WO2014055877A1 - Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates - Google Patents

Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates Download PDF

Info

Publication number
WO2014055877A1
WO2014055877A1 PCT/US2013/063480 US2013063480W WO2014055877A1 WO 2014055877 A1 WO2014055877 A1 WO 2014055877A1 US 2013063480 W US2013063480 W US 2013063480W WO 2014055877 A1 WO2014055877 A1 WO 2014055877A1
Authority
WO
WIPO (PCT)
Prior art keywords
mixture
cell
cytotoxic agent
binding agent
chromatography
Prior art date
Application number
PCT/US2013/063480
Other languages
English (en)
French (fr)
Inventor
Xiaoxi Kevin CHEN
Xinfang LI
Original Assignee
Immunogen, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US14/430,701 priority Critical patent/US10035817B2/en
Priority to RU2015116882A priority patent/RU2661083C2/ru
Priority to HK16101357.7A priority patent/HK1213288A1/zh
Priority to EP13844268.6A priority patent/EP2904089A4/en
Priority to SG11201502429YA priority patent/SG11201502429YA/en
Priority to AU2013326881A priority patent/AU2013326881B2/en
Priority to CN201380061552.7A priority patent/CN105209592A/zh
Priority to NZ707091A priority patent/NZ707091A/en
Priority to JP2015535823A priority patent/JP6345181B2/ja
Application filed by Immunogen, Inc. filed Critical Immunogen, Inc.
Priority to MX2015004257A priority patent/MX359599B/es
Priority to IN3202DEN2015 priority patent/IN2015DN03202A/en
Priority to CA 2886993 priority patent/CA2886993A1/en
Publication of WO2014055877A1 publication Critical patent/WO2014055877A1/en
Priority to IL238110A priority patent/IL238110B/en
Priority to ZA201502992A priority patent/ZA201502992B/en
Priority to US16/023,005 priority patent/US20190031712A1/en
Priority to AU2018241056A priority patent/AU2018241056A1/en
Priority to IL268378A priority patent/IL268378A/en

Links

Classifications

    • BPERFORMING OPERATIONS; TRANSPORTING
    • B01PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01DSEPARATION
    • B01D15/00Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08Selective adsorption, e.g. chromatography
    • B01D15/26Selective adsorption, e.g. chromatography characterised by the separation mechanism
    • B01D15/265Adsorption chromatography
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68033Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6867Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of a blood cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B01PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01DSEPARATION
    • B01D15/00Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08Selective adsorption, e.g. chromatography
    • B01D15/26Selective adsorption, e.g. chromatography characterised by the separation mechanism
    • B01D15/32Bonded phase chromatography
    • B01D15/325Reversed phase
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B01PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01DSEPARATION
    • B01D15/00Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08Selective adsorption, e.g. chromatography
    • B01D15/26Selective adsorption, e.g. chromatography characterised by the separation mechanism
    • B01D15/32Bonded phase chromatography
    • B01D15/325Reversed phase
    • B01D15/327Reversed phase with hydrophobic interaction
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B01PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01DSEPARATION
    • B01D15/00Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08Selective adsorption, e.g. chromatography
    • B01D15/26Selective adsorption, e.g. chromatography characterised by the separation mechanism
    • B01D15/36Selective adsorption, e.g. chromatography characterised by the separation mechanism involving ionic interaction, e.g. ion-exchange, ion-pair, ion-suppression or ion-exclusion
    • B01D15/361Ion-exchange
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B01PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01DSEPARATION
    • B01D15/00Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
    • B01D15/08Selective adsorption, e.g. chromatography
    • B01D15/26Selective adsorption, e.g. chromatography characterised by the separation mechanism
    • B01D15/38Selective adsorption, e.g. chromatography characterised by the separation mechanism involving specific interaction not covered by one or more of groups B01D15/265 and B01D15/30 - B01D15/36, e.g. affinity, ligand exchange or chiral chromatography
    • B01D15/3804Affinity chromatography
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B01PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
    • B01DSEPARATION
    • B01D71/00Semi-permeable membranes for separation processes or apparatus characterised by the material; Manufacturing processes specially adapted therefor
    • B01D71/06Organic material
    • B01D71/30Polyalkenyl halides
    • B01D71/32Polyalkenyl halides containing fluorine atoms
    • B01D71/34Polyvinylidene fluoride
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/14Extraction; Separation; Purification
    • C07K1/16Extraction; Separation; Purification by chromatography
    • C07K1/18Ion-exchange chromatography

