WO2014055877A1 - Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates - Google Patents
Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates Download PDFInfo
- Publication number
- WO2014055877A1 WO2014055877A1 PCT/US2013/063480 US2013063480W WO2014055877A1 WO 2014055877 A1 WO2014055877 A1 WO 2014055877A1 US 2013063480 W US2013063480 W US 2013063480W WO 2014055877 A1 WO2014055877 A1 WO 2014055877A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- mixture
- cell
- cytotoxic agent
- binding agent
- chromatography
- Prior art date
Links
- 229940127089 cytotoxic agent Drugs 0.000 title claims abstract description 374
- 239000002254 cytotoxic agent Substances 0.000 title claims abstract description 374
- 231100000599 cytotoxic agent Toxicity 0.000 title claims abstract description 348
- 239000011230 binding agent Substances 0.000 title claims abstract description 311
- 239000012528 membrane Substances 0.000 title claims abstract description 115
- 229920002981 polyvinylidene fluoride Polymers 0.000 title 1
- 239000000203 mixture Substances 0.000 claims abstract description 289
- 238000000034 method Methods 0.000 claims abstract description 210
- 230000008569 process Effects 0.000 claims abstract description 178
- 239000012535 impurity Substances 0.000 claims abstract description 114
- 229920002554 vinyl polymer Polymers 0.000 claims abstract description 10
- 230000001588 bifunctional effect Effects 0.000 claims description 83
- 238000000746 purification Methods 0.000 claims description 83
- 239000003431 cross linking reagent Substances 0.000 claims description 80
- 238000004587 chromatography analysis Methods 0.000 claims description 70
- 230000000274 adsorptive effect Effects 0.000 claims description 69
- ANZJBCHSOXCCRQ-FKUXLPTCSA-N mertansine Chemical compound CO[C@@H]([C@@]1(O)C[C@H](OC(=O)N1)[C@@H](C)[C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(=O)CCS)CC(=O)N1C)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 ANZJBCHSOXCCRQ-FKUXLPTCSA-N 0.000 claims description 50
- 238000006243 chemical reaction Methods 0.000 claims description 43
- 230000027455 binding Effects 0.000 claims description 39
- 239000000539 dimer Substances 0.000 claims description 39
- 238000009295 crossflow filtration Methods 0.000 claims description 35
- -1 β-maleimidopropyloxy-succinimidyl ester Chemical class 0.000 claims description 34
- 238000004255 ion exchange chromatography Methods 0.000 claims description 33
- 238000001914 filtration Methods 0.000 claims description 29
- 238000010791 quenching Methods 0.000 claims description 27
- 239000000243 solution Substances 0.000 claims description 26
- 238000004519 manufacturing process Methods 0.000 claims description 23
- 230000000171 quenching effect Effects 0.000 claims description 19
- 239000003153 chemical reaction reagent Substances 0.000 claims description 14
- 230000002829 reductive effect Effects 0.000 claims description 14
- 150000002148 esters Chemical group 0.000 claims description 12
- 229910052588 hydroxylapatite Inorganic materials 0.000 claims description 11
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 claims description 11
- 238000001556 precipitation Methods 0.000 claims description 11
- 239000006172 buffering agent Substances 0.000 claims description 10
- 238000001597 immobilized metal affinity chromatography Methods 0.000 claims description 10
- 239000011148 porous material Substances 0.000 claims description 10
- OWXMKDGYPWMGEB-UHFFFAOYSA-N HEPPS Chemical compound OCCN1CCN(CCCS(O)(=O)=O)CC1 OWXMKDGYPWMGEB-UHFFFAOYSA-N 0.000 claims description 9
- 229940123237 Taxane Drugs 0.000 claims description 9
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 claims description 8
- 108010002350 Interleukin-2 Proteins 0.000 claims description 8
- 102000000588 Interleukin-2 Human genes 0.000 claims description 8
- JOCBASBOOFNAJA-UHFFFAOYSA-N N-tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid Chemical compound OCC(CO)(CO)NCCS(O)(=O)=O JOCBASBOOFNAJA-UHFFFAOYSA-N 0.000 claims description 8
- GTBCXYYVWHFQRS-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(pyridin-2-yldisulfanyl)pentanoate Chemical compound C=1C=CC=NC=1SSC(C)CCC(=O)ON1C(=O)CCC1=O GTBCXYYVWHFQRS-UHFFFAOYSA-N 0.000 claims description 7
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 7
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 7
- 239000002253 acid Substances 0.000 claims description 7
- 230000001268 conjugating effect Effects 0.000 claims description 7
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 6
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 claims description 6
- 108091005804 Peptidases Proteins 0.000 claims description 6
- 102000035195 Peptidases Human genes 0.000 claims description 6
- 239000000919 ceramic Substances 0.000 claims description 6
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims description 6
- 239000003446 ligand Substances 0.000 claims description 6
- 235000019833 protease Nutrition 0.000 claims description 6
- 108090000371 Esterases Proteins 0.000 claims description 5
- 102000004877 Insulin Human genes 0.000 claims description 5
- 108090001061 Insulin Proteins 0.000 claims description 5
- 108010002386 Interleukin-3 Proteins 0.000 claims description 5
- 102000000646 Interleukin-3 Human genes 0.000 claims description 5
- 102000004388 Interleukin-4 Human genes 0.000 claims description 5
- 108090000978 Interleukin-4 Proteins 0.000 claims description 5
- 102000004889 Interleukin-6 Human genes 0.000 claims description 5
- 108090001005 Interleukin-6 Proteins 0.000 claims description 5
- 229930006000 Sucrose Natural products 0.000 claims description 5
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 claims description 5
- 125000002228 disulfide group Chemical group 0.000 claims description 5
- 230000002209 hydrophobic effect Effects 0.000 claims description 5
- 229940076264 interleukin-3 Drugs 0.000 claims description 5
- 229940028885 interleukin-4 Drugs 0.000 claims description 5
- 229940100601 interleukin-6 Drugs 0.000 claims description 5
- 239000005720 sucrose Substances 0.000 claims description 5
- 229960000575 trastuzumab Drugs 0.000 claims description 5
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 claims description 4
- PVGATNRYUYNBHO-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(2,5-dioxopyrrol-1-yl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCN1C(=O)C=CC1=O PVGATNRYUYNBHO-UHFFFAOYSA-N 0.000 claims description 4
- JSHOVKSMJRQOGY-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(pyridin-2-yldisulfanyl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCSSC1=CC=CC=N1 JSHOVKSMJRQOGY-UHFFFAOYSA-N 0.000 claims description 4
- PMJWDPGOWBRILU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(C=C1)=CC=C1N1C(=O)C=CC1=O PMJWDPGOWBRILU-UHFFFAOYSA-N 0.000 claims description 4
- LVQFQZZGTZFUNF-UHFFFAOYSA-N 2-hydroxy-3-[4-(2-hydroxy-3-sulfonatopropyl)piperazine-1,4-diium-1-yl]propane-1-sulfonate Chemical compound OS(=O)(=O)CC(O)CN1CCN(CC(O)CS(O)(=O)=O)CC1 LVQFQZZGTZFUNF-UHFFFAOYSA-N 0.000 claims description 4
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 claims description 4
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 claims description 4
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 claims description 4
- 239000007995 HEPES buffer Substances 0.000 claims description 4
- 239000007996 HEPPS buffer Substances 0.000 claims description 4
- GIZQLVPDAOBAFN-UHFFFAOYSA-N HEPPSO Chemical compound OCCN1CCN(CC(O)CS(O)(=O)=O)CC1 GIZQLVPDAOBAFN-UHFFFAOYSA-N 0.000 claims description 4
- 102000014150 Interferons Human genes 0.000 claims description 4
- 108010050904 Interferons Proteins 0.000 claims description 4
- 102100028123 Macrophage colony-stimulating factor 1 Human genes 0.000 claims description 4
- 239000008351 acetate buffer Substances 0.000 claims description 4
- 238000001042 affinity chromatography Methods 0.000 claims description 4
- 239000007979 citrate buffer Substances 0.000 claims description 4
- 230000006698 induction Effects 0.000 claims description 4
- 102000006495 integrins Human genes 0.000 claims description 4
- 108010044426 integrins Proteins 0.000 claims description 4
- 239000008363 phosphate buffer Substances 0.000 claims description 4
- 238000004366 reverse phase liquid chromatography Methods 0.000 claims description 4
- YCLWMUYXEGEIGD-UHFFFAOYSA-M sodium;2-hydroxy-3-[4-(2-hydroxyethyl)piperazin-1-yl]propane-1-sulfonate Chemical compound [Na+].OCCN1CCN(CC(O)CS([O-])(=O)=O)CC1 YCLWMUYXEGEIGD-UHFFFAOYSA-M 0.000 claims description 4
- 239000008362 succinate buffer Substances 0.000 claims description 4
- 125000003396 thiol group Chemical group [H]S* 0.000 claims description 4
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 claims description 3
- IUTPJBLLJJNPAJ-UHFFFAOYSA-N 3-(2,5-dioxopyrrol-1-yl)propanoic acid Chemical compound OC(=O)CCN1C(=O)C=CC1=O IUTPJBLLJJNPAJ-UHFFFAOYSA-N 0.000 claims description 3
- NCPQROHLJFARLL-UHFFFAOYSA-N 4-(2,5-dioxopyrrol-1-yl)butanoic acid Chemical compound OC(=O)CCCN1C(=O)C=CC1=O NCPQROHLJFARLL-UHFFFAOYSA-N 0.000 claims description 3
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 claims description 3
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 claims description 3
- 101100369076 Mus musculus Tdgf1 gene Proteins 0.000 claims description 3
- 102000004338 Transferrin Human genes 0.000 claims description 3
- 108090000901 Transferrin Proteins 0.000 claims description 3
- 239000002355 dual-layer Substances 0.000 claims description 3
- 108020005243 folate receptor Proteins 0.000 claims description 3
- 102000006815 folate receptor Human genes 0.000 claims description 3
- 125000005179 haloacetyl group Chemical group 0.000 claims description 3
- 229940125396 insulin Drugs 0.000 claims description 3
- 229940047124 interferons Drugs 0.000 claims description 3
- 239000012581 transferrin Substances 0.000 claims description 3
- TYKASZBHFXBROF-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-(2,5-dioxopyrrol-1-yl)acetate Chemical compound O=C1CCC(=O)N1OC(=O)CN1C(=O)C=CC1=O TYKASZBHFXBROF-UHFFFAOYSA-N 0.000 claims description 2
- VLARLSIGSPVYHX-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-(2,5-dioxopyrrol-1-yl)hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O VLARLSIGSPVYHX-UHFFFAOYSA-N 0.000 claims description 2
- FUHCFUVCWLZEDQ-UHFFFAOYSA-N 1-(2,5-dioxopyrrolidin-1-yl)oxy-1-oxo-4-(pyridin-2-yldisulfanyl)butane-2-sulfonic acid Chemical compound O=C1CCC(=O)N1OC(=O)C(S(=O)(=O)O)CCSSC1=CC=CC=N1 FUHCFUVCWLZEDQ-UHFFFAOYSA-N 0.000 claims description 2
- OJQSISYVGFJJBY-UHFFFAOYSA-N 1-(4-isocyanatophenyl)pyrrole-2,5-dione Chemical compound C1=CC(N=C=O)=CC=C1N1C(=O)C=CC1=O OJQSISYVGFJJBY-UHFFFAOYSA-N 0.000 claims description 2
- WTTBAQAXSWGSLB-UHFFFAOYSA-N 2-(2,5-dioxopyrrolidin-1-yl)-6-[3-(2,5-dioxopyrrol-1-yl)propanoylamino]hexanoic acid Chemical compound O=C1CCC(=O)N1C(C(=O)O)CCCCNC(=O)CCN1C(=O)C=CC1=O WTTBAQAXSWGSLB-UHFFFAOYSA-N 0.000 claims description 2
- QPPUSXURIGJCFQ-UHFFFAOYSA-N 2-[(2-iodoacetyl)amino]propanoic acid Chemical compound OC(=O)C(C)NC(=O)CI QPPUSXURIGJCFQ-UHFFFAOYSA-N 0.000 claims description 2
- LQILVUYCDHSGEU-UHFFFAOYSA-N 4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexane-1-carboxylic acid Chemical compound C1CC(C(=O)O)CCC1CN1C(=O)C=CC1=O LQILVUYCDHSGEU-UHFFFAOYSA-N 0.000 claims description 2
- HBEDKBRARKFPIC-UHFFFAOYSA-N 6-(2,5-dioxopyrrol-1-yl)hexanoic acid;1-hydroxypyrrolidine-2,5-dione Chemical compound ON1C(=O)CCC1=O.OC(=O)CCCCCN1C(=O)C=CC1=O HBEDKBRARKFPIC-UHFFFAOYSA-N 0.000 claims description 2
- 101001099381 Homo sapiens Peroxisomal biogenesis factor 19 Proteins 0.000 claims description 2
- GHAZCVNUKKZTLG-UHFFFAOYSA-N N-ethyl-succinimide Natural products CCN1C(=O)CCC1=O GHAZCVNUKKZTLG-UHFFFAOYSA-N 0.000 claims description 2
- HDFGOPSGAURCEO-UHFFFAOYSA-N N-ethylmaleimide Chemical compound CCN1C(=O)C=CC1=O HDFGOPSGAURCEO-UHFFFAOYSA-N 0.000 claims description 2
- 102100038883 Peroxisomal biogenesis factor 19 Human genes 0.000 claims description 2
- 230000003432 anti-folate effect Effects 0.000 claims description 2
- 229940127074 antifolate Drugs 0.000 claims description 2
- 229950002903 bivatuzumab Drugs 0.000 claims description 2
- 239000004052 folic acid antagonist Substances 0.000 claims description 2
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 claims description 2
- 239000012948 isocyanate Substances 0.000 claims description 2
- 150000002513 isocyanates Chemical class 0.000 claims description 2
- 229920000889 poly(m-phenylene isophthalamide) Polymers 0.000 claims description 2
- 229960004641 rituximab Drugs 0.000 claims description 2
- 229950008684 sibrotuzumab Drugs 0.000 claims description 2
- 229960002317 succinimide Drugs 0.000 claims description 2
- 230000008685 targeting Effects 0.000 claims description 2
- 238000004191 hydrophobic interaction chromatography Methods 0.000 claims 6
- HSXUNHYXJWDLDK-UHFFFAOYSA-N 2-hydroxypropane-1-sulfonic acid Chemical compound CC(O)CS(O)(=O)=O HSXUNHYXJWDLDK-UHFFFAOYSA-N 0.000 claims 2
- JKHVDAUOODACDU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCN1C(=O)C=CC1=O JKHVDAUOODACDU-UHFFFAOYSA-N 0.000 claims 1
- IHVODYOQUSEYJJ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]amino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)C(CC1)CCC1CN1C(=O)C=CC1=O IHVODYOQUSEYJJ-UHFFFAOYSA-N 0.000 claims 1
- 101150021185 FGF gene Proteins 0.000 claims 1
- 101710127797 Macrophage colony-stimulating factor 1 Proteins 0.000 claims 1
- 210000004027 cell Anatomy 0.000 description 287
- 239000000562 conjugate Substances 0.000 description 166
- 125000005647 linker group Chemical group 0.000 description 119