Definitions

  • nucleotide/amino acid sequence listing submitted concurrently herewith and identified as follows: One 8,259 Byte ASCII (Text) file named "714287SequenceListing.TXT,” created on October 3, 2013.
  • Antibody-drug conjugates which are useful for the treatment of cancer and other diseases are commonly composed of three distinct elements: a cell-binding agent; a linker; and a cytotoxic agent.
  • One of the commonly used manufacturing processes comprises a modification step, in which the cell-binding agent is reacted with a bifunctional linker to form a cell-binding agent covalently attached to a linker having a reactive group, a purification step in which the modified antibody is purified from the other components of the
  • modification reaction a conjugation step, in which the modified cell-binding agent is reacted with a cytotoxic agent to form a covalent chemical bond from the linker (using the reactive group) to the cytotoxic agent, and a second purification step, in which the conjugate is purified from the other components of the conjugation reaction.
  • conjugates produced by these processes comprise an increased amount of impurities, including free cytotoxic agent (e.g., cytotoxic agent dimer related species) and/or high molecular weight species (e.g., dimers and other higher order aggregates).
  • free cytotoxic agent e.g., cytotoxic agent dimer related species
  • high molecular weight species e.g., dimers and other higher order aggregates.
  • Current purification methods employed in the art such as tangential flow filtration and adsorptive chromatography, do not efficiently remove these impurities without significantly decreasing the yield and/or are cumbersome for large scale manufacturing processes.
  • the invention provides processes for preparing purified cell-binding agent cytotoxic agent conjugates comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a polyvinyl difluoride (PVDF) membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
  • PVDF polyvinyl difluoride
  • the present invention also includes a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent prepared according to the processes described herein.
  • Figures 1 A-B are chromatograms depicting the species present in an antibody- SMCC-DM1 conjugate reaction mixture before ( Figure 1 A) and after ( Figure IB) PVDF filtration.
  • Figure 2 is a line graph depicting the percent of DM1 dimer species (y-axis) present in an antibody-SMCC-DMl conjugate reaction mixture before and after filtration through multiple PVDF membranes (x-axis).
  • conjugates comprising a cell- binding agent, such as an antibody, chemically coupled to a cytotoxic agent typically are prepared by modifying an antibody with a bifunctional crosslinking reagent at a low pH (i.e., pH 7.0 or below), purifying the antibody having linkers bound thereto, conjugating a cytotoxic agent to the antibody having linkers bound thereto, and purifying the antibody- cytotoxic agent conjugate.
  • a bifunctional crosslinking reagent at a low pH (i.e., pH 7.0 or below)
  • methods have been developed to produce conjugates of increased stability by maximizing the amount of linker stably bound to the cell-binding agent and minimizing undesirable side reactions that lead to conjugate instability.
  • conjugates of increased stability it has been discovered that these processes result in conjugates having an increased levels of impurities, such as free cytotoxic agent (e.g., cytotoxic agent dimer related species) and/or high molecular weight species (e.g., dimers and other higher order aggregates).
  • impurities such as free cytotoxic agent (e.g., cytotoxic agent dimer related species) and/or high molecular weight species (e.g., dimers and other higher order aggregates).
  • Current purification methods employed in the art such as tangential flow filtration and adsorptive chromatography, do not efficiently remove these impurities without significantly decreasing the yield and/or are cumbersome for large scale manufacturing processes.
  • PVDF polyvinyl difluoride
  • a polyvinyl difluoride (PVDF) membrane can be used to remove at least a portion of the impurities from a mixture comprising a cell- binding agent cytotoxic agent conjugate.
  • free cytotoxic agent e.g., cytotoxic agent dimer related species
  • the invention provides processes for manufacturing cell-binding agent-cytotoxic agent conjugates of increased purity and stability comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane.
  • the invention provides a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
  • the PVDF membrane can be used to remove a variety of impurities commonly found in a mixture comprising a cell-binding agent cytotoxic agent conjugate.
  • the PVDF membrane can be used to remove one or more impurities selected from the group of cytotoxic agent dimers, aggregates of the cell-binding agent cytotoxic agent conjugate, free cytotoxic agent, unconjugated linker, and mixtures thereof.
  • the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises cytotoxic agent dimers as an impurity, and the PVDF membrane removes some portion of the cytotoxic agent dimers from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
  • the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises aggregates of the cell- binding agent cytotoxic agent conjugate as an impurity, and the PVDF membrane removes some portion of the aggregates of the cell-binding agent cytotoxic agent from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
  • the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises free cytotoxic agent as an impurity, and the PVDF membrane removes some portion of the free cytotoxic agent from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
  • the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises unconjugated linker as an impurity, and the PVDF membrane removes some portion of the unconjugated linker from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
  • the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises cytotoxic agent dimers chemically coupled to each other through a linker (e.g., DM1-MCC-DM1 , DM1-SPP-DM1, or DMl-CXl-l-DMl) as an impurity, and the PVDF membrane removes some portion of the cytotoxic agent dimers chemically coupled to each other through a linker (e.g., DM1-MCC-DM1, DM1-SPP-DM1, or DMl-CXl-1- DM1) from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
  • a linker e.g., DM1-MCC-DM1 , DM1-SPP-DM1, or DMl-CXl-1- DM1
  • the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises cytotoxic agent dimers that are not chemically coupled to each other through a linker (e.g., DM1 -DM1) as an impurity, and the PVDF membrane removes some portion of the cytotoxic agent dimers that are not chemically coupled to each other through a linker (e.g., DM1 -DM1) from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
  • a linker e.g., DM1 -DM1
  • the resulting purified cell-binding agent cytotoxic agent conjugate comprises a reduced level of at least one or more impurities as compared to the level of the one or more impurities in the mixture prior to subjecting the mixture to the PVDF membrane.
  • the PVDF membrane removes at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100% of the one or more impurities in the mixture as compared to the level of the one or more impurities in the mixture prior to subjecting the mixture to the PVDF membrane.
  • the PVDF membrane removes about 10% to about 100%, about 10% to about 90%, about 20% to about 100%, about 20% to about 90%, about 20% to about 80%, about 30% to about 100%, about 30% to about 90%, about 30% to about 80%, about 40% to about 80%, about 40% to about 90%, about 40% to about 100%, about 50% to about 80%, about 50% to about 90%, about 50% to about 100% (e.g., about 60% to about 90%, about 70% to about 90%), about 60% to about 100%, about 70% to about 100%, about 80% to about 100%, about 90% to about 100%, or about 95% to about 100% (e.g., about 96% to about 100%, about 97% to about 100%, about 98% to about 100%, about 99% to about 100%, about 95% to about 96%, about 95% to about 97%, about 95% to about 98%, or about 95% to about 99%) of the one or more impurities in the mixture as compared to the level of the one or more impurities in the mixture prior to subjecting the mixture to the PVDF membrane.
  • the pH of the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities is adjusted prior to subjecting the mixture to a PVDF membrane.
  • the pH of the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities preferably is about 4 to about 9 (e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6 to about 7, about 6.5 to about 7.5, about 7 to about 8, about 8 to about 9, about 4.5 to about 6, or about 4.5 to about 5).
  • the pH of the mixture is about 6 to about 6.5 (e.g., a pH of 5.5 to 7, a pH of 5.7 to 6.8, a pH of 5.8 to 6.7, a pH of 5.9 to 6.6, or a pH of 6 to 6.5), a pH of about 6 or below (e.g., a pH of about 4 to 6, about 4 to about 5.5, about 4 to about 4.5, about 4 to about 5, about 5 to 6), or a pH of about 6.5 or greater (e.g., a pH of 6.5 to about 9, about 6.5 to about 7, about 7 to about 9, about 7.5 to about 9, or 6.5 to about 8).
  • the pH of the mixture is greater than 7.5 (e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4, about 7.8 to about 8.2, about 8 to about 9, or about 8 to about 8.5).
  • the pH of the mixture can be a pH of 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, or 9.
  • the pH of the mixture is about 4.8 (e.g., about 4.5 to about 5, about 4.6 to about 5, or about 4.7 to about 4.9).
  • PVDF membranes are known in the art and can be used in any combination.
  • the PVDF membrane has a pore size of 0.22 microns. In another embodiment, the PVDF membrane has a pore size of 0.45 microns. In another embodiment, the PVDF membrane is a dual layer membrane having a pore size of 0.45 and 0.22 microns (i.e., a dual layer 0.45/0.22 micron pore size membrane pore size membrane).
  • the PVDF membrane is gamma irradiated. In other embodiments, the PVDF membrane is not gamma irradiated.
  • the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, wherein the modification reaction and the conjugation reaction are combined into a single step, followed by a purification step (i.e., the one-step process described in U.S. Patent Application
  • the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane either before or after the purification step.
  • the one-step process comprises contacting a cell-binding agent (e.g., an antibody) with a cytotoxic agent to form a first mixture comprising the cell-binding agent and the cytotoxic agent, and then contacting the first mixture comprising the cell-binding agent and the cytotoxic agent with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9 to provide a second mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities (e.g., free cytotoxic agent and reaction by-products), wherein the cell- binding agent is chemically coupled through the linker to the cytotoxic agent.
  • a cell-binding agent e.g., an antibody
  • the second mixture is then subjected to purification to provide a purified cell-binding agent cytotoxic agent conjugate.
  • the second mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities is subjected to a PVDF membrane before the purification step, after the purification step, or both.
  • the one-step reaction preferably is performed at a pH of about 4 to about pH 9 (e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6 to about 7, about 6 to about 8, about 6 to about 9, or about 6.5 to about 7.5).
  • the reaction is performed at a pH of about 6 to about 8 (e.g., a pH of about 6, about 6.5, about 7, about 7.5, or about 8).
  • the reaction is performed at a pH of about 7.1, about 7.2, about 7.3, about 7.4, about 7.5, about 7.6, about 7.7, about 7.8, about 7.9, about 8, about 8.1, about 8.2, about 8.3, about 8.4, about 8.5, about 8.6, about 8.7, about 8.8, about 8.9, or about 9.
  • the reaction is performed at a pH of about 7.5 to about 9, about 7.5 to about 8.5, about 7.5 to about 8, about 7.8 to about 9, about 7.8 to about 8.5, about 7.8 to about 8, about 8 to about 9, about 8 to about 8.5, or about 8.5 to about 9.
  • reaction is performed at a pH of about 7.8 (e.g., a pH of 7.6 to 8.0 or a pH of 7.7 to 7.9).
  • modification reaction is performed at a pH of about 8 (e.g., a pH of 7.8 to 8.2 or a pH of 7.9 to 8.1).
  • the reaction is performed at a pH that is greater than 7.5 (e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4, about 7.8 to about 8.2, about 8 to about 9, or about 8 to about 8.5).
  • 7.5 e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4, about 7.8 to about 8.2, about 8 to about 9, or about 8 to about 8.5.
  • the contacting is effected by providing the cell-binding agent, then contacting the cell-binding agent with the cytotoxic agent to form a first mixture comprising the cell-binding agent and the cytotoxic agent, and then contacting the first mixture comprising the cell-binding agent and the cytotoxic agent with the bifunctional crosslinking reagent.
  • the cell-binding agent is provided in a reaction vessel, the cytotoxic agent is added to the reaction vessel (thereby contacting the cell-binding agent), and then the bifunctional crosslinking reagent is added to the mixture comprising the cell-binding agent and the cytotoxic agent (thereby contacting the mixture comprising the cell-binding agent and the cytotoxic agent).
  • the cell- binding agent is provided in a reaction vessel, and the cytotoxic agent is added to the reaction vessel immediately following providing the cell-binding agent to the vessel.
  • the cell-binding agent is provided in a reaction vessel, and the cytotoxic agent is added to the reaction vessel after a time interval following providing the cell-binding agent to the vessel (e.g., about 5 minutes, about 10 minutes, about 20 minutes, about 30 minutes, about 40 minutes, about 50 minutes, about 1 hour, about 1 day or longer after providing the cell-binding agent to the space).
  • the cytotoxic agent can be added quickly (i.e., within a short time interval, such as about 5 minutes, about 10 minutes) or slowly (such as by using a pump).
  • the mixture comprising the cell-binding agent and the cytotoxic agent can be then contacted with the bifunctional crosslinking reagent either immediately after contacting the cell-binding agent with the cytotoxic agent or at some later point (e.g., about 5 minutes to about 8 hours or longer) after contacting the cell-binding agent with the cytotoxic agent.
  • the bifunctional crosslinking reagent is added to the mixture comprising the cell-binding agent and the cytotoxic agent immediately after the addition of the cytotoxic agent to the reaction vessel comprising the cell-binding agent.
  • the mixture comprising the cell-binding agent and the cytotoxic agent can be contacted with the bifunctional crosslinking reagent at about 5 minutes, about 10 minutes, about 20 minutes, about 30 minutes, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, or longer after contacting the cell-binding agent with the cytotoxic agent.
  • the cytotoxic agent and the bifunctional agent are added through multiple cycles (e.g., 1, 2, 3, 4, 5 or more cycles).
  • the invention provides a process comprising the steps of: a) contacting a cell-binding agent with a cytotoxic agent to form a first mixture comprising the cell-binding agent and the cytotoxic agent; and then contacting the first mixture with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9 to provide a second mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities (e.g., free cytotoxic agent and reaction by-products), wherein the cell-binding agent is chemically coupled through the linker to the cytotoxic agent; b) contacting the second mixture with the cytotoxic agent to form a third mixture; and then contacting the third mixture with the bifunctional crosslinking reagent at a pH of about 4 to about 9 to provide a fourth mixture;
  • step b) is carried out after a time interval (e.g., about 1 hour, about 2 hours, about 3 hours or longer) following step a).
  • step b) can be repeated several times (e.g., 1, 2, 3, 4 or more times) before step c) is carried out.
  • the additional step b) can be carried out after a time interval (e.g., about 1 hour, about 2 hours, about 3 hours or longer) following the initial step b).
  • the bifunctional crosslinking reagent is added before the complete addition of the cytotoxic agent.
  • the cytotoxic agent is added to the cell-binding agent continuously over a time interval (e.g., over about 5 minutes, about 10 minutes, about 30 minutes, about 1 hour, about 2 hours, about 3 hours, or longer) to form a mixture comprising the cell-binding agent and the cytotoxic agent.
  • the bifunctional crosslinking reagent is added to the mixture comprising the cell-binding agent and the cytotoxic agent, provided that at any time, the cytotoxic agent is in molar excess of the bifunctional crosslinking reagent.
  • the bifunctional crosslinking reagent is added continuously over a time interval (e.g., over about 5 minutes, about 10 minutes, about 30 minutes, about 1 hour, about 2 hours, about 3 hours, or longer).
  • the reaction is allowed to proceed for about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, or longer (e.g., about 30 hours, about 35 hours, about 40 hours, about 45 hours, or about 48 hrs).
  • the invention provides a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising contacting a cell-binding agent with a cytotoxic agent to form a first mixture comprising the cell-binding agent and the cytotoxic agent, then contacting the first mixture with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9, to provide a second mixture comprising the cell-binding agent cytotoxic agent conjugate comprising the cell- binding agent chemically coupled through the linker to the cytotoxic agent and one or more impurities; (b) subjecting the second mixture to a polyvinyl difluoride (PVDF) membrane to remove at least a portion of the impurities, thereby providing a purified second mixture of the cell-binding agent cytotoxic agent conjugate; and (c) subjecting the purified second mixture after step (b) to tangential flow filtration, selective precipitation, non-adsorp
  • PVDF polyvinyl di
  • chromatography adsorptive filtration, adsorptive chromatography, or a combination thereof, to further purify the cell-binding agent-cytotoxic agent conjugate from the impurities and thereby prepare a purified third mixture of the cell-binding agent-cytotoxic agent conjugate, wherein the purified third mixture comprises a reduced amount of the impurities as compared to the purified second mixture.
  • Any purification method described herein can be used in the inventive process.
  • tangential flow filtration, adsorptive chromatography, or non-adsorptive chromatography is utilized as the purification step.
  • contacting a cell-binding agent with a bifunctional crosslinking reagent produces a first mixture comprising the cell-binding agent having linkers bound thereto and one or more impurities (e.g., reactants and other by-products).
  • the first mixture comprises the cell-binding agent having linkers stably and unstably bound thereto and one or more impurities (e.g., reactants and other by-products).
  • a linker is "stably" bound to the cell-binding agent when the covalent bond between the linker and the cell-binding agent is not substantially weakened or severed under normal storage conditions over a period of time, which could range from a few months to a few years.
  • a linker is
  • the modification reaction preferably is performed at a pH of about 4 to about pH 9 (e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6 to about 7, about 6 to about 8, about 6 to about 9, or about 6.5 to about 7.5).
  • the modification reaction is performed at a pH of about 6 to about 8 (e.g., a pH of about 6, about 6.5, about 7, about 7.5, or about 8).
  • the modification reaction is performed at a pH of about 7.1, about 7.2, about 7.3, about 7.4, about 7.5, about 7.6, about 7.7, about 7.8, about 7.9, about 8, about 8.1, about 8.2, about 8.3, about 8.4, about 8.5, about 8.6, about 8.7, about 8.8, about 8.9, or about 9.
  • the modification reaction is performed at a pH of about 7.5 to about 9, about 7.5 to about 8.5, about 7.5 to about 8, about 7.8 to about 9, about 7.8 to about 8.5, about 7.8 to about 8, about 8 to about 9, about 8 to about 8.5, or about 8.5 to about 9.
  • the modification reaction is performed at a pH of about 7.8 (e.g., a pH of 7.6 to 8.0 or a pH of 7.7 to 7.9). In another embodiment, the modification reaction is performed at a pH of about 8 (e.g., a pH of 7.8 to 8.2 or a pH of 7.9 to 8.1). [0032] In another embodiment, the modification reaction is performed at a pH that is greater than 7.5 (e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4, about 7.8 to about 8.2, about 8 to about 9, or about 8 to about 8.5).
  • 7.5 e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4,
  • the inventive process comprises contacting a cell-binding agent with a bifunctional crosslinking reagent in a solution having a pH of 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, or 9.
  • purification of the modified cell-binding agent from impurities produced during the modification reaction is carried out by subjecting the mixture produced by the modification reaction (i.e., the first mixture) to a purification process.
  • the first mixture can be purified using tangential flow filtration (TFF), e.g., a membrane -based tangential flow filtration process, non-adsorptive chromatography, adsorptive chromatography, adsorptive filtration, or selective precipitation, or any other suitable purification process, as well as combinations thereof.
  • TMF tangential flow filtration
  • This first purification step provides a purified first mixture, i.e., an increased concentration of the cell-binding agents having linkers bound thereto and a decreased amount of unbound bifunctional crosslinking reagent, as compared to the first mixture prior to purification in accordance with the invention.
  • the first mixture is purified using tangential flow filtration or adsorptive chromatography (e.g., ion exchange chromatography, such as ceramic hydroxyapatite).
  • a cytotoxic agent is conjugated to the cell- binding agents having linkers bound thereto in the first purified mixture by reacting the cell- binding agents having linkers bound thereto with a cytotoxic agent in a solution having a pH from about 4 to about 9 to form a second mixture, wherein a second mixture comprising the cell-binding agent chemically coupled through the linker to the cytotoxic agent and one or more impurities (e.g., free cytotoxic agent and reaction by-products) is produced.
  • impurities e.g., free cytotoxic agent and reaction by-products
  • purification of the modified cell-binding agent may be omitted.
  • the first mixture comprising the cell-binding agent having linkers bound thereto, as well as reactants and other by-products, is not subjected to a purification process.
  • the cytotoxic agent may be added simultaneously with the crosslinking reagent or at some later point, e.g., 1, 2, 3, or more hours after addition of the crosslinking reagent to the cell-binding agent.
  • the modified cell-binding agent is conjugated to a cytotoxic agent (e.g., a maytansinoid) by reacting the modified cell-binding agent with the cytotoxic agent in a solution having a pH from about 4 to about 9, wherein the conjugation step results in formation of a mixture of stable cell-binding agent-cytotoxic agent conjugates, non-stable cell-binding agent-cytotoxic agent conjugates, non-conjugated cytotoxic agent (i.e., "free" cytotoxic agent), reactants, and by-products.
  • a cytotoxic agent e.g., a maytansinoid
  • the conjugation reaction preferably is performed at a pH of about 4 to about pH 9 (e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6.0 to about 7, or about 6.5 to about 7.5).
  • a pH of about 4 to about pH 9 e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6.0 to about 7, or about 6.5 to about 7.5.
  • the conjugation reaction is performed at a pH of about 6 to about 6.5 (e.g., a pH of 5.5 to 7, a pH of 5.7 to 6.8, a pH of 5.8 to 6.7, a pH of 5.9 to 6.6, or a pH of 6 to 6.5), a pH of about 6 or below (e.g., a pH of about 4 to 6, about 4 to about 5.5, about 5 to 6) or at a pH of about 6.5 or greater (e.g., a pH of 6.5 to about 9, about 6.5 to about 7, about 7 to about 9, about 7.5 to about 9, or 6.5 to about 8).
  • a pH of about 6 to about 6.5 e.g., a pH of 5.5 to 7, a pH of 5.7 to 6.8, a pH of 5.8 to 6.7, a pH of 5.9 to 6.6, or a pH of 6 to 6.5
  • a pH of about 6 or below e.g., a pH of about 4 to 6, about 4 to about 5.5, about 5 to 6
  • the conjugation reaction is performed at a pH of about 4 to a pH less than 6 or at a pH of greater than 6.5 to 9.
  • the conjugation step is performed at a pH of about 6.5 or greater, some sulfhydryl-containing cytotoxic agents may be prone to dimerize by disulfide-bond formation.
  • removal of trace metals and/or oxygen from the reaction mixture, as well as optional addition of antioxidants or the use of linkers with more reactive leaving groups, or addition of cytotoxic agent in more than one aliquot may be required to allow for efficient reaction in such a situation.
  • the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities is subjected to a purification step.
  • the conjugation mixture can be purified using tangential flow filtration (TFF), e.g., a membrane-based tangential flow filtration process, non-adsorptive chromatography, adsorptive chromatography, adsorptive filtration, or selective precipitation, or any other suitable purification process, as well as combinations thereof.
  • TMF tangential flow filtration
  • purification after the conjugation step enables the isolation of a purified conjugate comprising the cell-binding agent chemically coupled to the cytotoxic agent, wherein the conjugate has a reduced amount of impurities as compared to the conjugate prior to the purification step.
  • the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities is subjected to a PVDF membrane after the conjugation step and prior to the purification step in order to remove at least a portion of the impurities from the mixture prior to purification.
  • the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities is subjected to a PVDF membrane after the purification step in order to remove at least a portion of the impurities remaining in the mixture after purification.
  • the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, which process comprises a first purification step after the modification step and a second purification step after the conjugation step, wherein the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane either before or after the second purification step to remove at least a portion of the impurities from the mixture.
  • the invention provides a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising contacting a cell-binding agent with a bifunctional crosslinking reagent to covalently attach a linker to the cell-binding agent and thereby prepare a first mixture comprising cell-binding agents having linkers bound thereto, (b) subjecting the first mixture to tangential flow filtration, selective precipitation, non-adsorptive chromatography, adsorptive filtration, adsorptive chromatography, or a combination thereof and thereby prepare a purified first mixture of cell-binding agents having linkers bound thereto, (c) conjugating a cytotoxic agent to the cell-binding agents having linkers bound thereto in the purified first mixture by reacting the cell-binding agents having linkers bound thereto with a cytotoxic agent in a solution having a pH of about 4 to about 9 to prepare a second mixture comprising the cell-binding agent-cytotoxic agent conjugate comprising the cell-bind
  • any purification method described herein can be used in the inventive process.
  • tangential flow filtration (TFF, also known as cross flow filtration, ultrafiltration and diafiltration) and/or adsorptive chromatography resins are utilized in the purification steps.
  • the inventive process can comprise a first purification step using TFF after the modification step and a second purification step using TFF after the conjugation step.
  • the inventive process can comprise a first purification step using adsorptive chromatography after the modification step and a second purification step using adsorptive chromatography after the conjugation step.
  • the inventive process also can comprise a first purification step using adsorptive chromatography after the modification step and a second purification step using TFF after the conjugation step or a first purification step using TFF after the modification step and a second purification step using adsorptive chromatography after the conjugation step.
  • non-adsorptive chromatography is utilized as the purification step.
  • the inventive process can comprise a first purification step using non-adsorptive chromatography after the modification step and a second purification step using non-adsorptive chromatography after the conjugation step.
  • the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, wherein the first mixture comprising cell-binding agents having linkers bound thereto is not subjected to purification following the modification reaction and prior to the conjugation reaction, and wherein the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane.
  • the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, which process comprises a modification step, a conjugation step, and a first purification step after the conjugation step, wherein the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane either before or after the first purification step to remove at least a portion of the impurities from the mixture.
  • the invention provides process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising contacting a cell-binding agent with a bifunctional crosslinking reagent to covalently attach a linker to the cell-binding agent and thereby prepare a first mixture comprising cell-binding agents having linkers bound thereto, (b) conjugating a cytotoxic agent to the cell-binding agents having linkers bound thereto in the first mixture by reacting the cell-binding agents having linkers bound thereto with a cytotoxic agent to prepare a second mixture comprising the cell-binding agent-cytotoxic agent conjugate comprising the cell-binding agent chemically coupled through the linker to the cytotoxic agent and one or more impurities, (c) subjecting the second mixture to a polyvinyl difluoride (PVDF) membrane to remove at least a portion of the impurities, thereby providing a purified second mixture of the cell-binding agent cytotoxic agent conjugate; and (d) subjecting the purified
  • any purification method described herein can be used as the purification step following the conjugation reaction.
  • tangential flow filtration, adsorptive chromatography, or non-adsorptive chromatography is utilized as the purification step following the conjugation reaction.
  • the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, wherein the process comprises conjugating a pre-formed cytotoxic-agent-linker compound to a cell-binding agent, as described in U.S. Patent 6,441,163 and U.S. Patent Application Publication Nos.
  • a purification step followed by a purification step, and wherein the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane either before or after the purification step.
  • Any purification method described herein can be used in the inventive process.
  • tangential flow filtration, adsorptive chromatography, or non-adsorptive chromatography is utilized as the purification step.
  • the cytotoxic agent-linker compound is prepared by contacting a cytotoxic agent with a bifunctional crosslinking reagent comprising a linker to covalently attach the cytotoxic agent to the linker.
  • the cytotoxic agent-linker compound optionally is subjected to purification before contacting cytotoxic agent-linker compound with the cell-binding agent.
  • the inventive process described herein comprises two separate purification steps following the conjugation step.
  • the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities can be subjected to a PVDF membrane before either or both of the purification steps, or following the purification steps to remove at least a portion of the impurities from the mixture.
  • Any purification method described herein can be used as the purification steps following the conjugation reaction. In a preferred embodiment, tangential flow filtration, adsorptive chromatography, non-adsorptive chromatography, or a
  • TFF systems Any suitable TFF systems may be utilized for purification, including a Pellicon type system (Millipore, Billerica, MA), a Sartocon Cassette system (Sartorius AG,
  • Any suitable adsorptive chromatography resin may be utilized for purification.
  • Preferred adsorptive chromatography resins include hydroxyapatite chromatography, hydrophobic charge induction chromatography (HCIC), hydrophobic interaction
  • hydroxyapatite resins include ceramic hydroxyapatite (CHT Type I and Type II, Bio-Rad Laboratories, Hercules, CA), HA Ultrogel hydroxyapatite (Pall Corp., East Hills, NY), and ceramic fluoroapatite (CFT Type I and Type II, Bio-Rad
  • HCIC resin An example of a suitable HCIC resin is MEP Hypercel resin (Pall Corp., East Hills, NY).
  • suitable HIC resins include Butyl-Sepharose, Hexyl-Sepaharose, Phenyl-Sepharose, and Octyl Sepharose resins (all from GE Healthcare, Piscataway, NJ), as well as Macro-prep Methyl and Macro-Prep t-Butyl resins (Biorad Laboratories, Hercules, CA).
  • Suitable ion exchange resins include SP- Sepharose, CM-Sepharose, and Q-Sepharose resins (all from GE Healthcare, Piscataway, NJ), and Unosphere S resin (Bio-Rad Laboratories, Hercules, CA).
  • suitable mixed mode ion exchangers include Bakerbond ABx resin (JT Baker, Phillipsburg NJ).
  • IMAC resins examples include Chelating Sepharose resin (GE Healthcare, Piscataway, NJ) and Profinity IMAC resin (Bio-Rad Laboratories, Hercules, CA).
  • suitable dye ligand resins include Blue Sepharose resin (GE Healthcare, Piscataway, NJ) and Affi-gel Blue resin (Bio-Rad Laboratories, Hercules, CA).
  • suitable affinity resins include Protein A Sepharose resin (e.g., MabSelect, GE Healthcare, Piscataway, NJ), where the cell-binding agent is an antibody, and lectin affinity resins, e.g.
  • Lentil Lectin Sepharose resin (GE Healthcare, Piscataway, NJ), where the cell-binding agent bears appropriate lectin binding sites.
  • an antibody specific to the cell-binding agent may be used.
  • Such an antibody can be immobilized to, for instance, Sepharose 4 Fast Flow resin (GE Healthcare, Piscataway, NJ).
  • suitable reversed phase resins include C4, C8, and C18 resins (Grace Vydac, Hesperia, CA).
  • Any suitable non-adsorptive chromatography resin may be utilized for any suitable non-adsorptive chromatography resin.
  • non-adsorptive chromatography resins include, but are not limited to, SEPHADEXTM G-25, G-50, G-100, SEPHACRYLTM resins (e.g., S-200 and S- 300), SUPERDEXTM resins (e.g., SUPERDEXTM 75 and SUPERDEXTM 200), BIO-GEL® resins (e.g., P-6, P-10, P-30, P-60, and P-100), and others known to those of ordinary skill in the art.
  • the process described herein further comprises subjecting the mixture to an ion exchange chromatography membrane to remove at least a portion of the impurities from the mixture.
  • the ion exchange chromatography membrane can be an anion exchange membrane, such as a Q membrane, or a cation exchange membrane, such as an S membrane.
  • the ion exchange chromatography membrane is an endotoxin removal exchange membrane.
  • the ion exchange chromatography membrane is an anion exchange membrane (e.g., a Q membrane).
  • An anion exchange membrane is a positively charged microporous membrane.
  • the positively charged anion exchange moiety is quaternary ammonium group.
  • the positively charged microporous membrane comprises a porous substrate and a crosslinked coating having pendant cationic groups (see for example, those described in US Patent Nos. 6,780,327, 6,851,561, 7,094,347, 7,223,341, 7,396,465).
  • the porous substrate is hydrophilic (e.g., polyethersulfone or cross-linked cellulose matrix).
  • the cationic group is quaternary ammonium group.
  • the anion exchange membrane is a positively charged microporous membrane comprising a porous polyethersulfone substrate and a crosslinked coating having pendant quaternary ammonium groups.
  • the mixture is subjected to a PVDF membrane prior to subjecting the mixture to an ion exchange chromatography membrane (e.g., a Q membrane or an S membrane).
  • an ion exchange chromatography membrane e.g., a Q membrane or an S membrane.
  • the mixture is subjected to an ion exchange chromatography membrane prior to subjecting the mixture to a PVDF membrane.
  • the mixture is subject to an ion exchange chromatography membrane before and after subjecting the mixture to a PVDF membrane.
  • the mixture is subjected to a PVDF membrane before and after subjection the mixture to an ion exchange chromatography membrane.
  • the inventive process comprises performing the reactions described herein (e.g., the modification reaction, the conjugation reaction, or the one-step reaction) at any suitable temperature known in the art.
  • the reaction can occur at about 20 °C or less (e.g., about -10° C (provided that the solution is prevented from freezing, e.g., by the presence of organic solvent used to dissolve the cytotoxic agent and the bifunctional crosslinking reagent) to about 20 °C, about 0 °C to about 18 °C, about 4 °C to about 16 °C), at room temperature (e.g., about 20 °C to about 30 °C or about 20 °C to about 25 °C), or at an elevated temperature (e.g., about 30 °C to about 37 °C).
  • room temperature e.g., about 20 °C to about 30 °C or about 20 °C to about 25 °C
  • an elevated temperature e.g., about 30 °C to about 37 °C.
  • the reaction occurs at a temperature of about 16 °C to about 24 °C (e.g., about 16 °C, about 17 °C, about 18 °C, about 19 °C, about 20 °C, about 21 °C, about 22 °C, about 23 °C, about 24 °C, or about 25 °C).
  • the inventive process described herein further comprises a quenching step to quench any unreacted cytotoxic agent and/or unreacted bifunctional crosslinking reagent.
  • the quenching step is performed prior to purification of the cell- binding agent cytotoxic agent.
  • the quenching step is performed after purification of the cell-biding agent cytotoxic agent.
  • the inventive process comprises (a) contacting a cell-binding agent with a cytotoxic agent to form a mixture comprising the cell-binding agent and the cytotoxic agent and then contacting the mixture comprising the cell-binding agent and the cytotoxic agent with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9 to provide a mixture comprising the cell-binding agent cytotoxic agent conjugate, wherein the cell-binding agent is chemically coupled through the linker to the cytotoxic agent, and impurities (e.g., free cytotoxic agent and reaction by-products), (b) subjecting the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane, (c) quenching the mixture after step (b) to quench any unreacted cytotoxic agent and/or unreacted bifunctional crosslinking reagent, (d) subjecting the quenched mixture to a PVDF membrane, (a)
  • the inventive process comprises (a) contacting a cell-binding agent with a cytotoxic agent to form a mixture comprising the cell-binding agent and the cytotoxic agent and then contacting the mixture comprising the cell-binding agent and the cytotoxic agent with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9 to provide a mixture comprising the cell-binding agent cytotoxic agent conjugate, wherein the cell- binding agent is chemically coupled through the linker to the cytotoxic agent, and impurities (e.g., free cytotoxic agent and reaction by-products), (b) subjecting the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane, (c) optionally quenching the mixture after step (b) to quench any unreacted cytotoxic agent and/or unreacted bifunctional crosslinking reagent, (d) optionally subjecting the quenched mixture to a PVDF
  • the mixture is quenched by contacting the mixture with a quenching reagent.
  • quenching reagent refers to a reagent that reacts with the free cytotoxic agent and/or the bifunctional crosslinking reagent.
  • maleimide or haloacetamide quenching reagents such as 4- maleimidobutyric acid, 3-maleimidopropionic acid, N-ethylmaleimide, iodoacetamide, or iodoacetamidopropionic acid, can be used to ensure that any unreacted group (such as thiol) in the cytotoxic agent is quenched.
  • the quenching step can help prevent the dimerization of the cytotoxic agent, particular the cytotoxic agent having an unreacted thiol group (such as DM1).
  • the dimerized cytotoxic agent can be difficult to remove.
  • the quenching step may also minimize any unwanted thiol-disulfide interchange reaction with the native antibody disulfide groups.
  • polar, charged thiol-quenching reagents such as 4- maleimidobutyric acid or 3-maleimidopropionic acid
  • the excess, unreacted cytotoxic agent is converted into a polar, charged, water-soluble adduct that can be easily separated from the covalently- linked conjugate during the purification step.
  • Quenching with non-polar and neutral thiol-quenching reagents can also be used.
  • the mixture is quenched by contacting the mixture with a quenching reagent that reacts with the unreacted bifunctional crosslinking reagent.
  • a quenching reagent that reacts with the unreacted bifunctional crosslinking reagent.
  • nucleophiles can be added to the mixture in order to quench any unreacted bifunctional crosslinking reagent.
  • the nucleophile preferably is an amino group containing nucleophile, such as lysine, taurine and hydroxylamine.
  • the mixture is quenched by lowering the pH of the mixture to about 5.0 (e.g., 4.8, 4.9, 5.0, 5.1 or 5.2).
  • the mixture is quenched by lowering the pH to less than 6.0, less than 5.5, less than 5.0, less than 4.8, less than 4.6, less than 4.4, less than 4.2, less than 4.0.
  • the pH is lowered to about 4.0 (e.g., 3.8, 3.9, 4.0, 4.1 or 4.2) to about 6.0 (e.g., 5.8, 5.9, 6.0, 6.1 or 6.2), about 4.0 to about 5.0, about 4.5 (e.g., 4.3, 4.4, 4.5, 4.6 or 4.7) to about 5.0.
  • the mixture is quenched by lowering the pH of the mixture to 4.8.
  • the reaction e.g., the modification step, the conjugation step, or the one-step reaction
  • the quenching reagent is added to the mixture about 1 hour to about 48 hours (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, or about 25 hours to about 48 hours) after the mixture comprising the cell-binding agent and the cytotoxic agent is contacted with the bifunctional crosslinking reagent.
  • the inventive process may optionally include the addition of sucrose to the reaction step (e.g., the modification step, the conjugation step, or the one-step reaction) to increase solubility and recovery of the cell-binding agent-cytotoxic agent conjugates.
  • the reaction step e.g., the modification step, the conjugation step, or the one-step reaction
  • sucrose is added at a concentration of about 0.1% (w/v) to about 20%> (w/v) (e.g., about 0.1% (w/v), 1% (w/v), 5% (w/v), 10% (w/v), 15% (w/v), or 20% (w/v)).
  • sucrose is added at a concentration of about 1% (w/v) to about 10%> (w/v) (e.g., about 0.5%> (w/v), about 1% (w/v), about 1.5% (w/v), about 2% (w/v), about 3% (w/v), about 4% (w/v), about 5%> (w/v), about 6%> (w/v), about 7% (w/v), about 8% (w/v), about 9% (w/v), about 10%) (w/v), or about 11% (w/v)).
  • the reaction step also can comprise the addition of a buffering agent. Any suitable buffering agent known in the art can be used.
  • Suitable buffering agents include, for example, a citrate buffer, an acetate buffer, a succinate buffer, and a phosphate buffer.
  • the buffering agent is selected from the group consisting of HEPPSO (N-(2-hydroxyethyl)piperazine-N'-(2-hydroxypropanesulfonic acid)), POPSO (piperazine-l,4-bis-(2-hydroxy-propane-sulfonic acid) dehydrate), HEPES (4-(2- hydroxyethyl)piperazine-l-ethanesulfonic acid), HEPPS (EPPS) (4-(2- hydroxyethyl)piperazine-l-propanesulfonic acid), TES (N-[tris(hydroxymethyl)methyl]-2- aminoethanesulfonic acid), and combinations thereof.
  • HEPPSO N-(2-hydroxyethyl)piperazine-N'-(2-hydroxypropanesulfonic acid)
  • POPSO piperazine-l,4-bis
  • the inventive process further comprises one or more (e.g., one, two, or three) holding steps to release the unstably bound linkers from the cell-binding agent.
  • the holding step comprises holding the mixture after modification of the cell-binding agent with a bifunctional crosslinking reagent, after conjugation of a cytotoxic agent to the cell-binding agents having linkers bound thereto, and/or after a purification step.
  • the holding step comprises holding the mixture after conjugation of a cytotoxic agent to the cell- binding agents having linkers bound thereto and/or after a purification step following the conjugation step, the mixture can be subjected to a PVDF membrane before or after the holding step, or both.
  • the process comprises subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a holding step after the conjugation step, wherein the mixture is subjected to a PVDF membrane after the holding step and prior to the purification step.
  • the process comprises subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a holding step after the conjugation step, wherein the mixture is subjected to a purification step after the holding step, followed by subjecting the mixture to a PVDF membrane.
  • the mixture optionally may be subjected to a second holding step prior to subjecting the mixture to the PVDF membrane.
  • the holding step comprises maintaining the solution at a suitable temperature (e.g., about 2° C to about 37° C) for a suitable period of time (e.g., about 1 hour to about 1 week) to release the unstably bound linkers from the cell-binding agent while not
  • a suitable temperature e.g., about 2° C to about 37° C
  • a suitable period of time e.g., about 1 hour to about 1 week
  • the holding step comprises maintaining the solution at a low temperature (e.g., about 2° C to about 10° C or about 4° C), at room temperature (e.g., about 20° C to about 30° C or about 20° C to about 25° C), or at an elevated temperature (e.g., about 30° C to about 37° C).
  • a low temperature e.g., about 2° C to about 10° C or about 4° C
  • room temperature e.g., about 20° C to about 30° C or about 20° C to about 25° C
  • an elevated temperature e.g., about 30° C to about 37° C.
  • the duration of the holding step depends on the temperature at which the holding step is performed.
  • the duration of the holding step can be substantially reduced by performing the holding step at elevated temperature, with the maximum temperature limited by the stability of the cell-binding agent-cytotoxic agent conjugate.
  • the holding step can comprise maintaining the solution for about 1 hour to about 1 day (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 14 hours, about 16 hours, about 18 hours, about 20 hours, about 22 hours, or about 24 hours), about 5 hours to about 1 week, about 12 hours to about 1 week (e.g., about 12 hours, about 16 hours, about 20 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, or about 7 days), for about 12 hours to about 1 week (e.g., about 12 hours, about 16 hours, about 20 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, or about 7 days), or about 1 day to about 1 week.
  • about 12 hours to about 1 week e.g., about 12 hours, about 16 hours, about 20 hours, about 24 hours, about 2 days, about 3
  • the holding step comprises maintaining the solution at a temperature of about 2 °C to about 8 °C for a period of at least about 12 hours for up to 1 day.
  • the pH value for the holding step preferably is about 4 to about 9 (e.g., about 4.5 to about 8.5 or about 5 to about 8).
  • the pH values for the holding step range from about 5 to about 7.5 (e.g., about 5.5 to about 7.5, about 6 to about 7.5, about 6.5 to about 7.5, about 7 to about 7.5, about 5 to about 7, about 5 to about 6.5, about 5 to about 5.5, about 5.5 to about 7, about 6 to about 6.5, or about 6 to about 7).
  • pH values for the holding step can be about 4, about 4.5, about 5, about 5.5, about 6, about 6.5, about 7, about 7.5, about 8, about 8.5, or about 9.
  • the holding step can be performed before or after the cell-binding agent is conjugated to the cytotoxic agent.
  • the holding step is performed directly after the modification of the cell-binding agent with the bifunctional crosslinking reagent.
  • the inventive process comprises a holding step after modification of the cell-binding agent with a bifunctional crosslinking reagent and before conjugation.
  • a purification step may be performed before the hold step and/or after the hold step, but prior to the conjugation step.
  • the holding step is performed directly after conjugation of the cytotoxic agent to the cell-binding agent having linkers bound thereto and prior to purification step.
  • the holding step is performed after the conjugation and purification steps and followed by an additional purification step.
  • the holding step can comprise incubating the mixture at a pH of about 5-7.5 or about 6.5-7.5 for about 1 hour to about 1 week at about 2 °C to about room temperature.
  • the invention provides a process for preparing a cell-binding agent-cytotoxic agent conjugate, which process comprises the addition of exogenous NHS.
  • Exogenous NHS refers to NHS that is added during the process from an external source, and does not refer to NHS that is generated during the modification reaction as a result of hydro lysis/amino lysis of the bifunctional linker.
  • the invention provides a process for preparing a cell-binding agent-cytotoxic agent conjugate, which process comprises the addition of about 0.1 mM to about 300 mM exogenous NHS.
  • the inventive process comprises the addition of about 0.1 mM, about 0.2 mM, about 0.3 mM, about 0.4 mM, about 0.5 mM, about 0.6 mM, about 0.7 mM, about 0.8 mM, about 0.9 mM, about 1.0 mM, about 1.1 mM, about 1.3 mM, about 1.5 mM, about 1.7 mM, about 1.9 mM, about 2.0 mM, about 2.1 mM, about 2.3 mM, about 2.5 mM, about 2.7 mM, about 2.9 mM, about 3.0 mM, about 3.1 mM, about 3.3 mM, about 3.5 mM, about 3.7 mM, about 3.9 mM, about 4.0 m
  • the inventive process comprises the addition of about 0.1 mM to about 5 mM, about 0.1 mM to about 10 mM, about 1.0 mM to about 5 mM, about 1.0 mM to about 10 mM, about 5.0 mM to about 10 mM, about 10 mM to about 20 mM, about 20 mM to about 30 mM, about 30 mM to about 40 mM, about 40 mM to about 50 mM, about 50 mM to about 60 mM, about 60 mM to about 70 mM, about 70 mM to about 80 mM, about 80 mM to about 90 mM, about 90 mM to about 100 mM, about 100 mM to about 110 mM, about 110 mM to about 120 mM, about 120 mM to about 130 mM, about 130 mM to about 140 mM, about 140 mM to about 150 mM, about 150 mM to about 160 mM
  • the inventive process comprises the addition of a molar ratio of exogenous NHS with respect to the amount of NHS generated during the
  • modification reaction as a result of hydro lysis/amino lysis of the bifunctional linker.
  • One of ordinary skill in the art can determine the amount of NHS generated during a particular modification as the amount of NHS generated is essentially the same as the amount of the bifunctional linker used.
  • the skilled person can then add a molar ratio of exogenous NHS to the reaction mixture with respect to the amount of NHS generated during the modification reaction.
  • about 2 to about 200 fold exogenous NHS is added with respect to the amount of NHS generated during the modification reaction.
  • the inventive process comprises adding about 2, about 5, about 10, about 15, about 20, about 25, about 50, about 100, or about 200 fold exogenous NHS with respect to the amount of NHS generated during the modification reaction.
  • the inventive process comprises the addition of a molar ratio of exogenous NHS with respect to the amount of the bifunctional linker.
  • the molar ratio of the exogenous NHS to the bifunctional crosslinking agent is about 0.5 to about 1000 (e.g., about 1 to about 900, about 5 to about 750, about 50 to about 500, about 100 to about 500, about 0.5 to about 500, or about 100 to about 1000.
  • the inventive process comprises about 0.5, about 1, about 2, about 5, about 10, about 15, about 20, about 25, about 50, about 100, about 200, about 300, about 400, about 500, about 600, about 700, about 800, about 900, or about 1000 fold NHS with respect to the amount of the bifunctional linker.
  • the inventive process comprises the addition of exogenous NHS at any point during a process preparing a cell-binding agent-cytotoxic agent conjugate.
  • the inventive process comprises the addition of exogenous NHS to the modification step (i.e., the step in which a cell-binding agent is reacted with a bifunctional linker), to the conjugation step (i.e., the step in which a modified cell-binding agent is reacted with a cytotoxic agent), to a purification step, or to a holding step between any of the foregoing steps.
  • the inventive process comprises the addition of exogenous NHS to the modification step (i.e., NHS is added to the modification reaction), to a holding step between the modification step and a purification step, to a holding step between the modification step and the conjugation step, to a purification step, to the conjugation step, to a holding step between the conjugation step and a purification step, and/or to a holding step between two purification steps.
  • exogenous NHS i.e., NHS is added to the modification reaction
  • the invention provides a process for preparing a cell-binding agent having a linker bound thereto, which process comprises contacting a cell-binding agent with a bifunctional crosslinking reagent in the presence of exogenous NHS to covalently attach a linker to the cell-binding agent and thereby prepare a mixture comprising cell- binding agents having linkers bound thereto.
  • the invention provides a process for preparing compositions of stable conjugates comprising a cell-binding agent chemically coupled to a cytotoxic agent, wherein the compositions are substantially free of unstable conjugates.
  • the invention provides a process for preparing cell-binding agent-cytotoxic agent conjugate of substantially high purity and stability.
  • Such compositions can be used for treating diseases because of the high purity and stability of the conjugates.
  • Compositions comprising a cell-binding agent, such as an antibody, chemically coupled to a cytotoxic agent, such as a maytansinoid, are described in, for example, U.S. Patent 7,374,762.
  • a cell- binding agent-cytotoxic agent conjugate of substantially high purity has one or more of the following features: (a) greater than about 90% (e.g., greater than or equal to about 91%>, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%), preferably greater than about 95%, of conjugate species are monomeric, (b) unconjugated linker level in the conjugate preparation or purified conjugate is less than about 10%> (e.g., less than or equal to about 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or 0%) (relative to total linker), (c) less than 10% of conjugate species are crosslinked (e.g., less than or equal to about 9%, 8%, 7%, 6%, 5%, 4%, 3%), 2%, 1%), or 0%)), (d) free cytotoxic agent level in the conjugate preparation or purified conjugate is less
  • Substantial increase in free cytotoxic agent level means that after certain storage time, the increase in the level of free cytotoxic agent is less than about 0.1%, about 0.2%>, about 0.3%>, about 0.4%>, about 0.5%, about 0.6%, about 0.7%, about 0.8%, about 0.9%, about 1.0%, about 1.1%, about 1.2%, about 1.3%, about 1.4%, about 1.5%, about 1.6%, about 1.7%, about 1.8%, about 1.9%, about 2.0%, about 2.2%, about 2.5%, about 2.7%, about 3.0%, about 3.2%, about 3.5%, about 3.7%, or about 4.0%.
  • the term "unconjugated linker” refers to the cell-binding agent that is covalently linked with the bifunctional crosslinking reagent, wherein the cell-binding agent is not covalently coupled to the cytotoxic agent through the linker of the bifunctional crosslinking reagent (i.e., the "unconjugated linker” can be represented by CBA-L, wherein CBA represents the cell-binding agent and L represents the bifunctional crosslinking reagent.
  • the cell-binding agent cytotoxic agent conjugate can be represented by CBA-L-D, wherein D represents the cytotoxic agent).
  • cytotoxic agent dimers refers to dimers comprising free cytotoxic agent, wherein the cytotoxic agent is not chemically coupled to the cell-binding agent through the linker.
  • the cytotoxic agent dimers are chemically coupled to each other through a linker (i.e., the "cytotoxic agent dimers” can be represented by D-L-D, wherein D represents the cytotoxic agent and L represents the bifunctional crosslinking reagent.
  • the cell-binding agent cytotoxic agent conjugate can be represented by CBA-L-D, wherein CBA represents the cell-binding agent).
  • the cytotoxic agent dimers are not chemically coupled to each other through a linker (i.e., the "cytotoxic agent dimers" can be represented by D-D, wherein D represents the cytotoxic agent.
  • the cell-binding agent cytotoxic agent conjugate can be represented by CBA-L-D, wherein CBA represents the cell-binding agent and L represents the bifunctional crosslinking reagent).
  • the cytotoxic agent dimers are chemically coupled to each other through a linker and some of the cytotoxic agent dimers are not chemically coupled to each other through a linker (i.e., the "cytotoxic agent dimers" can be represented by D-L-D and D-D, wherein D represents the cytotoxic agent and L represents the bifunctional crosslinking reagent).
  • the cytotoxic agent dimers are DM1 -DM1 dimer and DMl-MCC-DMl dimer, when the linker is SMCC and the cytotoxic agent is DM1.
  • the cytotoxic agent dimers are DM1 -DM1 dimers and DMl-SPP-DMl dimers, when the linker is SPP and the cytotoxic agent is DM1.
  • the cytotoxic agent dimers are DM1 -DM1 dimers and DM 1 -CXI -1 -DM1 dimers, when the linker is CXI- 1 and the cytotoxic agent is DM1.
  • the term "free cytotoxic agent” refers to any form of the cytotoxic agent that is not chemically coupled to the cell-binding agent through the linker (i.e., the "free cytotoxic agent” can include, but is not limited to, the cytotoxic agent alone represented by D, the cytotoxic agent coupled with the linker or linker derivatives (e.g. hydrolyzed derivatives) represented by D-L and cytotoxic agent dimers represented by D-D and D-L-D described above).
  • the free cytotoxic agent includes DM1, MCC-DM1, hydro- SMCC-DM1, SMCC-DM1, DM1-SPP, DM1 -TP A, DM1 -DM1, DM1-MCC-DM1, and DM1-SPP-DM1.
  • the term "aggregates of the cell-binding agent cytotoxic agent conjugate” refers to two or more cell-binding agent cytotoxic agent conjugates covalently or noncovalently coupled to each other (e.g., two or more cell-binding agent cytotoxic agent conjugates covalently coupled through the linker).
  • the average molar ratio of the cytotoxic agent to the cell- binding agent in the cell-binding agent cytotoxic agent conjugate is about 1 to about 10, about 2 to about 7, about 3 to about 5, about 2.5 to about 4.5 (e.g., about 2.5, about 2.6, about 2.7, about 2.8, about 2.9, about 3.0, about 3.1, about 3.3, about 3.4, about 3.5, about 3.6, about 3.7, about 3.8, about 3.9, about 4.0, about 4.1, about 4.2, about 4.3, about 4.4, about 4.5), about 3.0 to about 4.0, about 3.2 to about 4.2, about 4.5 to 5.5 (e.g., about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5.0, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5).
  • the cell-binding agent can be any suitable agent that binds to a cell, typically and preferably an animal cell (e.g., a human cell).
  • the cell-binding agent preferably is a peptide or a polypeptide or a glycotope.
  • Suitable cell-binding agents include, for example, antibodies (e.g., monoclonal antibodies and fragments thereof), interferons (e.g., alpha, beta, gamma), lymphokines (e.g., interleukin 2 (IL-2), interleukin 3 (IL-3), interleukin 4 (IL-4), interleukin 6 (IL-6), hormones (e.g., insulin, TRH (thyrotropin releasing hormone), MSH (melanocyte- stimulating hormone), steroid hormones, such as androgens and estrogens), growth factors and colony-stimulating factors, such as epidermal growth factor (EGF), transforming growth factor alpha (TGF-alpha), fibroblast growth factor (FGF), vascular endothelial growth factor (VEGF), colony stimulating factors (CSFs), such as G-CSF, M-CSF and GM-CSF (Burgess, Immunology Today 5: 155-158 (1984)), nutrient-transport molecules (e.g
  • the cell-binding agent binds to an antigen that is a polypeptide and may be a transmembrane molecule (e.g., receptor) or a ligand, such as a growth factor.
  • antigens include molecules such as renin; a growth hormone, including human growth hormone and bovine growth hormone; growth hormone releasing factor; parathyroid hormone; thyroid stimulating hormone; lipoproteins; alpha- 1 -antitrypsin; insulin A-chain; insulin B-chain; proinsulin; follicle stimulating hormone; calcitonin;
  • luteinizing hormone glucagon
  • clotting factors such as factor vmc, factor IX, tissue factor (TF), and von Willebrands factor
  • anti-clotting factors such as Protein C; atrial natriuretic factor; lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue- type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor; tumor necrosis factor-alpha and -beta; enkephalinase; RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-1 -alpha); a serum albumin, such as human serum albumin; Muellerian-inhibiting substance; relaxin A- chain; relaxin B-chain; prorelaxin; mouse gonadotropin-associated peptide; a microbial protein, such as beta-lactamase; DNase; IgE; a
  • osteoinductive factors immunotoxins; a bone morphogenetic protein (BMP); an interferon, such as interferon-alpha, -beta, and -gamma; colony stimulating factors (CSFs), e.g., M-CSF, GM-CSF, and G-CSF; interleukins (ILs), e.g., IL-1 to IL-10; superoxide dismutase; T-cell receptors; surface membrane proteins; decay accelerating factor; viral antigen such as, for example, a portion of the HIV envelope; transport proteins; homing receptors; addressins; regulatory proteins; integrins, such as CDl la, CDl lb, CDl lc, CD 18, an ICAM, VLA-4 and VCAM; a tumor associated antigen such as HER2, HER3 or HER4 receptor; endoglin, c-Met, IGF1R, prostate antigens such as PC A3, PSA, PSGR, NGEP, PSMA, PSCA, T
  • GM-CSF which binds to myeloid cells can be used as a cell-binding agent to diseased cells from acute myelogenous leukemia.
  • IL-2 which binds to activated T- cells can be used for prevention of transplant graft rejection, for therapy and prevention of graft- versus-host disease, and for treatment of acute T-cell leukemia.
  • MSH which binds to melanocytes, can be used for the treatment of melanoma, as can antibodies directed towards melanomas.
  • Folic acid can be used to target the folate receptor expressed on ovarian and other tumors.
  • Epidermal growth factor can be used to target squamous cancers such as lung and head and neck.
  • Somatostatin can be used to target neuroblastomas and other tumor types.
  • Cancers of the breast and testes can be successfully targeted with estrogen (or estrogen analogues) or androgen (or androgen analogues) respectively as cell-binding agents
  • antibody refers to any immunoglobulin, any immunoglobulin fragment, such as Fab, Fab', F(ab') 2 , dsFv, sFv, minibodies, diabodies, tribodies, tetrabodies (Parham, J. Immunol. 131 : 2895-2902 (1983); Spring et al. J. Immunol. 113: 470-478 (1974); Nisonoff et al. Arch. Biochem. Biophys. 89: 230-244 (1960), Kim et al, Mol.
  • any suitable antibody can be used as the cell-binding agent.
  • Any suitable antibody can be used as the cell-binding agent.
  • the selection of an appropriate antibody will depend upon the cell population to be targeted.
  • the type and number of cell surface molecules (i.e., antigens) that are selectively expressed in a particular cell population will govern the selection of an appropriate antibody for use in the inventive composition.
  • Cell surface expression profiles are known for a wide variety of cell types, including tumor cell types, or, if unknown, can be determined using routine molecular biology and histochemistry techniques.
  • the antibody can be polyclonal or monoclonal, but is most preferably a monoclonal antibody.
  • polyclonal antibodies refer to heterogeneous populations of antibody molecules, typically contained in the sera of immunized animals.
  • Monoclonal antibodies refer to homogenous populations of antibody molecules that are specific to a particular antigen.
  • Monoclonal antibodies are typically produced by a single clone of B lymphocytes ("B cells").
  • B cells B cells
  • Monoclonal antibodies may be obtained using a variety of techniques known to those skilled in the art, including standard hybridoma technology (see, e.g., Kohler and Milstein, Eur. J.
  • the hybridoma method of producing monoclonal antibodies typically involves injecting any suitable animal, typically and preferably a mouse, with an antigen (i.e., an "immunogen"). The animal is subsequently sacrificed, and B cells isolated from its spleen are fused with human myeloma cells.
  • an antigen i.e., an "immunogen”
  • hybrid cell is produced (i.e., a "hybridoma"), which proliferates indefinitely and continuously secretes high titers of an antibody with the desired specificity in vitro.
  • Any appropriate method known in the art can be used to identify hybridoma cells that produce an antibody with the desired specificity. Such methods include, for example, enzyme-linked immunosorbent assay (ELISA), Western blot analysis, and radioimmunoassay.
  • ELISA enzyme-linked immunosorbent assay
  • the population of hybridomas is screened to isolate individual clones, each of which secretes a single antibody species to the antigen. Because each hybridoma is a clone derived from fusion with a single B cell, all the antibody molecules it produces are identical in structure, including their antigen binding site and isotype.
  • Monoclonal antibodies also may be generated using other suitable techniques including EBV-hybridoma technology (see, e.g., Haskard and Archer, J. Immunol. Methods, 74(2): 361-67 (1984), and Roder et al, Methods Enzymol., 121 : 140-67 (1986)), bacteriophage vector expression systems (see, e.g., Huse et al, Science, 246: 1275-81 (1989)), or phage display libraries comprising antibody fragments, such as Fab and scFv (single chain variable region) (see, e.g., U.S. Patents 5,885,793 and 5,969,108, and International Patent Application Publications WO 92/01047 and WO
  • the monoclonal antibody can be isolated from or produced in any suitable animal, but is preferably produced in a mammal, more preferably a mouse or human, and most preferably a human. Methods for producing an antibody in mice are well known to those skilled in the art and are described herein. With respect to human antibodies, one of ordinary skill in the art will appreciate that polyclonal antibodies can be isolated from the sera of human subjects vaccinated or immunized with an appropriate antigen. Alternatively, human antibodies can be generated by adapting known techniques for producing human antibodies in non-human animals such as mice (see, e.g., U.S. Patents 5,545,806, 5,569,825, and