- 229960005558 mertansine Drugs 0.000 description 58
- 230000021615 conjugation Effects 0.000 description 43
- 125000004432 carbon atom Chemical group C* 0.000 description 40
- 125000003342 alkenyl group Chemical group 0.000 description 33
- 239000000427 antigen Substances 0.000 description 33
- 102000036639 antigens Human genes 0.000 description 32
- 108091007433 antigens Proteins 0.000 description 31
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 25
- 239000011347 resin Substances 0.000 description 25
- 229920005989 resin Polymers 0.000 description 25
- 230000004048 modification Effects 0.000 description 23
- 238000012986 modification Methods 0.000 description 23
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 22
- 206010028980 Neoplasm Diseases 0.000 description 21
- 238000006011 modification reaction Methods 0.000 description 21
- 241000894007 species Species 0.000 description 21
- 125000006615 aromatic heterocyclic group Chemical group 0.000 description 18
- 125000000217 alkyl group Chemical group 0.000 description 16
- 150000001875 compounds Chemical class 0.000 description 14
- UOWVMDUEMSNCAV-WYENRQIDSA-N rachelmycin Chemical compound C1([C@]23C[C@@H]2CN1C(=O)C=1NC=2C(OC)=C(O)C4=C(C=2C=1)CCN4C(=O)C1=CC=2C=4CCN(C=4C(O)=C(C=2N1)OC)C(N)=O)=CC(=O)C1=C3C(C)=CN1 UOWVMDUEMSNCAV-WYENRQIDSA-N 0.000 description 14
- 239000012634 fragment Substances 0.000 description 12
- 239000006227 byproduct Substances 0.000 description 11
- 201000011510 cancer Diseases 0.000 description 11
- 239000011541 reaction mixture Substances 0.000 description 11
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 10
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 10
- QWPXBEHQFHACTK-KZVYIGENSA-N (10e,12e)-86-chloro-12,14,4-trihydroxy-85,14-dimethoxy-33,2,7,10-tetramethyl-15,16-dihydro-14h-7-aza-1(6,4)-oxazina-3(2,3)-oxirana-8(1,3)-benzenacyclotetradecaphane-10,12-dien-6-one Chemical compound CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-KZVYIGENSA-N 0.000 description 9
- 229920002684 Sepharose Polymers 0.000 description 8
- 231100000433 cytotoxic Toxicity 0.000 description 8
- 230000001472 cytotoxic effect Effects 0.000 description 8
- 210000004408 hybridoma Anatomy 0.000 description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 7
- 125000003107 substituted aryl group Chemical group 0.000 description 7
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 6
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 6
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 6
- 210000003719 b-lymphocyte Anatomy 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 229940047120 colony stimulating factors Drugs 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 239000000376 reactant Substances 0.000 description 6
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 5
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 5
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 5
- QWPXBEHQFHACTK-UHFFFAOYSA-N Maytansinol Natural products CN1C(=O)CC(O)C2(C)OC2C(C)C(OC(=O)N2)CC2(O)C(OC)C=CC=C(C)CC2=CC(OC)=C(Cl)C1=C2 QWPXBEHQFHACTK-UHFFFAOYSA-N 0.000 description 5
- 241001529936 Murinae Species 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 5
- 239000000611 antibody drug conjugate Substances 0.000 description 5
- 229940049595 antibody-drug conjugate Drugs 0.000 description 5
- 239000012539 chromatography resin Substances 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 229940126864 fibroblast growth factor Drugs 0.000 description 5
- 239000003102 growth factor Substances 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 125000002816 methylsulfanyl group Chemical group [H]C([H])([H])S[*] 0.000 description 5
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 5
- 102000004169 proteins and genes Human genes 0.000 description 5
- 108090000623 proteins and genes Proteins 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 5
- NMWKYTGJWUAZPZ-WWHBDHEGSA-N (4S)-4-[[(4R,7S,10S,16S,19S,25S,28S,31R)-31-[[(2S)-2-[[(1R,6R,9S,12S,18S,21S,24S,27S,30S,33S,36S,39S,42R,47R,53S,56S,59S,62S,65S,68S,71S,76S,79S,85S)-47-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-methylbutanoyl]amino]-3-methylbutanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-phenylpropanoyl]amino]-4-oxobutanoyl]amino]-3-carboxypropanoyl]amino]-18-(4-aminobutyl)-27,68-bis(3-amino-3-oxopropyl)-36,71,76-tribenzyl-39-(3-carbamimidamidopropyl)-24-(2-carboxyethyl)-21,56-bis(carboxymethyl)-65,85-bis[(1R)-1-hydroxyethyl]-59-(hydroxymethyl)-62,79-bis(1H-imidazol-4-ylmethyl)-9-methyl-33-(2-methylpropyl)-8,11,17,20,23,26,29,32,35,38,41,48,54,57,60,63,66,69,72,74,77,80,83,86-tetracosaoxo-30-propan-2-yl-3,4,44,45-tetrathia-7,10,16,19,22,25,28,31,34,37,40,49,55,58,61,64,67,70,73,75,78,81,84,87-tetracosazatetracyclo[40.31.14.012,16.049,53]heptaoctacontane-6-carbonyl]amino]-3-methylbutanoyl]amino]-7-(3-carbamimidamidopropyl)-25-(hydroxymethyl)-19-[(4-hydroxyphenyl)methyl]-28-(1H-imidazol-4-ylmethyl)-10-methyl-6,9,12,15,18,21,24,27,30-nonaoxo-16-propan-2-yl-1,2-dithia-5,8,11,14,17,20,23,26,29-nonazacyclodotriacontane-4-carbonyl]amino]-5-[[(2S)-1-[[(2S)-1-[[(2S)-3-carboxy-1-[[(2S)-1-[[(2S)-1-[[(1S)-1-carboxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid Chemical compound CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](Cc4ccccc4)NC3=O)[C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc3ccccc3)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N3CCC[C@H]3C(=O)N[C@@H](C)C(=O)N2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2c[nH]cn2)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1)C(=O)N[C@@H](C)C(O)=O NMWKYTGJWUAZPZ-WWHBDHEGSA-N 0.000 description 4
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 4
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 4
- 102100029268 Neurotrophin-3 Human genes 0.000 description 4
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 4
- 102400001320 Transforming growth factor alpha Human genes 0.000 description 4
- 239000003011 anion exchange membrane Substances 0.000 description 4
- 125000003118 aryl group Chemical group 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 238000005580 one pot reaction Methods 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 102000004196 processed proteins & peptides Human genes 0.000 description 4
- 238000003860 storage Methods 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 229910052717 sulfur Inorganic materials 0.000 description 4
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- 102000001301 EGF receptor Human genes 0.000 description 3
- 108060006698 EGF receptor Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 102100037241 Endoglin Human genes 0.000 description 3
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 3
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 3
- 101000628547 Homo sapiens Metalloreductase STEAP1 Proteins 0.000 description 3
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 3
- 101000834948 Homo sapiens Tomoregulin-2 Proteins 0.000 description 3
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 3
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 3
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 3
- 239000000637 Melanocyte-Stimulating Hormone Substances 0.000 description 3
- 108010007013 Melanocyte-Stimulating Hormones Proteins 0.000 description 3
- 102100026712 Metalloreductase STEAP1 Human genes 0.000 description 3
- 108010025020 Nerve Growth Factor Proteins 0.000 description 3
- 108090000099 Neurotrophin-4 Proteins 0.000 description 3
- 102100033857 Neurotrophin-4 Human genes 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 108010056088 Somatostatin Proteins 0.000 description 3
- 102000005157 Somatostatin Human genes 0.000 description 3
- 241000187747 Streptomyces Species 0.000 description 3
- 102100026160 Tomoregulin-2 Human genes 0.000 description 3
- 125000002252 acyl group Chemical group 0.000 description 3
- 230000030833 cell death Effects 0.000 description 3
- 125000003636 chemical group Chemical group 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 125000000392 cycloalkenyl group Chemical group 0.000 description 3
- 125000000753 cycloalkyl group Chemical group 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 229960003668 docetaxel Drugs 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 235000019152 folic acid Nutrition 0.000 description 3
- 239000011724 folic acid Substances 0.000 description 3
- 229940088597 hormone Drugs 0.000 description 3
- 239000005556 hormone Substances 0.000 description 3
- 239000012982 microporous membrane Substances 0.000 description 3
- 239000012038 nucleophile Substances 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 125000001453 quaternary ammonium group Chemical group 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- NHXLMOGPVYXJNR-ATOGVRKGSA-N somatostatin Chemical compound C([C@H]1C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N1)[C@@H](C)O)NC(=O)CNC(=O)[C@H](C)N)C(O)=O)=O)[C@H](O)C)C1=CC=CC=C1 NHXLMOGPVYXJNR-ATOGVRKGSA-N 0.000 description 3
- 229960000553 somatostatin Drugs 0.000 description 3
- 125000001424 substituent group Chemical group 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 125000004434 sulfur atom Chemical group 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 150000003573 thiols Chemical class 0.000 description 3
- 230000001988 toxicity Effects 0.000 description 3
- 231100000419 toxicity Toxicity 0.000 description 3
- NKUZQMZWTZAPSN-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-bromoacetate Chemical compound BrCC(=O)ON1C(=O)CCC1=O NKUZQMZWTZAPSN-UHFFFAOYSA-N 0.000 description 2
- VRDGQQTWSGDXCU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-iodoacetate Chemical compound ICC(=O)ON1C(=O)CCC1=O VRDGQQTWSGDXCU-UHFFFAOYSA-N 0.000 description 2
- WGMMKWFUXPMTRW-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-[(2-bromoacetyl)amino]propanoate Chemical compound BrCC(=O)NCCC(=O)ON1C(=O)CCC1=O WGMMKWFUXPMTRW-UHFFFAOYSA-N 0.000 description 2
- IADUWZMNTKHTIN-MLSWMBHTSA-N (2,5-dioxopyrrolidin-1-yl) 4-[[3-[3-[[(2S)-1-[[(1S,2R,3S,5S,6S,16E,18E,20R,21S)-11-chloro-21-hydroxy-12,20-dimethoxy-2,5,9,16-tetramethyl-8,23-dioxo-4,24-dioxa-9,22-diazatetracyclo[19.3.1.110,14.03,5]hexacosa-10,12,14(26),16,18-pentaen-6-yl]oxy]-1-oxopropan-2-yl]-methylamino]-3-oxopropyl]sulfanyl-2,5-dioxopyrrolidin-1-yl]methyl]cyclohexane-1-carboxylate Chemical compound CO[C@@H]1\C=C\C=C(C)\Cc2cc(OC)c(Cl)c(c2)N(C)C(=O)C[C@H](OC(=O)[C@H](C)N(C)C(=O)CCSC2CC(=O)N(CC3CCC(CC3)C(=O)ON3C(=O)CCC3=O)C2=O)[C@]2(C)O[C@H]2[C@H](C)[C@@H]2C[C@@]1(O)NC(=O)O2 IADUWZMNTKHTIN-MLSWMBHTSA-N 0.000 description 2
- DLKUYSQUHXBYPB-NSSHGSRYSA-N (2s,4r)-4-[[2-[(1r,3r)-1-acetyloxy-4-methyl-3-[3-methylbutanoyloxymethyl-[(2s,3s)-3-methyl-2-[[(2r)-1-methylpiperidine-2-carbonyl]amino]pentanoyl]amino]pentyl]-1,3-thiazole-4-carbonyl]amino]-2-methyl-5-(4-methylphenyl)pentanoic acid Chemical compound N([C@@H]([C@@H](C)CC)C(=O)N(COC(=O)CC(C)C)[C@H](C[C@@H](OC(C)=O)C=1SC=C(N=1)C(=O)N[C@H](C[C@H](C)C(O)=O)CC=1C=CC(C)=CC=1)C(C)C)C(=O)[C@H]1CCCCN1C DLKUYSQUHXBYPB-NSSHGSRYSA-N 0.000 description 2
- RVRLFABOQXZUJX-UHFFFAOYSA-N 1-[1-(2,5-dioxopyrrol-1-yl)ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1C(C)N1C(=O)C=CC1=O RVRLFABOQXZUJX-UHFFFAOYSA-N 0.000 description 2
- AASYSXRGODIQGY-UHFFFAOYSA-N 1-[1-(2,5-dioxopyrrol-1-yl)hexyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1C(CCCCC)N1C(=O)C=CC1=O AASYSXRGODIQGY-UHFFFAOYSA-N 0.000 description 2
- SGVWDRVQIYUSRA-UHFFFAOYSA-N 1-[2-[2-(2,5-dioxopyrrol-1-yl)ethyldisulfanyl]ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCSSCCN1C(=O)C=CC1=O SGVWDRVQIYUSRA-UHFFFAOYSA-N 0.000 description 2
- DIYPCWKHSODVAP-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=CC(N2C(C=CC2=O)=O)=C1 DIYPCWKHSODVAP-UHFFFAOYSA-N 0.000 description 2
- FPKVOQKZMBDBKP-UHFFFAOYSA-N 1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 FPKVOQKZMBDBKP-UHFFFAOYSA-N 0.000 description 2
- VHYRLCJMMJQUBY-UHFFFAOYSA-N 1-[4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoyloxy]-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCC1=CC=C(N2C(C=CC2=O)=O)C=C1 VHYRLCJMMJQUBY-UHFFFAOYSA-N 0.000 description 2
- KTLUMOZOWZSJFC-UHFFFAOYSA-N 3-azatetracyclo[7.5.0.02,6.012,14]tetradeca-1,3,5,7,9,11,13-heptaene Chemical compound C1=C2C=CN=C2C2=C3C=C3C=CC2=C1 KTLUMOZOWZSJFC-UHFFFAOYSA-N 0.000 description 2
- ZMRMMAOBSFSXLN-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanehydrazide Chemical compound C1=CC(CCCC(=O)NN)=CC=C1N1C(=O)C=CC1=O ZMRMMAOBSFSXLN-UHFFFAOYSA-N 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 2
- 102100036526 Anoctamin-7 Human genes 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 102000007350 Bone Morphogenetic Proteins Human genes 0.000 description 2
- 108010007726 Bone Morphogenetic Proteins Proteins 0.000 description 2
- 102100025221 CD70 antigen Human genes 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 2
- 230000004568 DNA-binding Effects 0.000 description 2
- 241001269524 Dura Species 0.000 description 2
- 108010036395 Endoglin Proteins 0.000 description 2
- 102000050554 Eph Family Receptors Human genes 0.000 description 2
- 108091008815 Eph receptors Proteins 0.000 description 2
- 108010055196 EphA2 Receptor Proteins 0.000 description 2
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 2
- 102400001368 Epidermal growth factor Human genes 0.000 description 2
- 101800003838 Epidermal growth factor Proteins 0.000 description 2
- 208000009329 Graft vs Host Disease Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000928370 Homo sapiens Anoctamin-7 Proteins 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 2