  • human antibodies While being the ideal choice for therapeutic applications in humans, human antibodies, particularly human monoclonal antibodies, typically are more difficult to generate than mouse monoclonal antibodies.
  • Mouse monoclonal antibodies induce a rapid host antibody response when administered to humans, which can reduce the therapeutic or diagnostic potential of the antibody-cytotoxic agent conjugate.
  • a monoclonal antibody preferably is not recognized as "foreign" by the human immune system.
  • phage display can be used to generate the antibody.
  • phage libraries encoding antigen-binding variable (V) domains of antibodies can be generated using standard molecular biology and recombinant DNA techniques (see, e.g., Sambrook et al. (eds.), Molecular Cloning, A Laboratory Manual, 3 rd Edition, Cold Spring Harbor Laboratory Press, New York (2001)). Phage encoding a variable region with the desired specificity are selected for specific binding to the desired antigen, and a complete human antibody is reconstituted comprising the selected variable domain.
  • Nucleic acid sequences encoding the reconstituted antibody are introduced into a suitable cell line, such as a myeloma cell used for hybridoma production, such that human antibodies having the characteristics of monoclonal antibodies are secreted by the cell (see, e.g., Janeway et al, supra, Huse et al, supra, and U.S. Patent 6,265,150).
  • a suitable cell line such as a myeloma cell used for hybridoma production
  • monoclonal antibodies can be generated from mice that are transgenic for specific human heavy and light chain immunoglobulin genes.
  • Such methods are known in the art and described in, for example, U.S. Patents 5,545,806 and 5,569,825, and Janeway et al, supra.
  • the antibody is a humanized antibody.
  • a humanized antibody As used herein, a
  • humanized antibody is one in which the complementarity-determining regions (CDR) of a mouse monoclonal antibody, which form the antigen binding loops of the antibody, are grafted onto the framework of a human antibody molecule. Owing to the similarity of the frameworks of mouse and human antibodies, it is generally accepted in the art that this approach produces a monoclonal antibody that is antigenically identical to a human antibody but binds the same antigen as the mouse monoclonal antibody from which the CDR sequences were derived. Methods for generating humanized antibodies are well known in the art and are described in detail in, for example, Janeway et al, supra, U.S. Patents 5,225,539, 5,585,089 and 5,693,761, European Patent No.
  • Humanized antibodies can also be generated using the antibody resurfacing technology described in U.S. Patent 5,639,641 and Pedersen et al, J. Mol. Biol., 235: 959- 973 (1994). While the antibody employed in the conjugate of the inventive composition most preferably is a humanized monoclonal antibody, a human monoclonal antibody and a mouse monoclonal antibody, as described above, are also within the scope of the invention.
  • Antibody fragments that have at least one antigen binding site, and thus recognize and bind to at least one antigen or receptor present on the surface of a target cell also are within the scope of the invention.
  • proteolytic cleavage of an intact antibody molecule can produce a variety of antibody fragments that retain the ability to recognize and bind antigens.
  • limited digestion of an antibody molecule with the protease papain typically produces three fragments, two of which are identical and are referred to as the Fab fragments, as they retain the antigen binding activity of the parent antibody molecule.
  • F(ab') 2 fragment Cleavage of an antibody molecule with the enzyme pepsin normally produces two antibody fragments, one of which retains both antigen-binding arms of the antibody molecule, and is thus referred to as the F(ab') 2 fragment.
  • Reduction of a F(ab') 2 fragment with dithiothreitol or mercaptoethylamine produces a fragment referred to as a Fab' fragment.
  • a single-chain variable region fragment (sFv) antibody fragment which consists of a truncated Fab fragment comprising the variable (V) domain of an antibody heavy chain linked to a V domain of a light antibody chain via a synthetic peptide, can be generated using routine recombinant DNA technology techniques (see, e.g., Janeway et al, supra).
  • disulfide-stabilized variable region fragments (dsFv) can be prepared by recombinant DNA technology (see, e.g., Reiter et al., Protein Engineering, 7: 697-704 (1994)).
  • Antibody fragments in the context of the invention are not limited to these exemplary types of antibody fragments.
  • Antibody fragments Any suitable antibody fragment that recognizes and binds to a desired cell surface receptor or antigen can be employed. Antibody fragments are further described in, for example, Parham, J. Immunol, 131 : 2895-2902 (1983), Spring et al., J. Immunol, 113: 470-478 (1974), and Nisonoff et al., Arch. Biochem. Biophys., 89: 230-244 (1960). Antibody-antigen binding can be assayed using any suitable method known in the art, such as, for example,
  • RIA radioimmunoassay
  • ELISA Western blot
  • immunoprecipitation immunoprecipitation
  • competitive inhibition assays see, e.g., Janeway et al, supra, and U.S. Patent Application Publication No. 2002/0197266 Al.
  • the antibody can be a chimeric antibody or an antigen binding fragment thereof.
  • chimeric it is meant that the antibody comprises at least two immunoglobulins, or fragments thereof, obtained or derived from at least two different species (e.g., two different immunoglobulins, such as a human immunoglobulin constant region combined with a murine immunoglobulin variable region).
  • the antibody also can be a domain antibody (dAb) or an antigen binding fragment thereof, such as, for example, a camelid antibody (see, e.g., Desmyter et al, Nature Struct.
  • a shark antibody such as, for example, a new antigen receptor (IgNAR) (see, e.g., Greenberg et al, Nature, 374: 168 (1995), and Stanfield et al, Science, 305: 1770-1773 (2004)).
  • IgNAR new antigen receptor
  • the monoclonal antibody J5 is a murine IgG2a antibody that is specific for Common Acute Lymphoblastic Leukemia Antigen (CALLA) (Ritz et al, Nature, 283: 583-585 (1980)), and can be used to target cells that express CALLA (e.g., acute lymphoblastic leukemia cells).
  • CALLA Common Acute Lymphoblastic Leukemia Antigen
  • the monoclonal antibody MY9 is a murine IgGl antibody that binds specifically to the CD33 antigen (Griffin et al, Leukemia Res., 8: 521 (1984)), and can be used to target cells that express CD33 (e.g., acute myelogenous leukemia (AML) cells).
  • AML acute myelogenous leukemia
  • the monoclonal antibody anti-B4 (also referred to as B4) is a murine IgGl antibody that binds to the CD 19 antigen on B cells (Nadler et al., J. Immunol. , 131 : 244-250 (1983)), and can be used to target B cells or diseased cells that express CD 19 (e.g., non- Hodgkin's lymphoma cells and chronic lymphoblastic leukemia cells).
  • N901 is a murine monoclonal antibody that binds to the CD56 (neural cell adhesion molecule) antigen found on cells of neuroendocrine origin, including small cell lung tumor, which can be used in the conjugate to target drugs to cells of neuroendocrine origin.
  • the J5, MY9, and B4 antibodies preferably are resurfaced or humanized prior to their use as part of the conjugate.
  • the anti-B4 antibody is huB4.
  • the anti-B4 antibody comprises a heavy chain and a light chain, wherein the heavy chain has the following sequence
  • the monoclonal antibody C242 binds to the CanAg antigen (see, e.g., U.S. Patent 5,552,293), and can be used to target the conjugate to CanAg expressing tumors, such as colorectal, pancreatic, non-small cell lung, and gastric cancers.
  • HuC242 is a humanized form of the monoclonal antibody C242 (see, e.g., U.S. Patent 5,552,293).
  • the hybridoma from which HuC242 is produced is deposited with ECACC identification Number 90012601.
  • HuC242 can be prepared using CDR-grafting methodology (see, e.g., U.S.
  • HuC242 can be used to target the conjugate to tumor cells expressing the CanAg antigen, such as, for example, colorectal, pancreatic, non-small cell lung, and gastric cancer cells.
  • an anti-MUC 1 antibody can be used as the cell-binding agent in the conjugate.
  • Anti-MUC 1 antibodies include, for example, anti-HMFG-2 (see, e.g., Taylor-Papadimitriou et al, Int. J. Cancer, 28: 17-21 (1981)), hCTMOl (see, e.g., van Hof et al, Cancer Res., 56: 5179-5185 (1996)), and DS6.
  • Prostate cancer cells also can be targeted with the conjugate by using an anti-prostate-specific membrane antigen (PSMA) as the cell-binding agent, such as J591 (see, e.g., Liu et al, Cancer Res., 57: 3629-3634 (1997)).
  • PSMA anti-prostate-specific membrane antigen
  • cancer cells that express the Her2 antigen such as breast, prostate, and ovarian cancers, can be targeted with the conjugate by using anti- HER2 antibodies, e.g., trastuzumab, as the cell-binding agent.
  • Cells that express epidermal growth factor receptor (EGFR) and variants thereof, such as the type III deletion mutant, EGFPvvIII, can be targeted with the conjugate by using anti-EGFR antibodies.
  • EGFR epidermal growth factor receptor
  • Anti-EGFR antibodies are described in International Patent Application Nos. PCT/US11/058385 and PCT/US11/058378.
  • Anti-EGFRvIII antibodies are described in U.S. Patents 7,736,644 and 7,628,986, and U.S. Patent Application Publications 2010/0111979; 2009/0240038;
  • Anti-IGF-IR antibodies that bind to insulin- like growth factor receptor such as those described in U.S. Patent 7,982,024, also can be used in the conjugate.
  • Antibodies that bind to CD27L, Cripto, CD138, CD38, EphA2, integrins, CD37, folate, CD20, PSGR, NGEP, PSCA, TMEFF2, STEAP1, endoglin, and Her3 also can be used in the conjugate.
  • the antibody is selected from the group consisting of huN901, anti-CD33 antibody (e.g., huMy9-6), huB4, huC242, an anti-HER2 antibody (e.g., trastuzumab), bivatuzumab, sibrotuzumab, rituximab, huDS6, anti-mesothelin antibodies described in International Patent Application Publication WO 2010/124797 (such as MF-T), anti-cripto antibodies described in U.S. Patent Application Publication 2010/0093980 (such as huB3F6), anti-CD138 antibodies described in U.S. Patent Application Publication 2007/0183971 (such as B-B4 or humanized B-B4 or nBT062), anti-EGFR antibodies described in International Patent Application Publications WO 2012/058592 and WO
  • 2012/058588 such as EGFR-7
  • anti-EGFRvIII antibodies described U.S. Patents 7,736,644 and 7,628,986 and U.S. Patent Application Publications 2010/0111979, 2009/0240038, 2009/0175887, 2009/0156790 and 2009/0155282, humanized EphA2 antibodies described in International Patent Application Publications WO 2011/039721 and WO 2011/039724 (such as 2H11R35R74); anti-CD38 antibodies described in International Patent Application
  • the antibody is not huN901, or CNT095.
  • the anti-CD37 antibody is huCD37-3, wherein the antibody comprises a variable heavy chain and a variable light chain, wherein the variable heavy chain has the following sequence
  • variable light chain has the following sequence
  • DIQMTQSPSSLSVSVGERVTITCRASENIRSNLAWYQQKPGKSPKLLVNVATNLADG VPSRFSGSGSGTDYSLKINSLQPEDFGTYYCQHYWGTTWTFGQGTKLEIKR (SEQ ID NO: 4).
  • the cell-binding agent preferably is an antibody
  • the cell-binding agent also can be a non-antibody molecule.
  • suitable non-antibody molecules include, for example, interferons (e.g., alpha, beta, or gamma interferon), lymphokines (e.g., interleukin 2 (IL-2), IL-3, IL-4, or IL-6), hormones (e.g., insulin), growth factors (e.g., EGF, TGF-alpha, FGF, and VEGF), colony-stimulating factors (e.g., G-CSF, M-CSF, and GM-CSF (see, e.g., Burgess, Immunology Today, 5: 155-158 (1984)), somatostatin, and transferrin (see, e.g., O'Keefe et al, J.
  • interferons e.g., alpha, beta, or gamma interferon
  • lymphokines
  • GM-CSF which binds to myeloid cells
  • IL-2 which binds to activated T-cells
  • EGF epidermal growth factor
  • Somatostatin can be used to target neuroblastoma cells and other tumor cell types.
  • the conjugate can comprise any suitable cytotoxic agent.
  • Suitable cytotoxic agents include, for example, maytansinoids and maytansinoid analogs, taxoids, CC-1065 and CC-1065 analogs, and dolastatin and dolastatin analogs.
  • the cytotoxic agent is a maytansinoid, including maytansinol and maytansinol analogs. Maytansinoids are compounds that inhibit microtubule formation and are highly toxic to mammalian cells.
  • Suitable maytansinol analogues include those having a modified aromatic ring and those having modifications at other positions.
  • Such maytansinoids are described in, for example, U.S. Patents 4,256,746, 4,294,757, 4,307,016, 4,313,946, 4,315,929, 4,322,348, 4,331,598, 4,361,650, 4,362,663, 4,364,866, 4,424,219, 4,371,533, 4,450,254, 5,475,092, 5,585,499, 5,846,545, and 6,333,410.
  • Examples of maytansinol analogs having a modified aromatic ring include:
  • Examples of maytansinol analogs having modifications of positions other than an aromatic ring include: (1) C-9-SH (U.S. Patent 4,424,219) (prepared by the reaction of maytansinol with H 2 S or P 2 S 5 ), (2) C-14-alkoxymethyl (demethoxy/CH 2 OR) (U.S. Patent 4,331,598), (3) C-14-hydroxymethyl or acyloxymethyl (CH 2 OH or CH 2 OAc) (U.S. Patent 4,450,254) (prepared from Nocardia), (4) C-15-hydroxy/acyloxy (U.S. Patent 4,364,866) (prepared by the conversion of maytansinol by Streptomyces), (5) C-15-methoxy (U.S.
  • Patents 4,313,946 and 4,315,929) isolated from Trewia nudiflora
  • (6) C-18-N-demethyl U.S. Patents 4,362,663 and 4,322,348
  • 4,5-deoxy U.S. Patent 4,371,533
  • the conjugate utilizes the thiol- containing maytansinoid DM1, also known as N 2 -deacetyl-N 2 -(3-mercapto-l-oxopropyl)- maytansine, as the cytotoxic agent.
  • DM1 is represented by formula (I):
  • the conjugate utilizes the thiol- containing maytansinoid DM4, also known as N 2 -deacetyl-N 2 -(4-methyl-4-mercapto-l- oxopentyl)-maytansine, as the cytotoxic agent.
  • DM4 is represented by formula (II):
  • maytansines may be used in the context of the invention, including, for example, thiol and disulfide-containing maytansinoids bearing a mono or di-alkyl substitution on the carbon atom bearing the sulfur atom.
  • Particularly preferred is a maytansinoid having at the C-3 position (a) C-14 hydroxymethyl, C-15 hydroxy, or C-20 desmethyl functionality, and (b) an acylated amino acid side chain with an acyl group bearing a hindered sulfhydryl group, wherein the carbon atom of the acyl group bearing the thiol functionality has one or two substituents, said substituents being CH 3 , C 2 H 5 , linear or branched alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, and further wherein one of the substituents
  • Ri and R 2 are each independently CH 3 , C 2 3 ⁇ 4, linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H,
  • A, B, D are cycloalkyl or cycloalkenyl having 3-10 carbon atoms, simple or substituted aryl, or heterocyclic aromatic, or heterocycloalkyl radical,
  • R 3 , R 4 , R 5 , 5, R 7 , Rs, R 9 , Rio, R 11 , and Ri 2 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic, or heterocycloalkyl radical,
  • 1, m, n, o, p, q, r, s, and t are each independently zero or an integer from 1 to 5, provided that at least two of 1, m, n, o, p, q, r, s and t are not zero at any one time, and wherein Z is H, SR or COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic, or heterocycloalkyl radical.
  • Preferred embodiments of formula (III) include compounds of formula (III) wherein (a) Ri is H, R 2 is methyl and Z is H, (b) Ri and R 2 are methyl and Z is H, (c) Ri is H,
  • R 2 is methyl, and Z is -SCH 3 , and (d) Ri and R 2 are methyl, and Z is -SCH 3 .
  • Such additional maytansines also include compounds represented by formula (IV-
  • Ri and R 2 are each independently CH 3 , C2H5, linear alkyl, or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H,
  • R 3 , R4, R 5 , 5, R7, and Rg are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical,
  • n are each independently an integer of from 1 to 5, and in addition n can be zero,
  • Z is H, SR, or COR wherein R is linear or branched alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical, and
  • Preferred embodiments of formulas (IV-L), (IV-D) and (IV-D,L) include compounds of formulas (IV-L), (IV-D) and (IV-D,L) wherein (a) Ri is H, R 2 is methyl, R 5 , R6, R7 , and Rs are each H, 1 and m are each 1, n is 0, and Z is H, (b) Ri and R 2 are methyl, R 5 , Re, R 7 , Rg are each H, 1 and m are 1 , n is 0, and Z is H, (c) Ri is H, R 2 is methyl, R 5 , R ⁇ ,
  • R 7 , and Rg are each H, 1 and m are each 1 , n is 0, and Z is -SCH 3 , or (d) Ri and R 2 are methyl, R 5 , 5, R7, Rs are each H, 1 and m are 1 , n is 0, and Z is -SCH 3 .
  • the cytotoxic agent is represented by formula (IV-L).
  • Additional preferred maytansines also include compounds represented by formula
  • Y represents (CR 7 R8)i(CR 5 R 6 ) m (CR 3 R 4 ) n CRiR 2 SZ
  • Ri and R 2 are each independently CH 3 , C2H5, linear alkyl, or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H,
  • R 3 , R 4 , R 5 , 5, R 7 , and Rg are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical,
  • n are each independently an integer of from 1 to 5, and in addition n can be zero, and
  • Z is H, SR or COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical.
  • Preferred embodiments of formula (V) include compounds of formula (V) wherein (a) Ri is H, R 2 is methyl, R 5 , 5, R 7 , and Rg are each H; 1 and m are each 1; n is 0; and Z is H, (b) Ri and R 2 are methyl; R 5 , 5, R 7 , Rs are each H, 1 and m are 1; n is 0; and Z is H, (c) Ri is H, R 2 is methyl, R 5 , 5, R 7 , and Rg are each H, 1 and m are each 1, n is 0, and Z is -SCH 3 , or (d) Ri and R 2 are methyl, R 5 , R ⁇ , R 7 , R 8 are each H, 1 and m are 1, n is 0, and Z is - SCH 3 .
  • Still further preferred maytansines include compounds represented by formula (VI-L), (VI-D), or (VI-D,L):
  • VI-L (VI-D) (VI-D, L)
  • Y 2 represents (CR 7 R 8 )i(CR 5 R 6 ) m (CR 3 R 4 ) n CRiR 2 SZ 2 ,
  • Ri and R 2 are each independently CH 3 , C 2 3 ⁇ 4, linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H,
  • R 3 , R 4 , R 5 , 5, R 7 , and Rg are each independently H, CH 3 , C 2 H 5 , linear cyclic alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical,
  • n are each independently an integer of from 1 to 5, and in addition n can be zero,
  • Z 2 is SR or COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical, and
  • May is a maytansinoid.
  • Additional preferred maytansines include compounds represented by formula (VII):
  • Ri and R 2 are each independently CH 3 , C 2 3 ⁇ 4, linear branched or alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H,
  • A, B, and D each independently is cycloalkyl or cycloalkenyl having 3 to 10 carbon atoms, simple or substituted aryl, or heterocyclic aromatic or heterocycloalkyl radical, wherein R 3 , R4, R 5 , 5, R7, Rs, R9, Rio, R11, and Ri 2 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical,
  • 1, m, n, o, p, q, r, s, and t are each independently zero or an integer of from 1 to 5, provided that at least two of 1, m, n, o, p, q, r, s and t are not zero at any one time, and wherein Z 2 is SR or -COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical.
  • Preferred embodiments of formula (VII) include compounds of formula (VII), wherein Ri is H and R 2 is methyl.
  • the cytotoxic agent used in the conjugate can be a taxane or derivative thereof.
  • Taxanes are a family of compounds that includes paclitaxel (Taxol®), a cytotoxic natural product, and docetaxel (Taxotere®), a semi-synthetic derivative, which are both widely used in the treatment of cancer. Taxanes are mitotic spindle poisons that inhibit the depolymerization of tubulin, resulting in cell death. While docetaxel and paclitaxel are useful agents in the treatment of cancer, their antitumor activity is limited because of their non-specific toxicity towards normal cells. Further, compounds like paclitaxel and docetaxel themselves are not sufficiently potent to be used in conjugates of cell-binding agents.
  • a preferred taxane for use in the preparation of a cytotoxic conjugate is the taxane of formula (VIII):
  • the cytotoxic agent also can be CC-1065 or a derivative thereof.
  • CC-1065 is a potent anti-tumor antibiotic isolated from the culture broth of Streptomyces zelensis.
  • CC- 1065 is about 1000-fold more potent in vitro than commonly used anti-cancer drugs, such as doxorubicin, methotrexate, and vincristine (Bhuyan et al, Cancer Res., 42: 3532-3537 (1982)).
  • CC-1065 and its analogs are disclosed in U.S. Patents 5,585,499, 5,846,545, 6,340,701, and 6,372,738.
  • cytotoxic potency of CC-1065 has been correlated with its alkylating activity and its DNA-binding or DNA-intercalating activity. These two activities reside in separate parts of the molecule.
  • the alkylating activity is contained in the cyclopropapyrrolomdole (CPI) subunit and the DNA-binding activity resides in the two pyrroloindole subunits of CC-1065.
  • CPI cyclopropapyrrolomdole
  • DNA-binding activity resides in the two pyrroloindole subunits of CC-1065.
  • CC-1065 analogs are known in the art and also can be used as the cytotoxic agent in the conjugate (see, e.g., Warpehoski et al, J. Med. Chem., 31: 590-603 (1988)).
  • CC-1065 analogs have been developed in which the CPI moiety is replaced by a cyclopropabenzindole (CBI) moiety (Boger et al, J. Org. Chem., 55: 5823- 5833 (1990), and Boger et al, Bioorg. Med. Chem. Lett., 1: 115-120 (1991)).
  • CBI cyclopropabenzindole
  • CC- 1065 analogs maintain the high in vitro potency of the parental drug, without causing delayed toxicity in mice.
  • these compounds are alkylating agents that covalently bind to the minor groove of DNA to cause cell death.
  • CC-1065 analogs can be greatly improved by changing the in vivo distribution through targeted delivery to a tumor site, resulting in lower toxicity to non-targeted tissues, and thus, lower systemic toxicity.
  • conjugates of analogs and derivatives of CC-1065 with cell-binding agents that specifically target tumor cells have been generated (see, e.g., U.S. Patents 5,475,092, 5,585,499, and 5,846,545).
  • conjugates typically display high target-specific cytotoxicity in vitro, and anti-tumor activity in human tumor xenograft models in mice (see, e.g., Chari et al., Cancer Res., 55: 4079-4084 (1995)).
  • Drugs such as methotrexate, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil, calicheamicin, tubulysin and tubulysin analogs, duocarmycin and duocarmycin analogs, dolastatin and dolastatin analogs also can be used as the cytotoxic agents of the invention.
  • Doxarubicin and daunorubicin compounds can also be used as the cytotoxic agent.
  • the cell-binding agent cytotoxic agent conjugates may be prepared by in vitro methods.
  • a linking group is used. Suitable linking groups are well known in the art and include disulfide groups, acid labile groups, photolabile groups, peptidase labile groups, and esterase labile groups, as well as
  • the cell-binding agent is modified by reacting a bifunctional crosslinking reagent with the cell-binding agent, thereby resulting in the covalent attachment of a linker molecule to the cell-binding agent.
  • a bifunctional crosslinking reagent refers to a reagent that possesses two reactive groups; one of which is capable of reacting with a cell-binding agent, while the other one is capable of reacting with the cytotoxic agent to link the cell-binding agent with the cytotoxic agent, thereby forming a conjugate.
  • any suitable bifunctional crosslinking reagent can be used in connection with the invention, so long as the linker reagent provides for retention of the therapeutic, e.g., cytotoxicity, and targeting characteristics of the cytotoxic agent and the cell-binding agent, respectively, while providing an acceptable toxicity profile.
  • the linker molecule joins the cytotoxic agent to the cell-binding agent through chemical bonds (as described above), such that the cytotoxic agent and the cell-binding agent are chemically coupled (e.g., covalently bonded) to each other.
  • the cell binding agent is chemically coupled to the cytotoxic agent via chemical bonds selected from the group consisting of disulfide bonds, acid labile bonds, photolabile bonds, peptidase labile bonds, and esterase labile bonds.
  • the bifunctional crosslinking reagent comprises non-cleavable linkers.
  • a non-cleavable linker is any chemical moiety that is capable of linking a cytotoxic agent, such as a maytansinoid, a taxane, or a CC-1065 analog, to a cell-binding agent in a stable, covalent manner.
  • non-cleavable linkers are substantially resistant to acid- induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the cytotoxic agent or the cell-binding agent remains active.
  • Suitable crosslinking reagents that form non-cleavable linkers between a cytotoxic agent and the cell-binding agent are well known in the art.
  • the cytotoxic agent is chemically coupled to the cell-binding agent through a thioether bond.
  • the cytotoxic agent is linked to the cell-binding agent through an amide bond.
  • non-cleavable linkers include linkers having a maleimido-based moeity or a haloacetyl-based moiety for reaction with the cytotoxic agent.
  • Such bifunctional crosslinking agents are well known in the art (see U.S. Patent Application Publication Nos.
  • Cross-linking reagents comprising a haloacetyl-based moiety include N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB), N-succinimidyl iodoacetate (SIA), N-succinimidyl bromoacetate (SBA), N- succinimidyl 3-(bromoacetamido)propionate (SBAP), bis-maleimidopolyethyleneglycol (BMPEO), BM(PEO) 2 , BM(PEO) 3 , N-( -maleimidopropyloxy)succinimide ester (BMPS), 5- maleimidovaleric acid NHS, HBVS, 4-(4-N-maleimidophenyl)-butyric acid hydrazide » HCl (MPBH), Succinimidyl-(4-vinylsulfonyl)benzoate (SVSB), di
  • BMDB bis-maleimidohexane
  • BMH bis-maleimidoethane
  • BMOE bis-maleimidoethane
  • sulfo-SMCC sulfosuccinimidyl(4-iodo- acetyl)aminobenzoate
  • sulfo-SIAB m-Maleimidobenzoyl-N-hydroxysulfosuccinimide ester
  • sulfo-MBS N-(y-maleimidobutryloxy)sulfosuccinimde ester
  • sulfo-GMBS ⁇ -( ⁇ - maleimidocaproyloxy)sulfosuccimido ester
  • sulfo-EMCS ⁇ -( ⁇ - maleimidoundecanoyloxy
  • the linking reagent is a cleavable linker.
  • suitable cleavable linkers include disulfide containing linkers, acid labile linkers, photolabile linkers, peptidase labile linkers, and esterase labile linkers.
  • Disulfide containing linkers are linkers cleavable through disulfide exchange, which can occur under physiological conditions.
  • Acid labile linkers are linkers cleavable at acid pH. For example, certain intracellular compartments, such as endosomes and lysosomes, have an acidic pH (pH 4-5), and provide conditions suitable to cleave acid labile linkers.
  • Photo labile linkers are useful at the body surface and in many body cavities that are accessible to light. Furthermore, infrared light can penetrate tissue. Peptidase labile linkers can be used to cleave certain peptides inside or outside cells (see e.g., Trouet et al, Proc. Natl. Acad. Sci. USA, 79: 626-629 (1982), and Umemoto et al., Int. J. Cancer, 43: 677-684 (1989)). In one embodiment, the cleavable linker is cleaved under mild conditions, i.e., conditions within a cell under which the activity of the cytotoxic agent is not affected.
  • the cytotoxic agent is linked to a cell-binding agent through a disulfide bond.
  • the linker molecule comprises a reactive chemical group that can react with the cell-binding agent.
  • the bifunctional crosslinking reagent comprises a reactive moiety that can form an amide bond with a lysine residue of the cell-binding agent.
  • reactive ester moieties such as N- succinimidyl ester, N-sulfosuccinimidyl ester, nitrophenyl ⁇ e.g., 2 or 4-nitrophenyl) ester, dinitrophenyl ⁇ e.g., 2,4-
  • Preferred reactive chemical groups for reaction with the cell-binding agent are N- succinimidyl esters and N-sulfosuccinimidyl esters.
  • the linker molecule comprises a reactive chemical group, preferably a dithiopyridyl group, that can react with the cytotoxic agent to form a disulfide bond.
  • Bifunctional crosslinking reagents that enable the linkage of the cell-binding agent with the cytotoxic agent via disulfide bonds are known in the art and include, for example, N-succinimidyl 3-(2-pyridyldithio)propionate (SPDP) (see, e.g., Carlsson et al, Biochem.
  • N-succinimidyl 4-(2- pyridyldithio)butanoate SPDB
  • SPDB N-succinimidyl 4-(2- pyridyldithio)pentanoate
  • SPP N-succinimidyl 4-(2- pyridyldithio)pentanoate
  • SPP N- succinimidyl-4-(2-pyridyldithio)2-sulfo butanoate
  • sulfo-SPDB N- succinimidyl-4-(2-pyridyldithio)2-sulfo butanoate
  • Other bifunctional crosslinking reagents that can be used to introduce disulfide groups are known in the art and are described in U.S.
  • linkers can be derived from dicarboxylic acid based moieties.
  • Suitable dicarboxylic acid based moieties include, but are not limited to, ⁇ , ⁇ - dicarboxylic acids of the general formula (IX):
  • X is a linear or branched alkyl, alkenyl, or alkynyl group having 2 to 20 carbon atoms
  • Y is a cycloalkyl or cycloalkenyl group bearing 3 to 10 carbon atoms
  • Z is a substituted or unsubstituted aromatic group bearing 6 to 10 carbon atoms, or a substituted or unsubstituted heterocyclic group wherein the hetero atom is selected from N, O or S, and wherein 1, m, and n are each 0 or 1, provided that 1, m, and n are all not zero at the same time.
  • Final purified cell-binding agent cytotoxic agent conjugates produced by the inventive process comprise a cytotoxic agent, a bifunctional crosslinking agent, and a cell- binding agent.
  • the cytotoxic agent is DM1
  • the bifunctional crosslinking agent is SMCC
  • the cell-binding agent is huCD37-3 antibody.
  • the cytotoxic agent is DM1
  • the bifunctional crosslinking agent is SMCC
  • the cell-binding agent is EGFR-7R antibody.
  • the cytotoxic agent is DM1
  • the bifunctional crosslinking agent is SMCC
  • the cell-binding agent is an anti-EFGRvIII antibody.
  • the cytotoxic agent is DM1, the bifunctional crosslinking agent is SMCC, and the cell-binding agent is an anti-CD27L antibody.
  • the cytotoxic agent is DM1
  • the bifunctional crosslinking agent is SMCC
  • the cell-binding agent is trastuzumab.
  • This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
  • An antibody-SMCC-DMl conjugate was prepared by the one-step process (as described in U.S. Patent Application Publication No. 2012/0253021).
  • the reaction mixture was continuously pumped through a PVDF filter and the filtrate was collected and analyzed for DM1 dimer species.
  • DM1 dimer species including DM1 -DM1 and DM1-MCC-DM1, that were present prior to the PVDF filtration (see Fig. 1A), were efficiently removed by PVDF filtration (see Fig. IB).
  • This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane alone and in combination with an ion exchange chromatography membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
  • An antibody-SMCC-DMl conjugate was prepared by the one-step process (as described in U.S. Patent Application Publication No. 2012/0253021).
  • the reaction mixture was filtered through a PVDF membrane filter or a combination of PVDF membrane filter and a Q membrane (an ion exchange chromatography membrane). As shown in Table 1 below, the combination of a PVDF membrane filter and Q membrane removed more DM1 dimer species than the PVDF membrane filter alone.
  • This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising repeatedly subjecting a mixture comprising a cell- binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell- binding agent cytotoxic agent conjugate.
  • An antibody-SMCC-DMl conjugate was prepared by the one-step process (as described in U.S. Patent Application Publication No. 2012/0253021).
  • the reaction mixture was filtered through a PVDF membrane filter either two or three times.
  • the percent of DM1 dimers (DM1 -DM1 and DMl-MCC-DMl) was measured before and after each filtration. As shown in Figure 2, additional PVDF membrane filtration can further remove the DM1 dimer species.
  • This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
  • huN901-SPP-DMl conjugate was prepared by the one-step process (as described in U.S. Patent Application Publication No. 2012/0253021). Briefly, huN901 antibody was diafiltered into modification buffer (50 mM potassium phosphate, 2 mM
  • reaction mixture was then filtered through a 0.22 ⁇ Dura pore PVDF filter.
  • the amount of free cytotoxic agent present in the reaction mixture before and after PVDF filtration was measured by HPLC. The results are shown in Table 3 below.
  • This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
  • HuN901 antibody was modified at a concentration of 16.0 mg/ml with SPP at a ratio of 11.0 mg/g antibody (4.7X molar ratio) in 50 mM KPi , 50 mM KC1, 2 mM EDTA, pH 7.5 buffer with 5% (v/v) DMA for a total of 180 minutes at 23°C with constant stirring.
  • the modified antibody was then conjugated at a concentration of 2.5 mg/ml with a 1.8 fold molar excess of DM1 relative to initial SPP linker in 15 mM KPi buffer with 2mM EDTA, 7.7 mM citric acid and 5% DMA at pH 5.3 for 23 hrs at 23°C with constant stirring.
  • the reaction mixture was filtered through a 0.22um Dura pore PVDF filter.
  • the amount of free cytotoxic agent present in the reaction mixture before and after PVDF filtration was measured by HPLC. The results are shown in Table 4 below.
  • DMl-SPP-DMl 0.1% Not detectable
  • the amount of all free cytotoxic agent species measured i.e., DM1 -TP A, DM1, DM1 -DM1, and DMl-SPP-DMl
  • DM1 -TP A a free cytotoxic agent species measured
  • DM1 -DM1 a cytotoxic agent dimer species measured
  • DMl-SPP-DMl a cytotoxic agent dimer species

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Analytical Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Separation Using Semi-Permeable Membranes (AREA)
  • Treatment Of Liquids With Adsorbents In General (AREA)
  • Solid-Sorbent Or Filter-Aiding Compositions (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2013/063480 2012-10-04 2013-10-04 Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates WO2014055877A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
JP2015535823A JP6345181B2 (ja) 2012-10-04 2013-10-04 細胞結合剤細胞毒性剤コンジュゲートを精製するためのpvdf膜の使用
HK16101357.7A HK1213288A1 (zh) 2012-10-04 2013-10-04 使用pvdf膜純化細胞結合劑細胞毒性劑綴合物
MX2015004257A MX359599B (es) 2012-10-04 2013-10-04 Uso de una membrana de pvdf para purificar conjugados de agentes de unión celular y agentes citotóxicos.
SG11201502429YA SG11201502429YA (en) 2012-10-04 2013-10-04 Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates
AU2013326881A AU2013326881B2 (en) 2012-10-04 2013-10-04 Use of a PVDF membrane to purify cell-binding agent cytotoxic agent conjugates
CN201380061552.7A CN105209592A (zh) 2012-10-04 2013-10-04 使用pvdf膜纯化细胞结合剂细胞毒性剂缀合物
NZ707091A NZ707091A (en) 2012-10-04 2013-10-04 Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates
US14/430,701 US10035817B2 (en) 2012-10-04 2013-10-04 Method of purifying cell-binding agent-cytotoxic agent conjugates with a PVDF membrane
EP13844268.6A EP2904089A4 (en) 2012-10-04 2013-10-04 USE OF A PVDF MEMBRANE FOR PURIFYING CELL BINDING AGENT-CYTOTOXIC AGENT CONJUGATES
RU2015116882A RU2661083C2 (ru) 2012-10-04 2013-10-04 Использование пвдф-мембраны для очистки конъюгатов клеточно-связывающий агент - цитотоксический агент
IN3202DEN2015 IN2015DN03202A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) 2012-10-04 2013-10-04
CA 2886993 CA2886993A1 (en) 2012-10-04 2013-10-04 Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates
IL238110A IL238110B (en) 2012-10-04 2015-04-02 Using a polyvinyl difluoride membrane to purify conjugates of a cytotoxic factor and a cell-binding factor
ZA201502992A ZA201502992B (en) 2012-10-04 2015-04-30 Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates
US16/023,005 US20190031712A1 (en) 2012-10-04 2018-06-29 Use of a PVDF membrane to purify cell-binding agent cytotoxic agent conjugates
AU2018241056A AU2018241056A1 (en) 2012-10-04 2018-10-03 Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates
IL268378A IL268378A (en) 2012-10-04 2019-07-31 Using a polyvinyl difluoride membrane to purify conjugates of a cytotoxic factor and a cell-binding factor