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 2
- 101000721757 Homo sapiens Olfactory receptor 51E2 Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 101000874179 Homo sapiens Syndecan-1 Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 2
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 2
- 102000006992 Interferon-alpha Human genes 0.000 description 2
- 108010047761 Interferon-alpha Proteins 0.000 description 2
- 102000003996 Interferon-beta Human genes 0.000 description 2
- 108090000467 Interferon-beta Proteins 0.000 description 2
- 102000008070 Interferon-gamma Human genes 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- XNSAINXGIQZQOO-UHFFFAOYSA-N L-pyroglutamyl-L-histidyl-L-proline amide Natural products NC(=O)C1CCCN1C(=O)C(NC(=O)C1NC(=O)CC1)CC1=CN=CN1 XNSAINXGIQZQOO-UHFFFAOYSA-N 0.000 description 2
- 108090001090 Lectins Proteins 0.000 description 2
- 102000004856 Lectins Human genes 0.000 description 2
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 2
- 102000008072 Lymphokines Human genes 0.000 description 2
- 108010074338 Lymphokines Proteins 0.000 description 2
- OFOBLEOULBTSOW-UHFFFAOYSA-N Malonic acid Chemical compound OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 108090000742 Neurotrophin 3 Proteins 0.000 description 2
- 102100025128 Olfactory receptor 51E2 Human genes 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 2
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 2
- 239000004695 Polyether sulfone Substances 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 208000009052 Precursor T-Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 102100035721 Syndecan-1 Human genes 0.000 description 2
- 208000029052 T-cell acute lymphoblastic leukemia Diseases 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 108010000499 Thromboplastin Proteins 0.000 description 2
- 239000000627 Thyrotropin-Releasing Hormone Substances 0.000 description 2
- 102400000336 Thyrotropin-releasing hormone Human genes 0.000 description 2
- 101800004623 Thyrotropin-releasing hormone Proteins 0.000 description 2
- 102100030859 Tissue factor Human genes 0.000 description 2
- 108010009583 Transforming Growth Factors Proteins 0.000 description 2
- 102000009618 Transforming Growth Factors Human genes 0.000 description 2
- 206010052779 Transplant rejections Diseases 0.000 description 2
- 201000011186 acute T cell leukemia Diseases 0.000 description 2
- 230000002152 alkylating effect Effects 0.000 description 2
- 150000001413 amino acids Chemical group 0.000 description 2
- 238000007098 aminolysis reaction Methods 0.000 description 2
- 239000003098 androgen Substances 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000003114 blood coagulation factor Substances 0.000 description 2
- 229940112869 bone morphogenetic protein Drugs 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 230000017858 demethylation Effects 0.000 description 2
- 238000010520 demethylation reaction Methods 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 229930188854 dolastatin Natural products 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 2
- 229940116977 epidermal growth factor Drugs 0.000 description 2
- 229940014144 folate Drugs 0.000 description 2
- 208000024908 graft versus host disease Diseases 0.000 description 2
- 239000013628 high molecular weight specie Substances 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 125000004356 hydroxy functional group Chemical group O* 0.000 description 2
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 229940047122 interleukins Drugs 0.000 description 2
- 238000011031 large-scale manufacturing process Methods 0.000 description 2
- 239000002523 lectin Substances 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 210000000066 myeloid cell Anatomy 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 230000000955 neuroendocrine Effects 0.000 description 2
- 239000003900 neurotrophic factor Substances 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 229920006393 polyether sulfone Polymers 0.000 description 2
- 229910000160 potassium phosphate Inorganic materials 0.000 description 2
- 235000011009 potassium phosphates Nutrition 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- XNSAINXGIQZQOO-SRVKXCTJSA-N protirelin Chemical compound NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H]1NC(=O)CC1)CC1=CN=CN1 XNSAINXGIQZQOO-SRVKXCTJSA-N 0.000 description 2
- HHSGWIABCIVPJT-UHFFFAOYSA-M sodium;1-[4-[(2-iodoacetyl)amino]benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1=CC=C(NC(=O)CI)C=C1 HHSGWIABCIVPJT-UHFFFAOYSA-M 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- XOAAWQZATWQOTB-UHFFFAOYSA-N taurine Chemical compound NCCS(O)(=O)=O XOAAWQZATWQOTB-UHFFFAOYSA-N 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 229940034199 thyrotropin-releasing hormone Drugs 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- ULZJAHZPCLFGHQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 5-(2,5-dioxopyrrol-1-yl)pentanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCN1C(=O)C=CC1=O ULZJAHZPCLFGHQ-UHFFFAOYSA-N 0.000 description 1
- LTDQGCFMTVHZKP-UHFFFAOYSA-N (4-bromophenyl)-(4,6-dimethoxy-3-methyl-1-benzofuran-2-yl)methanone Chemical compound O1C2=CC(OC)=CC(OC)=C2C(C)=C1C(=O)C1=CC=C(Br)C=C1 LTDQGCFMTVHZKP-UHFFFAOYSA-N 0.000 description 1
- VNJBTKQBKFMEHH-UHFFFAOYSA-N 1-[4-(2,5-dioxopyrrol-1-yl)-2,3-dihydroxybutyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CC(O)C(O)CN1C(=O)C=CC1=O VNJBTKQBKFMEHH-UHFFFAOYSA-N 0.000 description 1
- WXXSHAKLDCERGU-UHFFFAOYSA-N 1-[4-(2,5-dioxopyrrol-1-yl)butyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCCCN1C(=O)C=CC1=O WXXSHAKLDCERGU-UHFFFAOYSA-N 0.000 description 1
- 125000001917 2,4-dinitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C(=C1*)[N+]([O-])=O)[N+]([O-])=O 0.000 description 1
- OWDQCSBZQVISPN-UHFFFAOYSA-N 2-[(2,5-dioxopyrrolidin-1-yl)amino]-4-(2-iodoacetyl)benzoic acid Chemical compound OC(=O)C1=CC=C(C(=O)CI)C=C1NN1C(=O)CCC1=O OWDQCSBZQVISPN-UHFFFAOYSA-N 0.000 description 1
- GUPXYSSGJWIURR-UHFFFAOYSA-N 3-octoxypropane-1,2-diol Chemical compound CCCCCCCCOCC(O)CO GUPXYSSGJWIURR-UHFFFAOYSA-N 0.000 description 1
- QXZBMSIDSOZZHK-DOPDSADYSA-N 31362-50-2 Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1NC(=O)CC1)C(C)C)C1=CNC=N1 QXZBMSIDSOZZHK-DOPDSADYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 241000186046 Actinomyces Species 0.000 description 1
- 108010059616 Activins Proteins 0.000 description 1
- 102000005606 Activins Human genes 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 101800001288 Atrial natriuretic factor Proteins 0.000 description 1
- 102400001282 Atrial natriuretic peptide Human genes 0.000 description 1
- 101800001890 Atrial natriuretic peptide Proteins 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 1
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 1
- 102000013585 Bombesin Human genes 0.000 description 1
- 108010051479 Bombesin Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 239000012619 Butyl Sepharose® Substances 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- SLWIZYINNFAVIU-RJIXDBCESA-N CC(C1OC1(C)C(CC(N(C)c(cc(C/C(/C)=C/C=C/C(C(C1)(N2)O)OC)cc3OC)c3Cl)=O)OC(C(N(C)C(CCSC(CC(N3CC(CC4)CCC4C(O)=O)=O)C3=O)=C)OC)=O)C1OC2=O Chemical compound CC(C1OC1(C)C(CC(N(C)c(cc(C/C(/C)=C/C=C/C(C(C1)(N2)O)OC)cc3OC)c3Cl)=O)OC(C(N(C)C(CCSC(CC(N3CC(CC4)CCC4C(O)=O)=O)C3=O)=C)OC)=O)C1OC2=O SLWIZYINNFAVIU-RJIXDBCESA-N 0.000 description 1
- 0 CC(C1OC1(C)C(CC(N(C)c1c(C)c(OC)cc(CC(C)=CC=C[C@@](C(C2)(N3)O)OC)c1)=O)OC(C1N(C)C(CCSC(CC(N4CC(CC5)CCC5C(ON(C(CC5)=O)C5=O)=O)=O)C4=O)=*1)=O)C2OC3=O Chemical compound CC(C1OC1(C)C(CC(N(C)c1c(C)c(OC)cc(CC(C)=CC=C[C@@](C(C2)(N3)O)OC)c1)=O)OC(C1N(C)C(CCSC(CC(N4CC(CC5)CCC5C(ON(C(CC5)=O)C5=O)=O)=O)C4=O)=*1)=O)C2OC3=O 0.000 description 1
- 108010046080 CD27 Ligand Proteins 0.000 description 1
- 102000049320 CD36 Human genes 0.000 description 1
- 108010045374 CD36 Antigens Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 108010009575 CD55 Antigens Proteins 0.000 description 1
- 102100022002 CD59 glycoprotein Human genes 0.000 description 1
- 102100027221 CD81 antigen Human genes 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 102400000113 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 241000251730 Chondrichthyes Species 0.000 description 1
- 102100022641 Coagulation factor IX Human genes 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 1
- 102100032768 Complement receptor type 2 Human genes 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 1
- 101100421450 Drosophila melanogaster Shark gene Proteins 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 101710181478 Envelope glycoprotein GP350 Proteins 0.000 description 1
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- 108091008794 FGF receptors Proteins 0.000 description 1
- 108010076282 Factor IX Proteins 0.000 description 1
- 102100031517 Fc receptor-like protein 1 Human genes 0.000 description 1
- 102100031511 Fc receptor-like protein 2 Human genes 0.000 description 1
- 102100031512 Fc receptor-like protein 3 Human genes 0.000 description 1
- 102100031513 Fc receptor-like protein 4 Human genes 0.000 description 1
- 102100031507 Fc receptor-like protein 5 Human genes 0.000 description 1
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 1
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 1
- 102100031706 Fibroblast growth factor 1 Human genes 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 1
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 1
- 102100035139 Folate receptor alpha Human genes 0.000 description 1
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 1
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 1
- 102400000321 Glucagon Human genes 0.000 description 1
- 108060003199 Glucagon Proteins 0.000 description 1
- 102000006771 Gonadotropins Human genes 0.000 description 1
- 108010086677 Gonadotropins Proteins 0.000 description 1
- 108010051696 Growth Hormone Proteins 0.000 description 1
- 239000000095 Growth Hormone-Releasing Hormone Substances 0.000 description 1
- 241001622557 Hesperia Species 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000914479 Homo sapiens CD81 antigen Proteins 0.000 description 1
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 1
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 1
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 description 1
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 1
- 101000846913 Homo sapiens Fc receptor-like protein 1 Proteins 0.000 description 1
- 101000846911 Homo sapiens Fc receptor-like protein 2 Proteins 0.000 description 1
- 101000846910 Homo sapiens Fc receptor-like protein 3 Proteins 0.000 description 1
- 101000846909 Homo sapiens Fc receptor-like protein 4 Proteins 0.000 description 1
- 101000846908 Homo sapiens Fc receptor-like protein 5 Proteins 0.000 description 1
- 101001023230 Homo sapiens Folate receptor alpha Proteins 0.000 description 1
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101001063456 Homo sapiens Leucine-rich repeat-containing G-protein coupled receptor 5 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101000932478 Homo sapiens Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101000955999 Homo sapiens V-set domain-containing T-cell activation inhibitor 1 Proteins 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 102100022341 Integrin alpha-E Human genes 0.000 description 1
- 108010008212 Integrin alpha4beta1 Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- 102100031036 Leucine-rich repeat-containing G-protein coupled receptor 5 Human genes 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 102000009151 Luteinizing Hormone Human genes 0.000 description 1
- 108010073521 Luteinizing Hormone Proteins 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102000009571 Macrophage Inflammatory Proteins Human genes 0.000 description 1
- 108010009474 Macrophage Inflammatory Proteins Proteins 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 240000001427 Mallotus nudiflorus Species 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930126263 Maytansine Natural products 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 101710151805 Mitochondrial intermediate peptidase 1 Proteins 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 102100030173 Muellerian-inhibiting factor Human genes 0.000 description 1
- 101710122877 Muellerian-inhibiting factor Proteins 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- 108090000028 Neprilysin Proteins 0.000 description 1
- 102000003729 Neprilysin Human genes 0.000 description 1
- 102000015336 Nerve Growth Factor Human genes 0.000 description 1
- 108010069196 Neural Cell Adhesion Molecules Proteins 0.000 description 1
- 102100023616 Neural cell adhesion molecule L1-like protein Human genes 0.000 description 1
- 108090000095 Neurotrophin-6 Proteins 0.000 description 1
- 241000187654 Nocardia Species 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 102100021768 Phosphoserine aminotransferase Human genes 0.000 description 1
- 241001499740 Plantago alpina Species 0.000 description 1
- 108010001014 Plasminogen Activators Proteins 0.000 description 1
- 102000001938 Plasminogen Activators Human genes 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 description 1
- 108010076181 Proinsulin Proteins 0.000 description 1
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 1
- 101800004937 Protein C Proteins 0.000 description 1
- 239000012614 Q-Sepharose Substances 0.000 description 1