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261709891P 2012-10-04 2012-10-04
US61/709,891 2012-10-04

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/430,701 A-371-Of-International US10035817B2 (en) 2012-10-04 2013-10-04 Method of purifying cell-binding agent-cytotoxic agent conjugates with a PVDF membrane
US16/023,005 Continuation US20190031712A1 (en) 2012-10-04 2018-06-29 Use of a PVDF membrane to purify cell-binding agent cytotoxic agent conjugates

Publications (1)

Publication Number Publication Date
WO2014055877A1 true WO2014055877A1 (en) 2014-04-10

Family

ID=50435472

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/063480 WO2014055877A1 (en) 2012-10-04 2013-10-04 Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates

Country Status (15)

Country Link
US (2) US10035817B2 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
EP (1) EP2904089A4 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
JP (3) JP6345181B2 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
CN (2) CN109200290A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
AU (2) AU2013326881B2 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
CA (1) CA2886993A1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
HK (1) HK1213288A1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
IL (2) IL238110B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
IN (1) IN2015DN03202A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
MX (1) MX359599B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
NZ (1) NZ707091A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
RU (2) RU2661083C2 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
SG (2) SG11201502429YA (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
WO (1) WO2014055877A1 (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)
ZA (1) ZA201502992B (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106999604A (zh) * 2014-09-02 2017-08-01 伊缪诺金公司 用于配制抗体药物缀合物组合物的方法
US11040084B2 (en) * 2014-04-29 2021-06-22 Genequantum Healthcare (Suzhou) Co., Ltd. Stable antibody-drug conjugate, preparation method therefor, and use thereof
US11717576B2 (en) 2021-03-08 2023-08-08 Genequantum Healthcare (Suzhou) Co., Ltd. Antibody-immune agonist conjugate and applications thereof
WO2024193570A1 (en) * 2023-03-21 2024-09-26 Genequantum Healthcare (Suzhou) Co., Ltd. Combination of antibody-drug conjugate and cancer therapy, and use thereof

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PT1928503E (pt) 2005-08-24 2012-10-19 Immunogen Inc Processo para preparação de conjugados de anticorpo e maitansinóide
TR201907573T4 (tr) 2009-06-03 2019-06-21 Immunogen Inc Konjugasyon yöntemleri̇
EP2691155B1 (en) 2011-03-29 2018-11-14 Immunogen, Inc. Preparation of maytansinoid antibody conjugates by a one-step process
RU2661083C2 (ru) 2012-10-04 2018-07-11 Иммуноджен, Инк. Использование пвдф-мембраны для очистки конъюгатов клеточно-связывающий агент - цитотоксический агент
CN105797603A (zh) * 2016-04-13 2016-07-27 伊美特(上海)环保科技有限公司 一种亲水性中空纤维超滤膜及其制备工艺
CN106995639A (zh) * 2017-04-18 2017-08-01 安徽省康宇水电机械成套设备有限公司 一种低成本水下防腐材料
CN108549763B (zh) * 2018-04-09 2021-06-01 电子科技大学 一种用于离子推进器数值模拟的电荷交换碰撞mcc方法
CN112830937B (zh) * 2019-11-22 2025-04-04 上海医药集团股份有限公司 一种美登素dm1聚合物的制备方法
CN117177775A (zh) 2021-04-14 2023-12-05 启德医药科技(苏州)有限公司 连接子、缀合物及其应用

Citations (67)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4256746A (en) 1978-11-14 1981-03-17 Takeda Chemical Industries Dechloromaytansinoids, their pharmaceutical compositions and method of use
US4294757A (en) 1979-01-31 1981-10-13 Takeda Chemical Industries, Ltd 20-O-Acylmaytansinoids
US4307016A (en) 1978-03-24 1981-12-22 Takeda Chemical Industries, Ltd. Demethyl maytansinoids
US4313946A (en) 1981-01-27 1982-02-02 The United States Of America As Represented By The Secretary Of Agriculture Chemotherapeutically active maytansinoids from Trewia nudiflora
US4315929A (en) 1981-01-27 1982-02-16 The United States Of America As Represented By The Secretary Of Agriculture Method of controlling the European corn borer with trewiasine
US4322348A (en) 1979-06-05 1982-03-30 Takeda Chemical Industries, Ltd. Maytansinoids
US4331598A (en) 1979-09-19 1982-05-25 Takeda Chemical Industries, Ltd. Maytansinoids
US4362663A (en) 1979-09-21 1982-12-07 Takeda Chemical Industries, Ltd. Maytansinoid compound
US4364866A (en) 1979-09-21 1982-12-21 Takeda Chemical Industries, Ltd. Maytansinoids
US4371533A (en) 1980-10-08 1983-02-01 Takeda Chemical Industries, Ltd. 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof
US4424219A (en) 1981-05-20 1984-01-03 Takeda Chemical Industries, Ltd. 9-Thiomaytansinoids and their pharmaceutical compositions and use
US4450254A (en) 1980-11-03 1984-05-22 Standard Oil Company Impact improvement of high nitrile resins
US4563304A (en) 1981-02-27 1986-01-07 Pharmacia Fine Chemicals Ab Pyridine compounds modifying proteins, polypeptides or polysaccharides
GB2188638A (en) 1986-03-27 1987-10-07 Gregory Paul Winter Chimeric antibodies
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5475092A (en) 1992-03-25 1995-12-12 Immunogen Inc. Cell binding agent conjugates of analogues and derivatives of CC-1065
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5552293A (en) 1991-07-03 1996-09-03 Pharmacia Aktiebolag Tumor antigen specific antibody
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
WO1999005317A1 (en) * 1997-07-28 1999-02-04 The New York Blood Center, Inc. Method for purifying viral nucleic acids
WO1999006587A2 (en) 1997-08-01 1999-02-11 Morphosys Ag Novel method and phage for the identification of nucleic acid sequences encoding members of a multimeric (poly)peptide complex
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US5958872A (en) 1996-04-01 1999-09-28 Apoptosis Technology, Inc. Active survival domains of IGF-IR and methods of use
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
US6333410B1 (en) 2000-08-18 2001-12-25 Immunogen, Inc. Process for the preparation and purification of thiol-containing maytansinoids
US6340701B1 (en) 1999-11-24 2002-01-22 Immunogen Inc Cytotoxic agents comprising taxanes and their therapeutic use
US6441163B1 (en) 2001-05-31 2002-08-27 Immunogen, Inc. Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents
US20020197266A1 (en) 2000-02-08 2002-12-26 Waldemar Debinski Immunotherapy using interleukin 13 receptor subunit alpha 2
US6534660B1 (en) 2002-04-05 2003-03-18 Immunogen, Inc. CC-1065 analog synthesis
US6596757B1 (en) 2002-05-14 2003-07-22 Immunogen Inc. Cytotoxic agents comprising polyethylene glycol-containing taxanes and their therapeutic use
US6596743B2 (en) 1999-04-20 2003-07-22 Hoffmann-La Roche Inc. Carbamic acid derivatives
US6630579B2 (en) 1999-12-29 2003-10-07 Immunogen Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
US6716821B2 (en) 2001-12-21 2004-04-06 Immunogen Inc. Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same
US6756397B2 (en) 2002-04-05 2004-06-29 Immunogen, Inc. Prodrugs of CC-1065 analogs
US6780327B1 (en) 1999-02-25 2004-08-24 Pall Corporation Positively charged membrane
US20050169933A1 (en) 2003-10-10 2005-08-04 Immunogen, Inc. Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates
US20060127407A1 (en) 2004-12-09 2006-06-15 Qiming Chen Anti-integrin immunoconjugates, methods and uses
US20060182750A1 (en) 2005-02-11 2006-08-17 Immunogen, Inc. Process for preparing stable drug conjugates
US20070183971A1 (en) 2004-08-30 2007-08-09 Biotest Ag Immunoconjugates targeting syndecan-1 expressing cells and use thereof
US20080050310A1 (en) 2006-05-30 2008-02-28 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
WO2008047242A2 (en) 2006-10-19 2008-04-24 Sanofi-Aventis Novel anti-cd38 antibodies for the treatment of cancer
WO2008057683A2 (en) * 2006-10-03 2008-05-15 Novo Nordisk A/S Methods for the purification of polypeptide conjugates
US7374762B2 (en) 2003-05-14 2008-05-20 Immunogen, Inc. Drug conjugate composition
US7390898B2 (en) 2002-08-02 2008-06-24 Immunogen Inc. Cytotoxic agents containing novel potent taxanes and their therapeutic use
US20090156790A1 (en) 2003-06-27 2009-06-18 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20090274713A1 (en) 2008-04-30 2009-11-05 Immunogen Inc. Cross-linkers and their uses
US20100047257A1 (en) * 2006-07-18 2010-02-25 Sanofi-Aventis Antagonist antibody for the treatment of cancer
US20100093980A1 (en) 2005-03-04 2010-04-15 Biogen Idec Ma Inc. Methods of Humanizing Immunoglobulin Variable Regions Through Rational Modification Of Complementarity Determining Residues
US20100129314A1 (en) 2008-04-30 2010-05-27 Immunogen Inc. Potent conjugates and hydrophilic linkers
US7811572B2 (en) 2005-08-24 2010-10-12 Immunogen, Inc. Process for preparing purified drug conjugates
WO2010124797A1 (en) 2009-04-29 2010-11-04 Bayer Schering Pharma Aktiengesellschaft Anti-mesothelin immunoconjugates and uses therefor
US20110003969A1 (en) 2009-06-03 2011-01-06 Immunogen Inc. Conjugation methods
WO2011039721A1 (en) 2009-10-02 2011-04-07 Sanofi-Aventis New maytansinoids and the use of said maytansinoids to prepare conjugates with an antibody
WO2011039724A1 (en) 2009-10-02 2011-04-07 Sanofi-Aventis Antibodies that specifically bind to the epha2 receptor
US7982024B2 (en) 2001-01-05 2011-07-19 Amgen Fremont Inc. Antibodies to insulin-like growth factor I receptor
WO2011106528A1 (en) 2010-02-24 2011-09-01 Immunogen, Inc. Folate receptor 1 antibodies and immunoconjugates and uses thereof
US20110256153A1 (en) 2010-03-12 2011-10-20 Jutta Deckert CD37-Binding Molecules and Immunoconjugates Thereof
WO2012019024A2 (en) 2010-08-04 2012-02-09 Immunogen, Inc. Her3-binding molecules and immunoconjugates thereof
WO2012058592A2 (en) 2010-10-29 2012-05-03 Immunogen, Inc. Non-antagonistic egfr-binding molecules and immunoconjugates thereof
WO2012058588A2 (en) 2010-10-29 2012-05-03 Immunogen, Inc. Novel egfr-binding molecules and immunoconjugates thereof
US20120253021A1 (en) 2011-03-29 2012-10-04 Immunogen, Inc. Preparation of maytansinoid antibody conjugates by a one-step process
WO2012135517A2 (en) 2011-03-29 2012-10-04 Immunogen, Inc. Preparation of maytansinoid antibody conjugates by a one-step process

Family Cites Families (99)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SE430062B (sv) 1977-03-04 1983-10-17 Pharmacia Fine Chemicals Ab Kopplings- eller tioleringsreagens
US4137230A (en) 1977-11-14 1979-01-30 Takeda Chemical Industries, Ltd. Method for the production of maytansinoids
US4664911A (en) 1983-06-21 1987-05-12 Board Of Regents, University Of Texas System Immunotoxin conjugates employing toxin B chain moieties
DE3584012D1 (de) 1985-01-22 1991-10-10 Saint Gobain Vitrage Verfahren zur herstellung eines pulvers auf basis von indium-formiat zur herstellung einer duennen beschichtung auf einem substrat, insbesondere auf glas.
GB8600582D0 (en) 1986-01-10 1986-02-19 Ca Minister Nat Defence Purifying biological materials
US4859449A (en) 1987-09-14 1989-08-22 Center For Molecular Medicine And Immunology Modified antibodies for enhanced hepatocyte clearance
US5241078A (en) 1988-06-14 1993-08-31 Cetus Oncology Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom
US5024834A (en) 1988-07-12 1991-06-18 Cetus Corporation Thioether linked immunotoxin conjugates
CA2006408A1 (en) 1988-12-27 1990-06-27 Susumu Iwasa Bispecific monoclonal antibody, its production and use
US5714149A (en) 1989-02-10 1998-02-03 Celltech Therapeutics Limited Crosslinked antibodies and processes for their preparation
CA2026147C (en) 1989-10-25 2006-02-07 Ravi J. Chari Cytotoxic agents comprising maytansinoids and their therapeutic use
US6316003B1 (en) 1989-12-21 2001-11-13 Whitehead Institute For Biomedical Research Tat-derived transport polypeptides
US5137877B1 (en) 1990-05-14 1996-01-30 Bristol Myers Squibb Co Bifunctional linking compounds conjugates and methods for their production
CA2048078A1 (en) 1990-11-15 1992-05-16 Wolfgang A. Wrasidlo Chemical modification of antibodies for creation of immunoconjugates
US5252714A (en) 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
SE470006B (sv) 1991-09-26 1993-10-25 Corline Systems Ab Nytt konjugat, dess framställning och användning samt substrat preparerat med konjugatet
US5556623A (en) 1993-03-30 1996-09-17 Eli Lilly And Company Antibody-drug conjugates
IL111748A0 (en) 1993-12-03 1995-01-24 Zeneca Ltd Proteins
US5580853A (en) 1994-03-22 1996-12-03 New England Deaconess Hospital Modified polypeptides with increased biological activity
US5747446A (en) 1994-03-22 1998-05-05 Beth Israel Deaconess Medical Center Modified polypeptides with increased biological activity
US5919758A (en) 1994-03-22 1999-07-06 Beth Israel Deaconess Medical Center Modified polypeptides with altered biological activity
US5612474A (en) 1994-06-30 1997-03-18 Eli Lilly And Company Acid labile immunoconjugate intermediates
AU5908296A (en) 1995-05-31 1996-12-24 Fred Hutchinson Cancer Research Center Compositions and methods for targeted delivery of effector m olecules
WO1998026747A2 (en) 1996-12-17 1998-06-25 Terman David S Superantigen based methods and compositions for treatment of diseases
US6462070B1 (en) 1997-03-06 2002-10-08 The General Hospital Corporation Photosensitizer conjugates for pathogen targeting
US6371975B2 (en) 1998-11-06 2002-04-16 Neomend, Inc. Compositions, systems, and methods for creating in situ, chemically cross-linked, mechanical barriers
DE69827507T2 (de) 1997-06-11 2006-03-09 Borean Pharma A/S Trimerisierendes modul
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
US5965714A (en) 1997-10-02 1999-10-12 Connaught Laboratories, Inc. Method for the covalent attachment of polysaccharides to protein molecules
CA2305599A1 (en) 1997-10-03 1999-04-15 Galenica Pharmaceuticals, Inc. Imine-forming polysaccharides, preparation thereof and the use thereof as adjuvants and immunostimulants
US6121236A (en) 1998-03-24 2000-09-19 The Children's Medical Center Corporation Multivalent ligands which modulate angiogenesis
JP2002513028A (ja) 1998-04-28 2002-05-08 ガレニカ ファーマシューティカルズ, インコーポレイテッド ポリサッカリド抗原結合体
US5981564A (en) 1998-07-01 1999-11-09 Universite Laval Water-soluble derivatives of paclitaxel, method for producing same and uses thereof
CA2331789C (en) 1998-07-13 2013-09-10 Board Of Regents, The University Of Texas System Cancer treatment methods using therapeutic conjugates that bind to aminophospholipids
AUPQ014799A0 (en) 1999-05-04 1999-05-27 Access Pharmaceuticals Australia Pty Limited Amplification of folate-mediated targeting to tumor cells using polymers
EP2266607A3 (en) 1999-10-01 2011-04-20 Immunogen, Inc. Immunoconjugates for treating cancer
US6632979B2 (en) 2000-03-16 2003-10-14 Genentech, Inc. Rodent HER2 tumor model
US7097840B2 (en) 2000-03-16 2006-08-29 Genentech, Inc. Methods of treatment using anti-ErbB antibody-maytansinoid conjugates
US6596503B1 (en) 2000-08-18 2003-07-22 East Carolina University Monoclonal antibody DS6, tumor-associated antigen CA6, and methods of use thereof
US20060062786A1 (en) 2000-11-08 2006-03-23 Human Genome Sciences, Inc. Antibodies that immunospecifically bind to TRAIL receptors
KR20030091978A (ko) 2001-01-29 2003-12-03 아이덱 파마슈티칼즈 코포레이션 변형된 항체 및 사용 방법
US6875886B2 (en) 2001-02-07 2005-04-05 Beth Israel Deaconess Medical Center, Inc. Modified PSMA ligands and uses related thereto
EP1610751A4 (en) 2001-04-26 2006-05-24 Univ Texas THERAPEUTIC AGENT / LIGAND CONJUGATE COMPOSITIONS, ITS SYNTHESIS PROCESSES AND ITS APPLICATION
KR100863624B1 (ko) 2001-05-11 2008-10-15 보드 오브 리전츠, 더 유니버시티 오브 텍사스 시스템 Cd26을 발현하는 세포와 연관된 질환의 치료제로사용되는 항-cd26 단클론항체
EP1258255A1 (en) 2001-05-18 2002-11-20 Boehringer Ingelheim International GmbH Conjugates of an antibody to CD44 and a maytansinoid
EP1392360B1 (en) 2001-06-01 2011-11-30 Cornell Research Foundation, Inc. Modified antibodies to prostate-specific membrane antigen and uses thereof
US6576802B2 (en) 2001-06-04 2003-06-10 Shell Oil Company One-step production of 1, 3-propanediol from ethylene oxide and syngas with a catalyst with a phospholanoalkane ligand
EP1455817B1 (en) 2001-12-11 2008-12-31 Merck & Co., Inc. Staphylococcus aureus exopolysaccharide and process
JP2005532258A (ja) 2002-01-03 2005-10-27 スミスクライン・ビーチャム・コーポレイション 免疫コンジュゲートの調製方法
US8877901B2 (en) 2002-12-13 2014-11-04 Immunomedics, Inc. Camptothecin-binding moiety conjugates
US7591994B2 (en) 2002-12-13 2009-09-22 Immunomedics, Inc. Camptothecin-binding moiety conjugates
ES2545067T3 (es) 2002-04-26 2015-09-08 Genentech, Inc. Purificación de proteínas basada en la no afinidad
CA2483552A1 (en) 2002-05-02 2003-11-13 Wyeth Holdings Corporation Calicheamicin derivative-carrier conjugates
US20090068178A1 (en) 2002-05-08 2009-03-12 Genentech, Inc. Compositions and Methods for the Treatment of Tumor of Hematopoietic Origin
WO2005117986A2 (en) 2004-06-01 2005-12-15 Genentech, Inc. Antibody drug conjugates and methods
EP1551875A4 (en) 2002-06-21 2006-06-28 Biogen Idec Inc TAMPON PREPARATIONS FOR CONCENTRATING ANTIBODIES AND METHODS FOR USE THEREOF
EP1542723B1 (en) 2002-08-16 2011-02-23 ImmunoGen, Inc. Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs
US7538092B2 (en) 2002-10-08 2009-05-26 Fresenius Kabi Deutschland Gmbh Pharmaceutically active oligosaccharide conjugates
ES2368215T3 (es) 2002-10-30 2011-11-15 Nuevolution A/S Codificación enzimática.
SI1578446T1 (sl) 2002-11-07 2015-07-31 Immunogen, Inc. Protitelesa proti-cd33 in metoda za zdravljenje akutne mieloidne levkemije z uporabo istega
US7276497B2 (en) 2003-05-20 2007-10-02 Immunogen Inc. Cytotoxic agents comprising new maytansinoids
MXPA05011811A (es) 2003-05-20 2006-02-17 Immunogen Inc Agentes citotoxicos mejorados que comprenden nuevos maitansinoides.
WO2005002597A1 (en) 2003-07-02 2005-01-13 Polycord, Inc. Method for delivering polymerized therapeutic agent compositions and compositions thereof
CN1878568A (zh) 2003-11-05 2006-12-13 盘林京有限公司 Cdim结合抗体的增强的b细胞细胞毒性
US20050175619A1 (en) 2004-02-05 2005-08-11 Robert Duffy Methods of producing antibody conjugates
US20110064754A1 (en) 2005-03-03 2011-03-17 Center For Molecular Medicine And Immunology Immunoconjugates Comprising Poxvirus-Derived Peptides and Antibodies Against Antigen-Presenting Cells for Subunit-Based Poxvirus Vaccines
EP1610818A4 (en) 2004-03-03 2007-09-19 Millennium Pharm Inc MODIFIED ANTIBODIES AGAINST A PROSTATE-SPECIFIC MEMBRANE-ANTIGEN AND USE THEREOF
US8470315B2 (en) 2004-04-13 2013-06-25 Quintessence Biosciences, Inc. Non-natural ribonuclease conjugates as cytotoxic agents
US20060073528A1 (en) 2004-05-14 2006-04-06 Jean-Michel Lecerf Measurement methods
RU2402548C2 (ru) 2004-05-19 2010-10-27 Медарекс, Инк. Химические линкеры и их конъюгаты
JP4806680B2 (ja) 2004-05-19 2011-11-02 メダレックス インコーポレイテッド 自己犠牲リンカー及び薬剤複合体
TW200630106A (en) 2004-10-08 2006-09-01 Wyeth Corp Immunotherapy of autoimmune disorders
US20080305044A1 (en) 2004-11-29 2008-12-11 Seattle Genetics, Inc. Engineered Antibodies and Immunoconjugates
US7408030B2 (en) 2005-01-13 2008-08-05 North Carolina State University Purification of immunoglobulins using affinity chromatography and peptide ligands
US20110166319A1 (en) 2005-02-11 2011-07-07 Immunogen, Inc. Process for preparing purified drug conjugates
WO2006113623A2 (en) 2005-04-15 2006-10-26 Immunogen, Inc. Elimination of heterogeneous or mixed cell population in tumors
GB2427360A (en) 2005-06-22 2006-12-27 Complex Biosystems Gmbh Aliphatic prodrug linker
SI2233156T1 (sl) * 2005-07-15 2013-09-30 Angiochem Inc. Uporaba polipeptidov aprotinina kot nosilce v farmacevtskih konjugatih
NZ623901A (en) 2005-08-03 2015-10-30 Immunogen Inc Immunoconjugate formulations
JP2009508938A (ja) 2005-09-22 2009-03-05 ハダシット メディカル リサーチ サーヴィスィズ アンド ディベロップメント リミテッド 治療上活性な化合物の結合体
AU2006294554B2 (en) 2005-09-26 2013-03-21 E. R. Squibb & Sons, L.L.C. Antibody-drug conjugates and methods of use
EP1959958A4 (en) 2005-11-14 2010-07-14 Univ Southern California INTEGRIN-BINDING SMALL MOLECULES
US7964415B2 (en) 2006-04-26 2011-06-21 Cardiogenics Inc. Stable water-soluble polyethylenimine conjugates and methods of use thereof
US20080213349A1 (en) 2006-09-11 2008-09-04 Deepak Ramesh Thakker Liposome Complexes Containing Pharmaceutical Agents and Methods
PL2019104T3 (pl) * 2007-07-19 2014-03-31 Sanofi Sa Środki cytotoksyczne obejmujące nowe pochodne tomaymycyny i ich zastosowanie terapeutyczne
GB0811743D0 (en) 2008-06-26 2008-07-30 Hemosol Biopharma Inc Composition
WO2010057160A1 (en) 2008-11-17 2010-05-20 Enzon Pharmaceuticals, Inc. Releasable fusogenic lipids for nucleic acids delivery systems
IL271761B (en) 2009-02-05 2022-09-01 Immunogen Inc (12as)-8-methoxy-9-benzyloxy-11,12,12a,13-tetrahydro-6h-indolo[2,1-c][1,4]benzodiazepin-6-one, 4-benzyloxy-5-methoxy-2-nitrobenzoic acid and processes for preparing the same
FR2947269B1 (fr) 2009-06-29 2013-01-18 Sanofi Aventis Nouveaux composes anticancereux
US20120149732A1 (en) 2010-12-14 2012-06-14 Alexander Chucholowski Multifunctional linkers and methods for the use thereof
MX343337B (es) 2011-02-15 2016-11-01 Immunogen Inc Metodos de preparacion de conjugados.
JP2014510757A (ja) 2011-03-29 2014-05-01 イムノゲン インコーポレーティッド 均質性が改善された複合体を製造する工程
EA028805B1 (ru) 2011-04-01 2018-01-31 Иммьюноджен, Инк. Способы повышения эффективности folr1 терапии рака
US20130071482A1 (en) 2011-09-20 2013-03-21 The University Of Kentucky Research Foundation Block copolymer cross-linked nanoassemblies as modular delivery vehicles
HK1203364A1 (en) 2011-12-13 2015-10-30 Immunogen, Inc. Use of n-hydroxysuccinimide to improve conjugate stability
RU2661083C2 (ru) 2012-10-04 2018-07-11 Иммуноджен, Инк. Использование пвдф-мембраны для очистки конъюгатов клеточно-связывающий агент - цитотоксический агент
RU2015116883A (ru) * 2012-10-04 2016-11-27 Иммуноджен, Инк. Применение ионообменной мембраны для удаления примесей из конъюгатов клеточносвязывающего агента с цитотоксическим агентом
WO2014055842A1 (en) 2012-10-04 2014-04-10 Immunogen, Inc. Process for preparing stable antibody maytansinoid conjugates
WO2014086835A1 (en) 2012-12-05 2014-06-12 Ruprecht-Karls-Universität Heidelberg Conjugates of proteins and multivalent cell-penetrating peptides and their uses