- JQYMGXZJTCOARG-UHFFFAOYSA-N Reactive blue 2 Chemical compound C1=2C(=O)C3=CC=CC=C3C(=O)C=2C(N)=C(S(O)(=O)=O)C=C1NC(C=C1S(O)(=O)=O)=CC=C1NC(N=1)=NC(Cl)=NC=1NC1=CC=CC(S(O)(=O)=O)=C1 JQYMGXZJTCOARG-UHFFFAOYSA-N 0.000 description 1
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 1
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 1
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 description 1
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 1
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 1
- 102400000834 Relaxin A chain Human genes 0.000 description 1
- 101800000074 Relaxin A chain Proteins 0.000 description 1
- 102400000610 Relaxin B chain Human genes 0.000 description 1
- 101710109558 Relaxin B chain Proteins 0.000 description 1
- 108090000783 Renin Proteins 0.000 description 1
- 102100028255 Renin Human genes 0.000 description 1
- 102400000827 Saposin-D Human genes 0.000 description 1
- 101800001700 Saposin-D Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 108010029180 Sialic Acid Binding Ig-like Lectin 3 Proteins 0.000 description 1
- 102000001555 Sialic Acid Binding Ig-like Lectin 3 Human genes 0.000 description 1
- 102100022831 Somatoliberin Human genes 0.000 description 1
- 101710142969 Somatoliberin Proteins 0.000 description 1
- 108010017622 Somatomedin Receptors Proteins 0.000 description 1
- 102000004584 Somatomedin Receptors Human genes 0.000 description 1
- 102100038803 Somatotropin Human genes 0.000 description 1
- 231100000632 Spindle poison Toxicity 0.000 description 1
- 241000133426 Streptomyces zelensis Species 0.000 description 1
- 102000019197 Superoxide Dismutase Human genes 0.000 description 1
- 108010012715 Superoxide dismutase Proteins 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 102000011923 Thyrotropin Human genes 0.000 description 1
- 108010061174 Thyrotropin Proteins 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 102100033571 Tissue-type plasminogen activator Human genes 0.000 description 1
- 108010033576 Transferrin Receptors Proteins 0.000 description 1
- 102100026144 Transferrin receptor protein 1 Human genes 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 1
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 231100000230 acceptable toxicity Toxicity 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000000488 activin Substances 0.000 description 1
- 150000001263 acyl chlorides Chemical class 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 125000004423 acyloxy group Chemical group 0.000 description 1
- 125000005042 acyloxymethyl group Chemical group 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- 102000015395 alpha 1-Antitrypsin Human genes 0.000 description 1
- 108010050122 alpha 1-Antitrypsin Proteins 0.000 description 1
- 229940024142 alpha 1-antitrypsin Drugs 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229940094957 androgens and estrogen Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- 230000001455 anti-clotting effect Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000003972 antineoplastic antibiotic Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 238000010504 bond cleavage reaction Methods 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical group 0.000 description 1
- NSQLIUXCMFBZME-MPVJKSABSA-N carperitide Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 NSQLIUXCMFBZME-MPVJKSABSA-N 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000006298 dechlorination reaction Methods 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 125000005414 dithiopyridyl group Chemical group 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 238000011013 endotoxin removal Methods 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- 239000003687 estradiol congener Substances 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 229960004222 factor ix Drugs 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 229910052587 fluorapatite Inorganic materials 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 229940028334 follicle stimulating hormone Drugs 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 1
- 229960004666 glucagon Drugs 0.000 description 1
- 239000002622 gonadotropin Substances 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000002607 hemopoietic effect Effects 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 238000013415 human tumor xenograft model Methods 0.000 description 1
- 210000004754 hybrid cell Anatomy 0.000 description 1
- CBOIHMRHGLHBPB-UHFFFAOYSA-N hydroxymethyl Chemical compound O[CH2] CBOIHMRHGLHBPB-UHFFFAOYSA-N 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 229940051026 immunotoxin Drugs 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 230000002637 immunotoxin Effects 0.000 description 1
- 231100000608 immunotoxin Toxicity 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 239000000893 inhibin Substances 0.000 description 1
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 1
- 102000028416 insulin-like growth factor binding Human genes 0.000 description 1
- 108091022911 insulin-like growth factor binding Proteins 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000009830 intercalation Methods 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 239000003456 ion exchange resin Substances 0.000 description 1
- 229920003303 ion-exchange polymer Polymers 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 108010034897 lentil lectin Proteins 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 229940066294 lung surfactant Drugs 0.000 description 1
- 239000003580 lung surfactant Substances 0.000 description 1
- 208000037841 lung tumor Diseases 0.000 description 1
- 229940040129 luteinizing hormone Drugs 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 239000012516 mab select resin Substances 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- SVVGCFZPFZGWRG-OTKBOCOUSA-N maytansinoid dm4 Chemical compound CO[C@@H]([C@@]1(O)C[C@H](OC(=O)N1)C(C)(C)[C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(=O)CCC(C)(C)S)CC(=O)N1C)\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 SVVGCFZPFZGWRG-OTKBOCOUSA-N 0.000 description 1
- 210000002752 melanocyte Anatomy 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 238000005374 membrane filtration Methods 0.000 description 1
- 229960003151 mercaptamine Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 229940053128 nerve growth factor Drugs 0.000 description 1
- 229940032018 neurotrophin 3 Drugs 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 125000006501 nitrophenyl group Chemical group 0.000 description 1
- 150000007523 nucleic acids Chemical group 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000002138 osteoinductive effect Effects 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 125000000636 p-nitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1*)[N+]([O-])=O 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 229940127126 plasminogen activator Drugs 0.000 description 1
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 1
- 108010087851 prorelaxin Proteins 0.000 description 1
- 229960000856 protein c Drugs 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- ZCOSUVZGFDGWFV-UHFFFAOYSA-N pyrrolo[2,3-e]indole Chemical compound C1=CC2=NC=CC2=C2N=CC=C21 ZCOSUVZGFDGWFV-UHFFFAOYSA-N 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- MKNJJMHQBYVHRS-UHFFFAOYSA-M sodium;1-[11-(2,5-dioxopyrrol-1-yl)undecanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCCCCCCN1C(=O)C=CC1=O MKNJJMHQBYVHRS-UHFFFAOYSA-M 0.000 description 1
- ULARYIUTHAWJMU-UHFFFAOYSA-M sodium;1-[4-(2,5-dioxopyrrol-1-yl)butanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCN1C(=O)C=CC1=O ULARYIUTHAWJMU-UHFFFAOYSA-M 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000003270 steroid hormone Substances 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 125000000020 sulfo group Chemical group O=S(=O)([*])O[H] 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 229960003080 taurine Drugs 0.000 description 1
- RCINICONZNJXQF-XAZOAEDWSA-N taxol® Chemical compound O([C@@H]1[C@@]2(CC(C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3(C21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-XAZOAEDWSA-N 0.000 description 1
- 229940063683 taxotere Drugs 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- YONPGGFAJWQGJC-UHFFFAOYSA-K titanium(iii) chloride Chemical compound Cl[Ti](Cl)Cl YONPGGFAJWQGJC-UHFFFAOYSA-K 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 229930184737 tubulysin Natural products 0.000 description 1
- 238000013060 ultrafiltration and diafiltration Methods 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 229960005356 urokinase Drugs 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
- B01D15/08—Selective adsorption, e.g. chromatography
- B01D15/26—Selective adsorption, e.g. chromatography characterised by the separation mechanism
- B01D15/265—Adsorption chromatography
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6817—Toxins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6867—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of a blood cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
- B01D15/08—Selective adsorption, e.g. chromatography
- B01D15/26—Selective adsorption, e.g. chromatography characterised by the separation mechanism
- B01D15/32—Bonded phase chromatography
- B01D15/325—Reversed phase
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
- B01D15/08—Selective adsorption, e.g. chromatography
- B01D15/26—Selective adsorption, e.g. chromatography characterised by the separation mechanism
- B01D15/32—Bonded phase chromatography
- B01D15/325—Reversed phase
- B01D15/327—Reversed phase with hydrophobic interaction
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
- B01D15/08—Selective adsorption, e.g. chromatography
- B01D15/26—Selective adsorption, e.g. chromatography characterised by the separation mechanism
- B01D15/36—Selective adsorption, e.g. chromatography characterised by the separation mechanism involving ionic interaction, e.g. ion-exchange, ion-pair, ion-suppression or ion-exclusion
- B01D15/361—Ion-exchange
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
- B01D15/08—Selective adsorption, e.g. chromatography
- B01D15/26—Selective adsorption, e.g. chromatography characterised by the separation mechanism
- B01D15/38—Selective adsorption, e.g. chromatography characterised by the separation mechanism involving specific interaction not covered by one or more of groups B01D15/265 and B01D15/30 - B01D15/36, e.g. affinity, ligand exchange or chiral chromatography
- B01D15/3804—Affinity chromatography
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D71/00—Semi-permeable membranes for separation processes or apparatus characterised by the material; Manufacturing processes specially adapted therefor
- B01D71/06—Organic material
- B01D71/30—Polyalkenyl halides
- B01D71/32—Polyalkenyl halides containing fluorine atoms
- B01D71/34—Polyvinylidene fluoride
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/14—Extraction; Separation; Purification
- C07K1/16—Extraction; Separation; Purification by chromatography
- C07K1/18—Ion-exchange chromatography
Definitions
- nucleotide/amino acid sequence listing submitted concurrently herewith and identified as follows: One 8,259 Byte ASCII (Text) file named "714287SequenceListing.TXT,” created on October 3, 2013.
- Antibody-drug conjugates which are useful for the treatment of cancer and other diseases are commonly composed of three distinct elements: a cell-binding agent; a linker; and a cytotoxic agent.
- One of the commonly used manufacturing processes comprises a modification step, in which the cell-binding agent is reacted with a bifunctional linker to form a cell-binding agent covalently attached to a linker having a reactive group, a purification step in which the modified antibody is purified from the other components of the
- modification reaction a conjugation step, in which the modified cell-binding agent is reacted with a cytotoxic agent to form a covalent chemical bond from the linker (using the reactive group) to the cytotoxic agent, and a second purification step, in which the conjugate is purified from the other components of the conjugation reaction.
- conjugates produced by these processes comprise an increased amount of impurities, including free cytotoxic agent (e.g., cytotoxic agent dimer related species) and/or high molecular weight species (e.g., dimers and other higher order aggregates).
- free cytotoxic agent e.g., cytotoxic agent dimer related species
- high molecular weight species e.g., dimers and other higher order aggregates.
- Current purification methods employed in the art such as tangential flow filtration and adsorptive chromatography, do not efficiently remove these impurities without significantly decreasing the yield and/or are cumbersome for large scale manufacturing processes.
- the invention provides processes for preparing purified cell-binding agent cytotoxic agent conjugates comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a polyvinyl difluoride (PVDF) membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
- PVDF polyvinyl difluoride
- the present invention also includes a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent prepared according to the processes described herein.
- Figures 1 A-B are chromatograms depicting the species present in an antibody- SMCC-DM1 conjugate reaction mixture before ( Figure 1 A) and after ( Figure IB) PVDF filtration.
- Figure 2 is a line graph depicting the percent of DM1 dimer species (y-axis) present in an antibody-SMCC-DMl conjugate reaction mixture before and after filtration through multiple PVDF membranes (x-axis).