Patent Citations (93)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4307016A (en) 1978-03-24 1981-12-22 Takeda Chemical Industries, Ltd. Demethyl maytansinoids
US4361650A (en) 1978-03-24 1982-11-30 Takeda Chemical Industries, Ltd. Fermentation process of preparing demethyl maytansinoids
US4256746A (en) 1978-11-14 1981-03-17 Takeda Chemical Industries Dechloromaytansinoids, their pharmaceutical compositions and method of use
US4294757A (en) 1979-01-31 1981-10-13 Takeda Chemical Industries, Ltd 20-O-Acylmaytansinoids
US4322348A (en) 1979-06-05 1982-03-30 Takeda Chemical Industries, Ltd. Maytansinoids
US4331598A (en) 1979-09-19 1982-05-25 Takeda Chemical Industries, Ltd. Maytansinoids
US4364866A (en) 1979-09-21 1982-12-21 Takeda Chemical Industries, Ltd. Maytansinoids
US4362663A (en) 1979-09-21 1982-12-07 Takeda Chemical Industries, Ltd. Maytansinoid compound
US4371533A (en) 1980-10-08 1983-02-01 Takeda Chemical Industries, Ltd. 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof
US4450254A (en) 1980-11-03 1984-05-22 Standard Oil Company Impact improvement of high nitrile resins
US4315929A (en) 1981-01-27 1982-02-16 The United States Of America As Represented By The Secretary Of Agriculture Method of controlling the European corn borer with trewiasine
US4313946A (en) 1981-01-27 1982-02-02 The United States Of America As Represented By The Secretary Of Agriculture Chemotherapeutically active maytansinoids from Trewia nudiflora
US4563304A (en) 1981-02-27 1986-01-07 Pharmacia Fine Chemicals Ab Pyridine compounds modifying proteins, polypeptides or polysaccharides
US4424219A (en) 1981-05-20 1984-01-03 Takeda Chemical Industries, Ltd. 9-Thiomaytansinoids and their pharmaceutical compositions and use
GB2188638A (en) 1986-03-27 1987-10-07 Gregory Paul Winter Chimeric antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
EP0239400B1 (en) 1986-03-27 1994-08-03 Medical Research Council Recombinant antibodies and methods for their production
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5416064A (en) 1989-10-25 1995-05-16 Immunogen, Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5969108A (en) 1990-07-10 1999-10-19 Medical Research Council Methods for producing members of specific binding pairs
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5552293A (en) 1991-07-03 1996-09-03 Pharmacia Aktiebolag Tumor antigen specific antibody
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US5585499A (en) 1992-03-25 1996-12-17 Immunogen Inc. Cyclopropylbenzindole-containing cytotoxic drugs
US5846545A (en) 1992-03-25 1998-12-08 Immunogen, Inc. Targeted delivery of cyclopropylbenzindole-containing cytotoxic drugs
US5475092A (en) 1992-03-25 1995-12-12 Immunogen Inc. Cell binding agent conjugates of analogues and derivatives of CC-1065
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
US5958872A (en) 1996-04-01 1999-09-28 Apoptosis Technology, Inc. Active survival domains of IGF-IR and methods of use
WO1999005317A1 (en) * 1997-07-28 1999-02-04 The New York Blood Center, Inc. Method for purifying viral nucleic acids
WO1999006587A2 (en) 1997-08-01 1999-02-11 Morphosys Ag Novel method and phage for the identification of nucleic acid sequences encoding members of a multimeric (poly)peptide complex
US7396465B2 (en) 1999-02-25 2008-07-08 Pall Corporation Positively charged membrane
US7223341B2 (en) 1999-02-25 2007-05-29 Pall Corporation Positively charged membrane
US7094347B2 (en) 1999-02-25 2006-08-22 Pall Corporation Positively charged membrane
US6851561B2 (en) 1999-02-25 2005-02-08 Pall Corporation Positively charged membrane
US6780327B1 (en) 1999-02-25 2004-08-24 Pall Corporation Positively charged membrane
US6596743B2 (en) 1999-04-20 2003-07-22 Hoffmann-La Roche Inc. Carbamic acid derivatives
US6340701B1 (en) 1999-11-24 2002-01-22 Immunogen Inc Cytotoxic agents comprising taxanes and their therapeutic use
US6372738B2 (en) 1999-11-24 2002-04-16 Immunogen Inc. Cytotoxic agents comprising taxanes and their therapeutic use
US6436931B1 (en) 1999-11-24 2002-08-20 Immunogen Inc. Cytotoxic agents comprising taxanes and their therapeutic use
US6706708B2 (en) 1999-11-24 2004-03-16 Immunogen, Inc. Cytotoxic agents comprising taxanes and their therapeutic use
US6630579B2 (en) 1999-12-29 2003-10-07 Immunogen Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
US20020197266A1 (en) 2000-02-08 2002-12-26 Waldemar Debinski Immunotherapy using interleukin 13 receptor subunit alpha 2
US6333410B1 (en) 2000-08-18 2001-12-25 Immunogen, Inc. Process for the preparation and purification of thiol-containing maytansinoids
US7982024B2 (en) 2001-01-05 2011-07-19 Amgen Fremont Inc. Antibodies to insulin-like growth factor I receptor
US6441163B1 (en) 2001-05-31 2002-08-27 Immunogen, Inc. Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents
US6716821B2 (en) 2001-12-21 2004-04-06 Immunogen Inc. Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same
US6756397B2 (en) 2002-04-05 2004-06-29 Immunogen, Inc. Prodrugs of CC-1065 analogs
US6586618B1 (en) 2002-04-05 2003-07-01 Immunogen Inc. CC-1065 analog synthesis
US6534660B1 (en) 2002-04-05 2003-03-18 Immunogen, Inc. CC-1065 analog synthesis
US7329760B2 (en) 2002-04-05 2008-02-12 Immunogen Inc. CC-1065 analog synthesis
US6596757B1 (en) 2002-05-14 2003-07-22 Immunogen Inc. Cytotoxic agents comprising polyethylene glycol-containing taxanes and their therapeutic use
US7390898B2 (en) 2002-08-02 2008-06-24 Immunogen Inc. Cytotoxic agents containing novel potent taxanes and their therapeutic use
US7374762B2 (en) 2003-05-14 2008-05-20 Immunogen, Inc. Drug conjugate composition
US20090240038A1 (en) 2003-06-27 2009-09-24 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US7736644B2 (en) 2003-06-27 2010-06-15 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20100111979A1 (en) 2003-06-27 2010-05-06 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US7628986B2 (en) 2003-06-27 2009-12-08 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20090175887A1 (en) 2003-06-27 2009-07-09 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20090155282A1 (en) 2003-06-27 2009-06-18 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20090156790A1 (en) 2003-06-27 2009-06-18 Amgen Fremont Inc. Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof
US20080145374A1 (en) 2003-10-10 2008-06-19 Immunogen, Inc. Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates and methods of making said conjugates
US20050169933A1 (en) 2003-10-10 2005-08-04 Immunogen, Inc. Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates
US20070183971A1 (en) 2004-08-30 2007-08-09 Biotest Ag Immunoconjugates targeting syndecan-1 expressing cells and use thereof
US20060127407A1 (en) 2004-12-09 2006-06-15 Qiming Chen Anti-integrin immunoconjugates, methods and uses
US20060182750A1 (en) 2005-02-11 2006-08-17 Immunogen, Inc. Process for preparing stable drug conjugates
US20100093980A1 (en) 2005-03-04 2010-04-15 Biogen Idec Ma Inc. Methods of Humanizing Immunoglobulin Variable Regions Through Rational Modification Of Complementarity Determining Residues
US7811572B2 (en) 2005-08-24 2010-10-12 Immunogen, Inc. Process for preparing purified drug conjugates
US20080050310A1 (en) 2006-05-30 2008-02-28 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
US20100047257A1 (en) * 2006-07-18 2010-02-25 Sanofi-Aventis Antagonist antibody for the treatment of cancer
WO2008057683A2 (en) * 2006-10-03 2008-05-15 Novo Nordisk A/S Methods for the purification of polypeptide conjugates
WO2008047242A2 (en) 2006-10-19 2008-04-24 Sanofi-Aventis Novel anti-cd38 antibodies for the treatment of cancer
US20100129314A1 (en) 2008-04-30 2010-05-27 Immunogen Inc. Potent conjugates and hydrophilic linkers
US20090274713A1 (en) 2008-04-30 2009-11-05 Immunogen Inc. Cross-linkers and their uses
WO2010124797A1 (en) 2009-04-29 2010-11-04 Bayer Schering Pharma Aktiengesellschaft Anti-mesothelin immunoconjugates and uses therefor
US20110003969A1 (en) 2009-06-03 2011-01-06 Immunogen Inc. Conjugation methods
WO2011039721A1 (en) 2009-10-02 2011-04-07 Sanofi-Aventis New maytansinoids and the use of said maytansinoids to prepare conjugates with an antibody
WO2011039724A1 (en) 2009-10-02 2011-04-07 Sanofi-Aventis Antibodies that specifically bind to the epha2 receptor
WO2011106528A1 (en) 2010-02-24 2011-09-01 Immunogen, Inc. Folate receptor 1 antibodies and immunoconjugates and uses thereof
US20120009181A1 (en) 2010-02-24 2012-01-12 Ab Olga Folate Receptor 1 Antibodies and Immunoconjugates and Uses Thereof
US20110256153A1 (en) 2010-03-12 2011-10-20 Jutta Deckert CD37-Binding Molecules and Immunoconjugates Thereof
WO2012019024A2 (en) 2010-08-04 2012-02-09 Immunogen, Inc. Her3-binding molecules and immunoconjugates thereof
WO2012058592A2 (en) 2010-10-29 2012-05-03 Immunogen, Inc. Non-antagonistic egfr-binding molecules and immunoconjugates thereof
WO2012058588A2 (en) 2010-10-29 2012-05-03 Immunogen, Inc. Novel egfr-binding molecules and immunoconjugates thereof
US20120253021A1 (en) 2011-03-29 2012-10-04 Immunogen, Inc. Preparation of maytansinoid antibody conjugates by a one-step process
WO2012135517A2 (en) 2011-03-29 2012-10-04 Immunogen, Inc. Preparation of maytansinoid antibody conjugates by a one-step process
WO2012135522A2 (en) 2011-03-29 2012-10-04 Immunogen, Inc. Process for manufacturing conjugates of improved homogeneity

Non-Patent Citations (37)

* Cited by examiner, † Cited by third party
Title
"Antibodies: A Laboratory Manual", 1988, CSH PRESS
"Immunobiology", 2001, GARLAND PUBLISHING
"Molecular Cloning, A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
BHUYAN, CANCER RES., vol. 42, 1982, pages 3532 - 3537
BOGER ET AL., BIOORG. MED. CHEM. LETT., vol. 1, 1991, pages 115 - 120
BOGER ET AL., J. ORG. CHEM., vol. 55, 1990, pages 5823 - 5833
BURGESS, IMMUNOLOGY TODAY, vol. 5, 1984, pages 155 - 158
CARLSSON ET AL., BIOCHEM. J., vol. 173, 1978, pages 723 - 737
CARTER, NATURE REVS., vol. 6, 2006, pages 343 - 357
CASSIDY, P ET AL.: "Purification Of Staphylococcal Alpha-Toxin By Adsorption Chromatography On Glass.", INFECTION AND IMMUNITY., vol. 13, March 1976 (1976-03-01), pages 982 - 986, XP055184079 *
CHARI ET AL., CANCER RES., vol. 55, 1995, pages 4079 - 4084
CHEMICAL ABSTRACTS, Columbus, Ohio, US; abstract no. 341498-08-6
DESMYTER ET AL., NATURE STRUCT. BIOL., vol. 3, 1996, pages 752
GREENBERG ET AL., NATURE, vol. 374, 1995, pages 168
GRIFFIN ET AL., LEUKEMIA RES., vol. 8, 1984, pages 521
HASKARD; ARCHER, J. IMMUNOL. METHODS, vol. 74, no. 2, 1984, pages 361 - 67
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 81
KAHN, D ET AL.: "Purification Of Plasmid DNA By Tangential Flow Filtration.", BIOTECHNOLOGY AND BIOENGINEERING., vol. 69, 15 May 2000 (2000-05-15), pages 100 - 106, XP002151908 *
KIM ET AL., MOL. CANCER THER., vol. 7, 2008, pages 2486 - 2497
KOHLER; MILSTEIN, EUR. J. IMMUNOL., vol. 5, 1976, pages 511 - 519
LIU ET AL., CANCER RES., vol. 57, 1997, pages 3629 - 3634
NADLER ET AL., J. IMMUNOL., vol. 131, 1983, pages 244 - 250
NISONOFF ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 89, 1960, pages 230 - 244
O'KEEFE ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 932 - 937
PARHAM, J. IMMUNOL., vol. 131, 1983, pages 2895 - 2902
PEDERSEN ET AL., J. MOL. BIOL., vol. 235, 1994, pages 959 - 973
REITER ET AL., PROTEIN ENGINEERING, vol. 7, 1994, pages 697 - 704
RITZ ET AL., NATURE, vol. 283, 1980, pages 583 - 585
RODER ET AL., METHODS ENZYMOL., vol. 121, 1986, pages 140 - 67
ROGUSKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 969 - 73
SPRING ET AL., J. IMMUNOL., vol. 113, 1974, pages 470 - 478
STANFIELD ET AL., SCIENCE, vol. 305, 2004, pages 1770 - 1773
TAYLOR-PAPADIMITRIOU ET AL., INT. J. CANCER, vol. 28, 1981, pages 17 - 21
TROUET ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 626 - 629
UMEMOTO ET AL., INT. J. CANCER, vol. 43, 1989, pages 677 - 684
VAN HOF ET AL., CANCER RES., vol. 56, 1996, pages 5179 - 5185
WARPEHOSKI ET AL., J. MED. CHEM., vol. 31, 1988, pages 590 - 603

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11040084B2 (en) * 2014-04-29 2021-06-22 Genequantum Healthcare (Suzhou) Co., Ltd. Stable antibody-drug conjugate, preparation method therefor, and use thereof
US11911435B2 (en) 2014-04-29 2024-02-27 Genequantum Healthcare (Suzhou) Co., Ltd. Stable antibody-drug conjugate, preparation method therefor, and use thereof
US11911434B2 (en) 2014-04-29 2024-02-27 Genequantum Healthcare (Suzhou) Co., Ltd. Stable antibody-drug conjugate, preparation method therefor, and use thereof
CN106999604A (zh) * 2014-09-02 2017-08-01 伊缪诺金公司 用于配制抗体药物缀合物组合物的方法
US10603388B2 (en) 2014-09-02 2020-03-31 Immunogen, Inc. Methods for formulating antibody drug conjugate compositions
US11717576B2 (en) 2021-03-08 2023-08-08 Genequantum Healthcare (Suzhou) Co., Ltd. Antibody-immune agonist conjugate and applications thereof
WO2024193570A1 (en) * 2023-03-21 2024-09-26 Genequantum Healthcare (Suzhou) Co., Ltd. Combination of antibody-drug conjugate and cancer therapy, and use thereof

Also Published As

Publication number Publication date
JP2016502501A (ja) 2016-01-28
US20150225446A1 (en) 2015-08-13
ZA201502992B (en) 2019-10-30
CN109200290A (zh) 2019-01-15
RU2015116882A (ru) 2016-11-27
AU2013326881B2 (en) 2018-08-02
IL268378A (en) 2019-09-26
EP2904089A1 (en) 2015-08-12
NZ707091A (en) 2018-12-21
HK1213288A1 (zh) 2016-06-30
IL238110A0 (en) 2015-05-31
JP6345181B2 (ja) 2018-06-20
AU2013326881A1 (en) 2015-05-07
SG11201502429YA (en) 2015-04-29
JP2018158925A (ja) 2018-10-11
RU2018122734A (ru) 2018-07-24
IL238110B (en) 2019-08-29
JP2020079294A (ja) 2020-05-28
MX2015004257A (es) 2016-02-09
CN105209592A (zh) 2015-12-30
SG10201702737TA (en) 2017-05-30
EP2904089A4 (en) 2016-05-25
CA2886993A1 (en) 2014-04-10
AU2018241056A1 (en) 2018-10-25
US10035817B2 (en) 2018-07-31
MX359599B (es) 2018-09-12
RU2661083C2 (ru) 2018-07-11
IN2015DN03202A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) 2015-10-02
US20190031712A1 (en) 2019-01-31

Similar Documents

Publication Publication Date Title
US11744900B2 (en) Preparation of maytansinoid antibody conjugates by a one-step process
US20190031712A1 (en) Use of a PVDF membrane to purify cell-binding agent cytotoxic agent conjugates
AU2012236403B2 (en) Process for manufacturing conjugates of improved homogeneity
US20150306242A1 (en) Process for preparing stable antibody maytansinoid conjugates
WO2012135522A2 (en) Process for manufacturing conjugates of improved homogeneity
EP2903450A1 (en) Use of an ion exchange membrane to remove impurities from cell-binding agent cytotoxic agent conjugates
EP2790724A1 (en) Use of n-hydroxysuccinimide to improve conjugate stability
NZ616516B2 (en) Process for manufacturing conjugates of improved homogeneity
NZ616509B2 (en) Preparation of maytansinoid antibody conjugates by a one-step process
NZ712414B2 (en) Preparation of antibody maytansinoid conjugates

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 2013844268

Country of ref document: EP

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13844268

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 14430701

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/004257

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2886993

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 238110

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2015535823

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015007358

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: IDP00201502610

Country of ref document: ID

ENP Entry into the national phase

Ref document number: 2015116882

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013326881

Country of ref document: AU

Date of ref document: 20131004

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112015007358

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150401