- conjugates comprising a cell- binding agent, such as an antibody, chemically coupled to a cytotoxic agent typically are prepared by modifying an antibody with a bifunctional crosslinking reagent at a low pH (i.e., pH 7.0 or below), purifying the antibody having linkers bound thereto, conjugating a cytotoxic agent to the antibody having linkers bound thereto, and purifying the antibody- cytotoxic agent conjugate.
- a bifunctional crosslinking reagent at a low pH (i.e., pH 7.0 or below)
- methods have been developed to produce conjugates of increased stability by maximizing the amount of linker stably bound to the cell-binding agent and minimizing undesirable side reactions that lead to conjugate instability.
- conjugates of increased stability it has been discovered that these processes result in conjugates having an increased levels of impurities, such as free cytotoxic agent (e.g., cytotoxic agent dimer related species) and/or high molecular weight species (e.g., dimers and other higher order aggregates).
- impurities such as free cytotoxic agent (e.g., cytotoxic agent dimer related species) and/or high molecular weight species (e.g., dimers and other higher order aggregates).
- Current purification methods employed in the art such as tangential flow filtration and adsorptive chromatography, do not efficiently remove these impurities without significantly decreasing the yield and/or are cumbersome for large scale manufacturing processes.
- PVDF polyvinyl difluoride
- a polyvinyl difluoride (PVDF) membrane can be used to remove at least a portion of the impurities from a mixture comprising a cell- binding agent cytotoxic agent conjugate.
- free cytotoxic agent e.g., cytotoxic agent dimer related species
- the invention provides processes for manufacturing cell-binding agent-cytotoxic agent conjugates of increased purity and stability comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane.
- the invention provides a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
- the PVDF membrane can be used to remove a variety of impurities commonly found in a mixture comprising a cell-binding agent cytotoxic agent conjugate.
- the PVDF membrane can be used to remove one or more impurities selected from the group of cytotoxic agent dimers, aggregates of the cell-binding agent cytotoxic agent conjugate, free cytotoxic agent, unconjugated linker, and mixtures thereof.
- the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises cytotoxic agent dimers as an impurity, and the PVDF membrane removes some portion of the cytotoxic agent dimers from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
- the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises aggregates of the cell- binding agent cytotoxic agent conjugate as an impurity, and the PVDF membrane removes some portion of the aggregates of the cell-binding agent cytotoxic agent from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
- the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises free cytotoxic agent as an impurity, and the PVDF membrane removes some portion of the free cytotoxic agent from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
- the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises unconjugated linker as an impurity, and the PVDF membrane removes some portion of the unconjugated linker from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
- the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises cytotoxic agent dimers chemically coupled to each other through a linker (e.g., DM1-MCC-DM1 , DM1-SPP-DM1, or DMl-CXl-l-DMl) as an impurity, and the PVDF membrane removes some portion of the cytotoxic agent dimers chemically coupled to each other through a linker (e.g., DM1-MCC-DM1, DM1-SPP-DM1, or DMl-CXl-1- DM1) from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
- a linker e.g., DM1-MCC-DM1 , DM1-SPP-DM1, or DMl-CXl-1- DM1
- the mixture comprising a cell-binding agent cytotoxic agent conjugate comprises cytotoxic agent dimers that are not chemically coupled to each other through a linker (e.g., DM1 -DM1) as an impurity, and the PVDF membrane removes some portion of the cytotoxic agent dimers that are not chemically coupled to each other through a linker (e.g., DM1 -DM1) from the mixture to provide the purified cell-binding agent cytotoxic agent conjugate.
- a linker e.g., DM1 -DM1
- the resulting purified cell-binding agent cytotoxic agent conjugate comprises a reduced level of at least one or more impurities as compared to the level of the one or more impurities in the mixture prior to subjecting the mixture to the PVDF membrane.
- the PVDF membrane removes at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100% of the one or more impurities in the mixture as compared to the level of the one or more impurities in the mixture prior to subjecting the mixture to the PVDF membrane.
- the PVDF membrane removes about 10% to about 100%, about 10% to about 90%, about 20% to about 100%, about 20% to about 90%, about 20% to about 80%, about 30% to about 100%, about 30% to about 90%, about 30% to about 80%, about 40% to about 80%, about 40% to about 90%, about 40% to about 100%, about 50% to about 80%, about 50% to about 90%, about 50% to about 100% (e.g., about 60% to about 90%, about 70% to about 90%), about 60% to about 100%, about 70% to about 100%, about 80% to about 100%, about 90% to about 100%, or about 95% to about 100% (e.g., about 96% to about 100%, about 97% to about 100%, about 98% to about 100%, about 99% to about 100%, about 95% to about 96%, about 95% to about 97%, about 95% to about 98%, or about 95% to about 99%) of the one or more impurities in the mixture as compared to the level of the one or more impurities in the mixture prior to subjecting the mixture to the PVDF membrane.
- the pH of the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities is adjusted prior to subjecting the mixture to a PVDF membrane.
- the pH of the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities preferably is about 4 to about 9 (e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6 to about 7, about 6.5 to about 7.5, about 7 to about 8, about 8 to about 9, about 4.5 to about 6, or about 4.5 to about 5).
- the pH of the mixture is about 6 to about 6.5 (e.g., a pH of 5.5 to 7, a pH of 5.7 to 6.8, a pH of 5.8 to 6.7, a pH of 5.9 to 6.6, or a pH of 6 to 6.5), a pH of about 6 or below (e.g., a pH of about 4 to 6, about 4 to about 5.5, about 4 to about 4.5, about 4 to about 5, about 5 to 6), or a pH of about 6.5 or greater (e.g., a pH of 6.5 to about 9, about 6.5 to about 7, about 7 to about 9, about 7.5 to about 9, or 6.5 to about 8).
- the pH of the mixture is greater than 7.5 (e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4, about 7.8 to about 8.2, about 8 to about 9, or about 8 to about 8.5).
- the pH of the mixture can be a pH of 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, or 9.
- the pH of the mixture is about 4.8 (e.g., about 4.5 to about 5, about 4.6 to about 5, or about 4.7 to about 4.9).
- PVDF membranes are known in the art and can be used in any combination.
- the PVDF membrane has a pore size of 0.22 microns. In another embodiment, the PVDF membrane has a pore size of 0.45 microns. In another embodiment, the PVDF membrane is a dual layer membrane having a pore size of 0.45 and 0.22 microns (i.e., a dual layer 0.45/0.22 micron pore size membrane pore size membrane).
- the PVDF membrane is gamma irradiated. In other embodiments, the PVDF membrane is not gamma irradiated.
- the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, wherein the modification reaction and the conjugation reaction are combined into a single step, followed by a purification step (i.e., the one-step process described in U.S. Patent Application
- the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane either before or after the purification step.
- the one-step process comprises contacting a cell-binding agent (e.g., an antibody) with a cytotoxic agent to form a first mixture comprising the cell-binding agent and the cytotoxic agent, and then contacting the first mixture comprising the cell-binding agent and the cytotoxic agent with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9 to provide a second mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities (e.g., free cytotoxic agent and reaction by-products), wherein the cell- binding agent is chemically coupled through the linker to the cytotoxic agent.
- a cell-binding agent e.g., an antibody
- the second mixture is then subjected to purification to provide a purified cell-binding agent cytotoxic agent conjugate.
- the second mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities is subjected to a PVDF membrane before the purification step, after the purification step, or both.
- the one-step reaction preferably is performed at a pH of about 4 to about pH 9 (e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6 to about 7, about 6 to about 8, about 6 to about 9, or about 6.5 to about 7.5).
- the reaction is performed at a pH of about 6 to about 8 (e.g., a pH of about 6, about 6.5, about 7, about 7.5, or about 8).
- the reaction is performed at a pH of about 7.1, about 7.2, about 7.3, about 7.4, about 7.5, about 7.6, about 7.7, about 7.8, about 7.9, about 8, about 8.1, about 8.2, about 8.3, about 8.4, about 8.5, about 8.6, about 8.7, about 8.8, about 8.9, or about 9.
- the reaction is performed at a pH of about 7.5 to about 9, about 7.5 to about 8.5, about 7.5 to about 8, about 7.8 to about 9, about 7.8 to about 8.5, about 7.8 to about 8, about 8 to about 9, about 8 to about 8.5, or about 8.5 to about 9.
- reaction is performed at a pH of about 7.8 (e.g., a pH of 7.6 to 8.0 or a pH of 7.7 to 7.9).
- modification reaction is performed at a pH of about 8 (e.g., a pH of 7.8 to 8.2 or a pH of 7.9 to 8.1).
- the reaction is performed at a pH that is greater than 7.5 (e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4, about 7.8 to about 8.2, about 8 to about 9, or about 8 to about 8.5).
- 7.5 e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4, about 7.8 to about 8.2, about 8 to about 9, or about 8 to about 8.5.
- the contacting is effected by providing the cell-binding agent, then contacting the cell-binding agent with the cytotoxic agent to form a first mixture comprising the cell-binding agent and the cytotoxic agent, and then contacting the first mixture comprising the cell-binding agent and the cytotoxic agent with the bifunctional crosslinking reagent.
- the cell-binding agent is provided in a reaction vessel, the cytotoxic agent is added to the reaction vessel (thereby contacting the cell-binding agent), and then the bifunctional crosslinking reagent is added to the mixture comprising the cell-binding agent and the cytotoxic agent (thereby contacting the mixture comprising the cell-binding agent and the cytotoxic agent).
- the cell- binding agent is provided in a reaction vessel, and the cytotoxic agent is added to the reaction vessel immediately following providing the cell-binding agent to the vessel.
- the cell-binding agent is provided in a reaction vessel, and the cytotoxic agent is added to the reaction vessel after a time interval following providing the cell-binding agent to the vessel (e.g., about 5 minutes, about 10 minutes, about 20 minutes, about 30 minutes, about 40 minutes, about 50 minutes, about 1 hour, about 1 day or longer after providing the cell-binding agent to the space).
- the cytotoxic agent can be added quickly (i.e., within a short time interval, such as about 5 minutes, about 10 minutes) or slowly (such as by using a pump).
- the mixture comprising the cell-binding agent and the cytotoxic agent can be then contacted with the bifunctional crosslinking reagent either immediately after contacting the cell-binding agent with the cytotoxic agent or at some later point (e.g., about 5 minutes to about 8 hours or longer) after contacting the cell-binding agent with the cytotoxic agent.
- the bifunctional crosslinking reagent is added to the mixture comprising the cell-binding agent and the cytotoxic agent immediately after the addition of the cytotoxic agent to the reaction vessel comprising the cell-binding agent.
- the mixture comprising the cell-binding agent and the cytotoxic agent can be contacted with the bifunctional crosslinking reagent at about 5 minutes, about 10 minutes, about 20 minutes, about 30 minutes, about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, or longer after contacting the cell-binding agent with the cytotoxic agent.
- the cytotoxic agent and the bifunctional agent are added through multiple cycles (e.g., 1, 2, 3, 4, 5 or more cycles).
- the invention provides a process comprising the steps of: a) contacting a cell-binding agent with a cytotoxic agent to form a first mixture comprising the cell-binding agent and the cytotoxic agent; and then contacting the first mixture with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9 to provide a second mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities (e.g., free cytotoxic agent and reaction by-products), wherein the cell-binding agent is chemically coupled through the linker to the cytotoxic agent; b) contacting the second mixture with the cytotoxic agent to form a third mixture; and then contacting the third mixture with the bifunctional crosslinking reagent at a pH of about 4 to about 9 to provide a fourth mixture;
- step b) is carried out after a time interval (e.g., about 1 hour, about 2 hours, about 3 hours or longer) following step a).
- step b) can be repeated several times (e.g., 1, 2, 3, 4 or more times) before step c) is carried out.
- the additional step b) can be carried out after a time interval (e.g., about 1 hour, about 2 hours, about 3 hours or longer) following the initial step b).
- the bifunctional crosslinking reagent is added before the complete addition of the cytotoxic agent.
- the cytotoxic agent is added to the cell-binding agent continuously over a time interval (e.g., over about 5 minutes, about 10 minutes, about 30 minutes, about 1 hour, about 2 hours, about 3 hours, or longer) to form a mixture comprising the cell-binding agent and the cytotoxic agent.
- the bifunctional crosslinking reagent is added to the mixture comprising the cell-binding agent and the cytotoxic agent, provided that at any time, the cytotoxic agent is in molar excess of the bifunctional crosslinking reagent.
- the bifunctional crosslinking reagent is added continuously over a time interval (e.g., over about 5 minutes, about 10 minutes, about 30 minutes, about 1 hour, about 2 hours, about 3 hours, or longer).
- the reaction is allowed to proceed for about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, or longer (e.g., about 30 hours, about 35 hours, about 40 hours, about 45 hours, or about 48 hrs).
- the invention provides a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising contacting a cell-binding agent with a cytotoxic agent to form a first mixture comprising the cell-binding agent and the cytotoxic agent, then contacting the first mixture with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9, to provide a second mixture comprising the cell-binding agent cytotoxic agent conjugate comprising the cell- binding agent chemically coupled through the linker to the cytotoxic agent and one or more impurities; (b) subjecting the second mixture to a polyvinyl difluoride (PVDF) membrane to remove at least a portion of the impurities, thereby providing a purified second mixture of the cell-binding agent cytotoxic agent conjugate; and (c) subjecting the purified second mixture after step (b) to tangential flow filtration, selective precipitation, non-adsorp
- PVDF polyvinyl di
- chromatography adsorptive filtration, adsorptive chromatography, or a combination thereof, to further purify the cell-binding agent-cytotoxic agent conjugate from the impurities and thereby prepare a purified third mixture of the cell-binding agent-cytotoxic agent conjugate, wherein the purified third mixture comprises a reduced amount of the impurities as compared to the purified second mixture.
- Any purification method described herein can be used in the inventive process.
- tangential flow filtration, adsorptive chromatography, or non-adsorptive chromatography is utilized as the purification step.
- contacting a cell-binding agent with a bifunctional crosslinking reagent produces a first mixture comprising the cell-binding agent having linkers bound thereto and one or more impurities (e.g., reactants and other by-products).
- the first mixture comprises the cell-binding agent having linkers stably and unstably bound thereto and one or more impurities (e.g., reactants and other by-products).
- a linker is "stably" bound to the cell-binding agent when the covalent bond between the linker and the cell-binding agent is not substantially weakened or severed under normal storage conditions over a period of time, which could range from a few months to a few years.
- a linker is
- the modification reaction preferably is performed at a pH of about 4 to about pH 9 (e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6 to about 7, about 6 to about 8, about 6 to about 9, or about 6.5 to about 7.5).
- the modification reaction is performed at a pH of about 6 to about 8 (e.g., a pH of about 6, about 6.5, about 7, about 7.5, or about 8).
- the modification reaction is performed at a pH of about 7.1, about 7.2, about 7.3, about 7.4, about 7.5, about 7.6, about 7.7, about 7.8, about 7.9, about 8, about 8.1, about 8.2, about 8.3, about 8.4, about 8.5, about 8.6, about 8.7, about 8.8, about 8.9, or about 9.
- the modification reaction is performed at a pH of about 7.5 to about 9, about 7.5 to about 8.5, about 7.5 to about 8, about 7.8 to about 9, about 7.8 to about 8.5, about 7.8 to about 8, about 8 to about 9, about 8 to about 8.5, or about 8.5 to about 9.
- the modification reaction is performed at a pH of about 7.8 (e.g., a pH of 7.6 to 8.0 or a pH of 7.7 to 7.9). In another embodiment, the modification reaction is performed at a pH of about 8 (e.g., a pH of 7.8 to 8.2 or a pH of 7.9 to 8.1). [0032] In another embodiment, the modification reaction is performed at a pH that is greater than 7.5 (e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4, about 7.8 to about 8.2, about 8 to about 9, or about 8 to about 8.5).
- 7.5 e.g., a pH of 7.6 to about 9, 7.7 to about 9, about 7.8 to about 9, about 7.9 to about 9, 7.6 to about 8.5, 7.6 to about 8, 7.7 to about 8.5, 7.7 to about 8, about 7.8 to about 8.4,
- the inventive process comprises contacting a cell-binding agent with a bifunctional crosslinking reagent in a solution having a pH of 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, or 9.
- purification of the modified cell-binding agent from impurities produced during the modification reaction is carried out by subjecting the mixture produced by the modification reaction (i.e., the first mixture) to a purification process.
- the first mixture can be purified using tangential flow filtration (TFF), e.g., a membrane -based tangential flow filtration process, non-adsorptive chromatography, adsorptive chromatography, adsorptive filtration, or selective precipitation, or any other suitable purification process, as well as combinations thereof.
- TMF tangential flow filtration
- This first purification step provides a purified first mixture, i.e., an increased concentration of the cell-binding agents having linkers bound thereto and a decreased amount of unbound bifunctional crosslinking reagent, as compared to the first mixture prior to purification in accordance with the invention.
- the first mixture is purified using tangential flow filtration or adsorptive chromatography (e.g., ion exchange chromatography, such as ceramic hydroxyapatite).
- a cytotoxic agent is conjugated to the cell- binding agents having linkers bound thereto in the first purified mixture by reacting the cell- binding agents having linkers bound thereto with a cytotoxic agent in a solution having a pH from about 4 to about 9 to form a second mixture, wherein a second mixture comprising the cell-binding agent chemically coupled through the linker to the cytotoxic agent and one or more impurities (e.g., free cytotoxic agent and reaction by-products) is produced.
- impurities e.g., free cytotoxic agent and reaction by-products
- purification of the modified cell-binding agent may be omitted.
- the first mixture comprising the cell-binding agent having linkers bound thereto, as well as reactants and other by-products, is not subjected to a purification process.
- the cytotoxic agent may be added simultaneously with the crosslinking reagent or at some later point, e.g., 1, 2, 3, or more hours after addition of the crosslinking reagent to the cell-binding agent.
- the modified cell-binding agent is conjugated to a cytotoxic agent (e.g., a maytansinoid) by reacting the modified cell-binding agent with the cytotoxic agent in a solution having a pH from about 4 to about 9, wherein the conjugation step results in formation of a mixture of stable cell-binding agent-cytotoxic agent conjugates, non-stable cell-binding agent-cytotoxic agent conjugates, non-conjugated cytotoxic agent (i.e., "free" cytotoxic agent), reactants, and by-products.
- a cytotoxic agent e.g., a maytansinoid
- the conjugation reaction preferably is performed at a pH of about 4 to about pH 9 (e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6.0 to about 7, or about 6.5 to about 7.5).
- a pH of about 4 to about pH 9 e.g., a pH of about 4.5 to about 8.5, about 5 to about 8, about 5.5 to about 7.5, about 6.0 to about 7, or about 6.5 to about 7.5.
- the conjugation reaction is performed at a pH of about 6 to about 6.5 (e.g., a pH of 5.5 to 7, a pH of 5.7 to 6.8, a pH of 5.8 to 6.7, a pH of 5.9 to 6.6, or a pH of 6 to 6.5), a pH of about 6 or below (e.g., a pH of about 4 to 6, about 4 to about 5.5, about 5 to 6) or at a pH of about 6.5 or greater (e.g., a pH of 6.5 to about 9, about 6.5 to about 7, about 7 to about 9, about 7.5 to about 9, or 6.5 to about 8).
- a pH of about 6 to about 6.5 e.g., a pH of 5.5 to 7, a pH of 5.7 to 6.8, a pH of 5.8 to 6.7, a pH of 5.9 to 6.6, or a pH of 6 to 6.5
- a pH of about 6 or below e.g., a pH of about 4 to 6, about 4 to about 5.5, about 5 to 6
- the conjugation reaction is performed at a pH of about 4 to a pH less than 6 or at a pH of greater than 6.5 to 9.
- the conjugation step is performed at a pH of about 6.5 or greater, some sulfhydryl-containing cytotoxic agents may be prone to dimerize by disulfide-bond formation.
- removal of trace metals and/or oxygen from the reaction mixture, as well as optional addition of antioxidants or the use of linkers with more reactive leaving groups, or addition of cytotoxic agent in more than one aliquot may be required to allow for efficient reaction in such a situation.
- the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities is subjected to a purification step.
- the conjugation mixture can be purified using tangential flow filtration (TFF), e.g., a membrane-based tangential flow filtration process, non-adsorptive chromatography, adsorptive chromatography, adsorptive filtration, or selective precipitation, or any other suitable purification process, as well as combinations thereof.
- TMF tangential flow filtration
- purification after the conjugation step enables the isolation of a purified conjugate comprising the cell-binding agent chemically coupled to the cytotoxic agent, wherein the conjugate has a reduced amount of impurities as compared to the conjugate prior to the purification step.
- the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities is subjected to a PVDF membrane after the conjugation step and prior to the purification step in order to remove at least a portion of the impurities from the mixture prior to purification.
- the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities is subjected to a PVDF membrane after the purification step in order to remove at least a portion of the impurities remaining in the mixture after purification.
- the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, which process comprises a first purification step after the modification step and a second purification step after the conjugation step, wherein the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane either before or after the second purification step to remove at least a portion of the impurities from the mixture.
- the invention provides a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising contacting a cell-binding agent with a bifunctional crosslinking reagent to covalently attach a linker to the cell-binding agent and thereby prepare a first mixture comprising cell-binding agents having linkers bound thereto, (b) subjecting the first mixture to tangential flow filtration, selective precipitation, non-adsorptive chromatography, adsorptive filtration, adsorptive chromatography, or a combination thereof and thereby prepare a purified first mixture of cell-binding agents having linkers bound thereto, (c) conjugating a cytotoxic agent to the cell-binding agents having linkers bound thereto in the purified first mixture by reacting the cell-binding agents having linkers bound thereto with a cytotoxic agent in a solution having a pH of about 4 to about 9 to prepare a second mixture comprising the cell-binding agent-cytotoxic agent conjugate comprising the cell-bind
- any purification method described herein can be used in the inventive process.
- tangential flow filtration (TFF, also known as cross flow filtration, ultrafiltration and diafiltration) and/or adsorptive chromatography resins are utilized in the purification steps.
- the inventive process can comprise a first purification step using TFF after the modification step and a second purification step using TFF after the conjugation step.
- the inventive process can comprise a first purification step using adsorptive chromatography after the modification step and a second purification step using adsorptive chromatography after the conjugation step.
- the inventive process also can comprise a first purification step using adsorptive chromatography after the modification step and a second purification step using TFF after the conjugation step or a first purification step using TFF after the modification step and a second purification step using adsorptive chromatography after the conjugation step.
- non-adsorptive chromatography is utilized as the purification step.
- the inventive process can comprise a first purification step using non-adsorptive chromatography after the modification step and a second purification step using non-adsorptive chromatography after the conjugation step.
- the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, wherein the first mixture comprising cell-binding agents having linkers bound thereto is not subjected to purification following the modification reaction and prior to the conjugation reaction, and wherein the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane.
- the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, which process comprises a modification step, a conjugation step, and a first purification step after the conjugation step, wherein the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane either before or after the first purification step to remove at least a portion of the impurities from the mixture.
- the invention provides process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising contacting a cell-binding agent with a bifunctional crosslinking reagent to covalently attach a linker to the cell-binding agent and thereby prepare a first mixture comprising cell-binding agents having linkers bound thereto, (b) conjugating a cytotoxic agent to the cell-binding agents having linkers bound thereto in the first mixture by reacting the cell-binding agents having linkers bound thereto with a cytotoxic agent to prepare a second mixture comprising the cell-binding agent-cytotoxic agent conjugate comprising the cell-binding agent chemically coupled through the linker to the cytotoxic agent and one or more impurities, (c) subjecting the second mixture to a polyvinyl difluoride (PVDF) membrane to remove at least a portion of the impurities, thereby providing a purified second mixture of the cell-binding agent cytotoxic agent conjugate; and (d) subjecting the purified
- any purification method described herein can be used as the purification step following the conjugation reaction.
- tangential flow filtration, adsorptive chromatography, or non-adsorptive chromatography is utilized as the purification step following the conjugation reaction.
- the invention provides a process for preparing a conjugate comprising a cell-binding agent chemically coupled to a cytotoxic agent, wherein the process comprises conjugating a pre-formed cytotoxic-agent-linker compound to a cell-binding agent, as described in U.S. Patent 6,441,163 and U.S. Patent Application Publication Nos.
- a purification step followed by a purification step, and wherein the process comprises subjecting the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane either before or after the purification step.
- Any purification method described herein can be used in the inventive process.
- tangential flow filtration, adsorptive chromatography, or non-adsorptive chromatography is utilized as the purification step.
- the cytotoxic agent-linker compound is prepared by contacting a cytotoxic agent with a bifunctional crosslinking reagent comprising a linker to covalently attach the cytotoxic agent to the linker.
- the cytotoxic agent-linker compound optionally is subjected to purification before contacting cytotoxic agent-linker compound with the cell-binding agent.
- the inventive process described herein comprises two separate purification steps following the conjugation step.
- the mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities can be subjected to a PVDF membrane before either or both of the purification steps, or following the purification steps to remove at least a portion of the impurities from the mixture.
- Any purification method described herein can be used as the purification steps following the conjugation reaction. In a preferred embodiment, tangential flow filtration, adsorptive chromatography, non-adsorptive chromatography, or a
- TFF systems Any suitable TFF systems may be utilized for purification, including a Pellicon type system (Millipore, Billerica, MA), a Sartocon Cassette system (Sartorius AG,
- Any suitable adsorptive chromatography resin may be utilized for purification.
- Preferred adsorptive chromatography resins include hydroxyapatite chromatography, hydrophobic charge induction chromatography (HCIC), hydrophobic interaction
- hydroxyapatite resins include ceramic hydroxyapatite (CHT Type I and Type II, Bio-Rad Laboratories, Hercules, CA), HA Ultrogel hydroxyapatite (Pall Corp., East Hills, NY), and ceramic fluoroapatite (CFT Type I and Type II, Bio-Rad
- HCIC resin An example of a suitable HCIC resin is MEP Hypercel resin (Pall Corp., East Hills, NY).
- suitable HIC resins include Butyl-Sepharose, Hexyl-Sepaharose, Phenyl-Sepharose, and Octyl Sepharose resins (all from GE Healthcare, Piscataway, NJ), as well as Macro-prep Methyl and Macro-Prep t-Butyl resins (Biorad Laboratories, Hercules, CA).
- Suitable ion exchange resins include SP- Sepharose, CM-Sepharose, and Q-Sepharose resins (all from GE Healthcare, Piscataway, NJ), and Unosphere S resin (Bio-Rad Laboratories, Hercules, CA).
- suitable mixed mode ion exchangers include Bakerbond ABx resin (JT Baker, Phillipsburg NJ).
- IMAC resins examples include Chelating Sepharose resin (GE Healthcare, Piscataway, NJ) and Profinity IMAC resin (Bio-Rad Laboratories, Hercules, CA).
- suitable dye ligand resins include Blue Sepharose resin (GE Healthcare, Piscataway, NJ) and Affi-gel Blue resin (Bio-Rad Laboratories, Hercules, CA).
- suitable affinity resins include Protein A Sepharose resin (e.g., MabSelect, GE Healthcare, Piscataway, NJ), where the cell-binding agent is an antibody, and lectin affinity resins, e.g.
- Lentil Lectin Sepharose resin (GE Healthcare, Piscataway, NJ), where the cell-binding agent bears appropriate lectin binding sites.
- an antibody specific to the cell-binding agent may be used.
- Such an antibody can be immobilized to, for instance, Sepharose 4 Fast Flow resin (GE Healthcare, Piscataway, NJ).
- suitable reversed phase resins include C4, C8, and C18 resins (Grace Vydac, Hesperia, CA).
- Any suitable non-adsorptive chromatography resin may be utilized for any suitable non-adsorptive chromatography resin.
- non-adsorptive chromatography resins include, but are not limited to, SEPHADEXTM G-25, G-50, G-100, SEPHACRYLTM resins (e.g., S-200 and S- 300), SUPERDEXTM resins (e.g., SUPERDEXTM 75 and SUPERDEXTM 200), BIO-GEL® resins (e.g., P-6, P-10, P-30, P-60, and P-100), and others known to those of ordinary skill in the art.
- the process described herein further comprises subjecting the mixture to an ion exchange chromatography membrane to remove at least a portion of the impurities from the mixture.
- the ion exchange chromatography membrane can be an anion exchange membrane, such as a Q membrane, or a cation exchange membrane, such as an S membrane.
- the ion exchange chromatography membrane is an endotoxin removal exchange membrane.
- the ion exchange chromatography membrane is an anion exchange membrane (e.g., a Q membrane).
- An anion exchange membrane is a positively charged microporous membrane.
- the positively charged anion exchange moiety is quaternary ammonium group.
- the positively charged microporous membrane comprises a porous substrate and a crosslinked coating having pendant cationic groups (see for example, those described in US Patent Nos. 6,780,327, 6,851,561, 7,094,347, 7,223,341, 7,396,465).
- the porous substrate is hydrophilic (e.g., polyethersulfone or cross-linked cellulose matrix).
- the cationic group is quaternary ammonium group.
- the anion exchange membrane is a positively charged microporous membrane comprising a porous polyethersulfone substrate and a crosslinked coating having pendant quaternary ammonium groups.
- the mixture is subjected to a PVDF membrane prior to subjecting the mixture to an ion exchange chromatography membrane (e.g., a Q membrane or an S membrane).
- an ion exchange chromatography membrane e.g., a Q membrane or an S membrane.
- the mixture is subjected to an ion exchange chromatography membrane prior to subjecting the mixture to a PVDF membrane.
- the mixture is subject to an ion exchange chromatography membrane before and after subjecting the mixture to a PVDF membrane.
- the mixture is subjected to a PVDF membrane before and after subjection the mixture to an ion exchange chromatography membrane.
- the inventive process comprises performing the reactions described herein (e.g., the modification reaction, the conjugation reaction, or the one-step reaction) at any suitable temperature known in the art.
- the reaction can occur at about 20 °C or less (e.g., about -10° C (provided that the solution is prevented from freezing, e.g., by the presence of organic solvent used to dissolve the cytotoxic agent and the bifunctional crosslinking reagent) to about 20 °C, about 0 °C to about 18 °C, about 4 °C to about 16 °C), at room temperature (e.g., about 20 °C to about 30 °C or about 20 °C to about 25 °C), or at an elevated temperature (e.g., about 30 °C to about 37 °C).
- room temperature e.g., about 20 °C to about 30 °C or about 20 °C to about 25 °C
- an elevated temperature e.g., about 30 °C to about 37 °C.
- the reaction occurs at a temperature of about 16 °C to about 24 °C (e.g., about 16 °C, about 17 °C, about 18 °C, about 19 °C, about 20 °C, about 21 °C, about 22 °C, about 23 °C, about 24 °C, or about 25 °C).
- the inventive process described herein further comprises a quenching step to quench any unreacted cytotoxic agent and/or unreacted bifunctional crosslinking reagent.
- the quenching step is performed prior to purification of the cell- binding agent cytotoxic agent.
- the quenching step is performed after purification of the cell-biding agent cytotoxic agent.
- the inventive process comprises (a) contacting a cell-binding agent with a cytotoxic agent to form a mixture comprising the cell-binding agent and the cytotoxic agent and then contacting the mixture comprising the cell-binding agent and the cytotoxic agent with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9 to provide a mixture comprising the cell-binding agent cytotoxic agent conjugate, wherein the cell-binding agent is chemically coupled through the linker to the cytotoxic agent, and impurities (e.g., free cytotoxic agent and reaction by-products), (b) subjecting the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane, (c) quenching the mixture after step (b) to quench any unreacted cytotoxic agent and/or unreacted bifunctional crosslinking reagent, (d) subjecting the quenched mixture to a PVDF membrane, (a)
- the inventive process comprises (a) contacting a cell-binding agent with a cytotoxic agent to form a mixture comprising the cell-binding agent and the cytotoxic agent and then contacting the mixture comprising the cell-binding agent and the cytotoxic agent with a bifunctional crosslinking reagent comprising a linker, in a solution having a pH of about 4 to about 9 to provide a mixture comprising the cell-binding agent cytotoxic agent conjugate, wherein the cell- binding agent is chemically coupled through the linker to the cytotoxic agent, and impurities (e.g., free cytotoxic agent and reaction by-products), (b) subjecting the mixture comprising the cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane, (c) optionally quenching the mixture after step (b) to quench any unreacted cytotoxic agent and/or unreacted bifunctional crosslinking reagent, (d) optionally subjecting the quenched mixture to a PVDF
- the mixture is quenched by contacting the mixture with a quenching reagent.
- quenching reagent refers to a reagent that reacts with the free cytotoxic agent and/or the bifunctional crosslinking reagent.
- maleimide or haloacetamide quenching reagents such as 4- maleimidobutyric acid, 3-maleimidopropionic acid, N-ethylmaleimide, iodoacetamide, or iodoacetamidopropionic acid, can be used to ensure that any unreacted group (such as thiol) in the cytotoxic agent is quenched.
- the quenching step can help prevent the dimerization of the cytotoxic agent, particular the cytotoxic agent having an unreacted thiol group (such as DM1).
- the dimerized cytotoxic agent can be difficult to remove.
- the quenching step may also minimize any unwanted thiol-disulfide interchange reaction with the native antibody disulfide groups.
- polar, charged thiol-quenching reagents such as 4- maleimidobutyric acid or 3-maleimidopropionic acid
- the excess, unreacted cytotoxic agent is converted into a polar, charged, water-soluble adduct that can be easily separated from the covalently- linked conjugate during the purification step.
- Quenching with non-polar and neutral thiol-quenching reagents can also be used.
- the mixture is quenched by contacting the mixture with a quenching reagent that reacts with the unreacted bifunctional crosslinking reagent.
- a quenching reagent that reacts with the unreacted bifunctional crosslinking reagent.
- nucleophiles can be added to the mixture in order to quench any unreacted bifunctional crosslinking reagent.
- the nucleophile preferably is an amino group containing nucleophile, such as lysine, taurine and hydroxylamine.
- the mixture is quenched by lowering the pH of the mixture to about 5.0 (e.g., 4.8, 4.9, 5.0, 5.1 or 5.2).
- the mixture is quenched by lowering the pH to less than 6.0, less than 5.5, less than 5.0, less than 4.8, less than 4.6, less than 4.4, less than 4.2, less than 4.0.
- the pH is lowered to about 4.0 (e.g., 3.8, 3.9, 4.0, 4.1 or 4.2) to about 6.0 (e.g., 5.8, 5.9, 6.0, 6.1 or 6.2), about 4.0 to about 5.0, about 4.5 (e.g., 4.3, 4.4, 4.5, 4.6 or 4.7) to about 5.0.
- the mixture is quenched by lowering the pH of the mixture to 4.8.
- the reaction e.g., the modification step, the conjugation step, or the one-step reaction
- the quenching reagent is added to the mixture about 1 hour to about 48 hours (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, or about 25 hours to about 48 hours) after the mixture comprising the cell-binding agent and the cytotoxic agent is contacted with the bifunctional crosslinking reagent.
- the inventive process may optionally include the addition of sucrose to the reaction step (e.g., the modification step, the conjugation step, or the one-step reaction) to increase solubility and recovery of the cell-binding agent-cytotoxic agent conjugates.
- the reaction step e.g., the modification step, the conjugation step, or the one-step reaction
- sucrose is added at a concentration of about 0.1% (w/v) to about 20%> (w/v) (e.g., about 0.1% (w/v), 1% (w/v), 5% (w/v), 10% (w/v), 15% (w/v), or 20% (w/v)).
- sucrose is added at a concentration of about 1% (w/v) to about 10%> (w/v) (e.g., about 0.5%> (w/v), about 1% (w/v), about 1.5% (w/v), about 2% (w/v), about 3% (w/v), about 4% (w/v), about 5%> (w/v), about 6%> (w/v), about 7% (w/v), about 8% (w/v), about 9% (w/v), about 10%) (w/v), or about 11% (w/v)).
- the reaction step also can comprise the addition of a buffering agent. Any suitable buffering agent known in the art can be used.
- Suitable buffering agents include, for example, a citrate buffer, an acetate buffer, a succinate buffer, and a phosphate buffer.
- the buffering agent is selected from the group consisting of HEPPSO (N-(2-hydroxyethyl)piperazine-N'-(2-hydroxypropanesulfonic acid)), POPSO (piperazine-l,4-bis-(2-hydroxy-propane-sulfonic acid) dehydrate), HEPES (4-(2- hydroxyethyl)piperazine-l-ethanesulfonic acid), HEPPS (EPPS) (4-(2- hydroxyethyl)piperazine-l-propanesulfonic acid), TES (N-[tris(hydroxymethyl)methyl]-2- aminoethanesulfonic acid), and combinations thereof.
- HEPPSO N-(2-hydroxyethyl)piperazine-N'-(2-hydroxypropanesulfonic acid)
- POPSO piperazine-l,4-bis
- the inventive process further comprises one or more (e.g., one, two, or three) holding steps to release the unstably bound linkers from the cell-binding agent.
- the holding step comprises holding the mixture after modification of the cell-binding agent with a bifunctional crosslinking reagent, after conjugation of a cytotoxic agent to the cell-binding agents having linkers bound thereto, and/or after a purification step.
- the holding step comprises holding the mixture after conjugation of a cytotoxic agent to the cell- binding agents having linkers bound thereto and/or after a purification step following the conjugation step, the mixture can be subjected to a PVDF membrane before or after the holding step, or both.
- the process comprises subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a holding step after the conjugation step, wherein the mixture is subjected to a PVDF membrane after the holding step and prior to the purification step.
- the process comprises subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a holding step after the conjugation step, wherein the mixture is subjected to a purification step after the holding step, followed by subjecting the mixture to a PVDF membrane.
- the mixture optionally may be subjected to a second holding step prior to subjecting the mixture to the PVDF membrane.
- the holding step comprises maintaining the solution at a suitable temperature (e.g., about 2° C to about 37° C) for a suitable period of time (e.g., about 1 hour to about 1 week) to release the unstably bound linkers from the cell-binding agent while not
- a suitable temperature e.g., about 2° C to about 37° C
- a suitable period of time e.g., about 1 hour to about 1 week
- the holding step comprises maintaining the solution at a low temperature (e.g., about 2° C to about 10° C or about 4° C), at room temperature (e.g., about 20° C to about 30° C or about 20° C to about 25° C), or at an elevated temperature (e.g., about 30° C to about 37° C).
- a low temperature e.g., about 2° C to about 10° C or about 4° C
- room temperature e.g., about 20° C to about 30° C or about 20° C to about 25° C
- an elevated temperature e.g., about 30° C to about 37° C.
- the duration of the holding step depends on the temperature at which the holding step is performed.
- the duration of the holding step can be substantially reduced by performing the holding step at elevated temperature, with the maximum temperature limited by the stability of the cell-binding agent-cytotoxic agent conjugate.
- the holding step can comprise maintaining the solution for about 1 hour to about 1 day (e.g., about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 14 hours, about 16 hours, about 18 hours, about 20 hours, about 22 hours, or about 24 hours), about 5 hours to about 1 week, about 12 hours to about 1 week (e.g., about 12 hours, about 16 hours, about 20 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, or about 7 days), for about 12 hours to about 1 week (e.g., about 12 hours, about 16 hours, about 20 hours, about 24 hours, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, or about 7 days), or about 1 day to about 1 week.
- about 12 hours to about 1 week e.g., about 12 hours, about 16 hours, about 20 hours, about 24 hours, about 2 days, about 3
- the holding step comprises maintaining the solution at a temperature of about 2 °C to about 8 °C for a period of at least about 12 hours for up to 1 day.
- the pH value for the holding step preferably is about 4 to about 9 (e.g., about 4.5 to about 8.5 or about 5 to about 8).
- the pH values for the holding step range from about 5 to about 7.5 (e.g., about 5.5 to about 7.5, about 6 to about 7.5, about 6.5 to about 7.5, about 7 to about 7.5, about 5 to about 7, about 5 to about 6.5, about 5 to about 5.5, about 5.5 to about 7, about 6 to about 6.5, or about 6 to about 7).
- pH values for the holding step can be about 4, about 4.5, about 5, about 5.5, about 6, about 6.5, about 7, about 7.5, about 8, about 8.5, or about 9.
- the holding step can be performed before or after the cell-binding agent is conjugated to the cytotoxic agent.
- the holding step is performed directly after the modification of the cell-binding agent with the bifunctional crosslinking reagent.
- the inventive process comprises a holding step after modification of the cell-binding agent with a bifunctional crosslinking reagent and before conjugation.
- a purification step may be performed before the hold step and/or after the hold step, but prior to the conjugation step.
- the holding step is performed directly after conjugation of the cytotoxic agent to the cell-binding agent having linkers bound thereto and prior to purification step.
- the holding step is performed after the conjugation and purification steps and followed by an additional purification step.
- the holding step can comprise incubating the mixture at a pH of about 5-7.5 or about 6.5-7.5 for about 1 hour to about 1 week at about 2 °C to about room temperature.
- the invention provides a process for preparing a cell-binding agent-cytotoxic agent conjugate, which process comprises the addition of exogenous NHS.
- Exogenous NHS refers to NHS that is added during the process from an external source, and does not refer to NHS that is generated during the modification reaction as a result of hydro lysis/amino lysis of the bifunctional linker.
- the invention provides a process for preparing a cell-binding agent-cytotoxic agent conjugate, which process comprises the addition of about 0.1 mM to about 300 mM exogenous NHS.
- the inventive process comprises the addition of about 0.1 mM, about 0.2 mM, about 0.3 mM, about 0.4 mM, about 0.5 mM, about 0.6 mM, about 0.7 mM, about 0.8 mM, about 0.9 mM, about 1.0 mM, about 1.1 mM, about 1.3 mM, about 1.5 mM, about 1.7 mM, about 1.9 mM, about 2.0 mM, about 2.1 mM, about 2.3 mM, about 2.5 mM, about 2.7 mM, about 2.9 mM, about 3.0 mM, about 3.1 mM, about 3.3 mM, about 3.5 mM, about 3.7 mM, about 3.9 mM, about 4.0 m
- the inventive process comprises the addition of about 0.1 mM to about 5 mM, about 0.1 mM to about 10 mM, about 1.0 mM to about 5 mM, about 1.0 mM to about 10 mM, about 5.0 mM to about 10 mM, about 10 mM to about 20 mM, about 20 mM to about 30 mM, about 30 mM to about 40 mM, about 40 mM to about 50 mM, about 50 mM to about 60 mM, about 60 mM to about 70 mM, about 70 mM to about 80 mM, about 80 mM to about 90 mM, about 90 mM to about 100 mM, about 100 mM to about 110 mM, about 110 mM to about 120 mM, about 120 mM to about 130 mM, about 130 mM to about 140 mM, about 140 mM to about 150 mM, about 150 mM to about 160 mM
- the inventive process comprises the addition of a molar ratio of exogenous NHS with respect to the amount of NHS generated during the
- modification reaction as a result of hydro lysis/amino lysis of the bifunctional linker.
- One of ordinary skill in the art can determine the amount of NHS generated during a particular modification as the amount of NHS generated is essentially the same as the amount of the bifunctional linker used.
- the skilled person can then add a molar ratio of exogenous NHS to the reaction mixture with respect to the amount of NHS generated during the modification reaction.
- about 2 to about 200 fold exogenous NHS is added with respect to the amount of NHS generated during the modification reaction.
- the inventive process comprises adding about 2, about 5, about 10, about 15, about 20, about 25, about 50, about 100, or about 200 fold exogenous NHS with respect to the amount of NHS generated during the modification reaction.
- the inventive process comprises the addition of a molar ratio of exogenous NHS with respect to the amount of the bifunctional linker.
- the molar ratio of the exogenous NHS to the bifunctional crosslinking agent is about 0.5 to about 1000 (e.g., about 1 to about 900, about 5 to about 750, about 50 to about 500, about 100 to about 500, about 0.5 to about 500, or about 100 to about 1000.
- the inventive process comprises about 0.5, about 1, about 2, about 5, about 10, about 15, about 20, about 25, about 50, about 100, about 200, about 300, about 400, about 500, about 600, about 700, about 800, about 900, or about 1000 fold NHS with respect to the amount of the bifunctional linker.
- the inventive process comprises the addition of exogenous NHS at any point during a process preparing a cell-binding agent-cytotoxic agent conjugate.
- the inventive process comprises the addition of exogenous NHS to the modification step (i.e., the step in which a cell-binding agent is reacted with a bifunctional linker), to the conjugation step (i.e., the step in which a modified cell-binding agent is reacted with a cytotoxic agent), to a purification step, or to a holding step between any of the foregoing steps.
- the inventive process comprises the addition of exogenous NHS to the modification step (i.e., NHS is added to the modification reaction), to a holding step between the modification step and a purification step, to a holding step between the modification step and the conjugation step, to a purification step, to the conjugation step, to a holding step between the conjugation step and a purification step, and/or to a holding step between two purification steps.
- exogenous NHS i.e., NHS is added to the modification reaction
- the invention provides a process for preparing a cell-binding agent having a linker bound thereto, which process comprises contacting a cell-binding agent with a bifunctional crosslinking reagent in the presence of exogenous NHS to covalently attach a linker to the cell-binding agent and thereby prepare a mixture comprising cell- binding agents having linkers bound thereto.
- the invention provides a process for preparing compositions of stable conjugates comprising a cell-binding agent chemically coupled to a cytotoxic agent, wherein the compositions are substantially free of unstable conjugates.
- the invention provides a process for preparing cell-binding agent-cytotoxic agent conjugate of substantially high purity and stability.
- Such compositions can be used for treating diseases because of the high purity and stability of the conjugates.
- Compositions comprising a cell-binding agent, such as an antibody, chemically coupled to a cytotoxic agent, such as a maytansinoid, are described in, for example, U.S. Patent 7,374,762.
- a cell- binding agent-cytotoxic agent conjugate of substantially high purity has one or more of the following features: (a) greater than about 90% (e.g., greater than or equal to about 91%>, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%), preferably greater than about 95%, of conjugate species are monomeric, (b) unconjugated linker level in the conjugate preparation or purified conjugate is less than about 10%> (e.g., less than or equal to about 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or 0%) (relative to total linker), (c) less than 10% of conjugate species are crosslinked (e.g., less than or equal to about 9%, 8%, 7%, 6%, 5%, 4%, 3%), 2%, 1%), or 0%)), (d) free cytotoxic agent level in the conjugate preparation or purified conjugate is less
- Substantial increase in free cytotoxic agent level means that after certain storage time, the increase in the level of free cytotoxic agent is less than about 0.1%, about 0.2%>, about 0.3%>, about 0.4%>, about 0.5%, about 0.6%, about 0.7%, about 0.8%, about 0.9%, about 1.0%, about 1.1%, about 1.2%, about 1.3%, about 1.4%, about 1.5%, about 1.6%, about 1.7%, about 1.8%, about 1.9%, about 2.0%, about 2.2%, about 2.5%, about 2.7%, about 3.0%, about 3.2%, about 3.5%, about 3.7%, or about 4.0%.
- the term "unconjugated linker” refers to the cell-binding agent that is covalently linked with the bifunctional crosslinking reagent, wherein the cell-binding agent is not covalently coupled to the cytotoxic agent through the linker of the bifunctional crosslinking reagent (i.e., the "unconjugated linker” can be represented by CBA-L, wherein CBA represents the cell-binding agent and L represents the bifunctional crosslinking reagent.
- the cell-binding agent cytotoxic agent conjugate can be represented by CBA-L-D, wherein D represents the cytotoxic agent).
- cytotoxic agent dimers refers to dimers comprising free cytotoxic agent, wherein the cytotoxic agent is not chemically coupled to the cell-binding agent through the linker.
- the cytotoxic agent dimers are chemically coupled to each other through a linker (i.e., the "cytotoxic agent dimers” can be represented by D-L-D, wherein D represents the cytotoxic agent and L represents the bifunctional crosslinking reagent.
- the cell-binding agent cytotoxic agent conjugate can be represented by CBA-L-D, wherein CBA represents the cell-binding agent).
- the cytotoxic agent dimers are not chemically coupled to each other through a linker (i.e., the "cytotoxic agent dimers" can be represented by D-D, wherein D represents the cytotoxic agent.
- the cell-binding agent cytotoxic agent conjugate can be represented by CBA-L-D, wherein CBA represents the cell-binding agent and L represents the bifunctional crosslinking reagent).
- the cytotoxic agent dimers are chemically coupled to each other through a linker and some of the cytotoxic agent dimers are not chemically coupled to each other through a linker (i.e., the "cytotoxic agent dimers" can be represented by D-L-D and D-D, wherein D represents the cytotoxic agent and L represents the bifunctional crosslinking reagent).
- the cytotoxic agent dimers are DM1 -DM1 dimer and DMl-MCC-DMl dimer, when the linker is SMCC and the cytotoxic agent is DM1.
- the cytotoxic agent dimers are DM1 -DM1 dimers and DMl-SPP-DMl dimers, when the linker is SPP and the cytotoxic agent is DM1.
- the cytotoxic agent dimers are DM1 -DM1 dimers and DM 1 -CXI -1 -DM1 dimers, when the linker is CXI- 1 and the cytotoxic agent is DM1.
- the term "free cytotoxic agent” refers to any form of the cytotoxic agent that is not chemically coupled to the cell-binding agent through the linker (i.e., the "free cytotoxic agent” can include, but is not limited to, the cytotoxic agent alone represented by D, the cytotoxic agent coupled with the linker or linker derivatives (e.g. hydrolyzed derivatives) represented by D-L and cytotoxic agent dimers represented by D-D and D-L-D described above).
- the free cytotoxic agent includes DM1, MCC-DM1, hydro- SMCC-DM1, SMCC-DM1, DM1-SPP, DM1 -TP A, DM1 -DM1, DM1-MCC-DM1, and DM1-SPP-DM1.
- the term "aggregates of the cell-binding agent cytotoxic agent conjugate” refers to two or more cell-binding agent cytotoxic agent conjugates covalently or noncovalently coupled to each other (e.g., two or more cell-binding agent cytotoxic agent conjugates covalently coupled through the linker).
- the average molar ratio of the cytotoxic agent to the cell- binding agent in the cell-binding agent cytotoxic agent conjugate is about 1 to about 10, about 2 to about 7, about 3 to about 5, about 2.5 to about 4.5 (e.g., about 2.5, about 2.6, about 2.7, about 2.8, about 2.9, about 3.0, about 3.1, about 3.3, about 3.4, about 3.5, about 3.6, about 3.7, about 3.8, about 3.9, about 4.0, about 4.1, about 4.2, about 4.3, about 4.4, about 4.5), about 3.0 to about 4.0, about 3.2 to about 4.2, about 4.5 to 5.5 (e.g., about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5.0, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5).
- the cell-binding agent can be any suitable agent that binds to a cell, typically and preferably an animal cell (e.g., a human cell).
- the cell-binding agent preferably is a peptide or a polypeptide or a glycotope.
- Suitable cell-binding agents include, for example, antibodies (e.g., monoclonal antibodies and fragments thereof), interferons (e.g., alpha, beta, gamma), lymphokines (e.g., interleukin 2 (IL-2), interleukin 3 (IL-3), interleukin 4 (IL-4), interleukin 6 (IL-6), hormones (e.g., insulin, TRH (thyrotropin releasing hormone), MSH (melanocyte- stimulating hormone), steroid hormones, such as androgens and estrogens), growth factors and colony-stimulating factors, such as epidermal growth factor (EGF), transforming growth factor alpha (TGF-alpha), fibroblast growth factor (FGF), vascular endothelial growth factor (VEGF), colony stimulating factors (CSFs), such as G-CSF, M-CSF and GM-CSF (Burgess, Immunology Today 5: 155-158 (1984)), nutrient-transport molecules (e.g
- the cell-binding agent binds to an antigen that is a polypeptide and may be a transmembrane molecule (e.g., receptor) or a ligand, such as a growth factor.
- antigens include molecules such as renin; a growth hormone, including human growth hormone and bovine growth hormone; growth hormone releasing factor; parathyroid hormone; thyroid stimulating hormone; lipoproteins; alpha- 1 -antitrypsin; insulin A-chain; insulin B-chain; proinsulin; follicle stimulating hormone; calcitonin;
- luteinizing hormone glucagon
- clotting factors such as factor vmc, factor IX, tissue factor (TF), and von Willebrands factor
- anti-clotting factors such as Protein C; atrial natriuretic factor; lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue- type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor; tumor necrosis factor-alpha and -beta; enkephalinase; RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-1 -alpha); a serum albumin, such as human serum albumin; Muellerian-inhibiting substance; relaxin A- chain; relaxin B-chain; prorelaxin; mouse gonadotropin-associated peptide; a microbial protein, such as beta-lactamase; DNase; IgE; a
- osteoinductive factors immunotoxins; a bone morphogenetic protein (BMP); an interferon, such as interferon-alpha, -beta, and -gamma; colony stimulating factors (CSFs), e.g., M-CSF, GM-CSF, and G-CSF; interleukins (ILs), e.g., IL-1 to IL-10; superoxide dismutase; T-cell receptors; surface membrane proteins; decay accelerating factor; viral antigen such as, for example, a portion of the HIV envelope; transport proteins; homing receptors; addressins; regulatory proteins; integrins, such as CDl la, CDl lb, CDl lc, CD 18, an ICAM, VLA-4 and VCAM; a tumor associated antigen such as HER2, HER3 or HER4 receptor; endoglin, c-Met, IGF1R, prostate antigens such as PC A3, PSA, PSGR, NGEP, PSMA, PSCA, T
- GM-CSF which binds to myeloid cells can be used as a cell-binding agent to diseased cells from acute myelogenous leukemia.
- IL-2 which binds to activated T- cells can be used for prevention of transplant graft rejection, for therapy and prevention of graft- versus-host disease, and for treatment of acute T-cell leukemia.
- MSH which binds to melanocytes, can be used for the treatment of melanoma, as can antibodies directed towards melanomas.
- Folic acid can be used to target the folate receptor expressed on ovarian and other tumors.
- Epidermal growth factor can be used to target squamous cancers such as lung and head and neck.
- Somatostatin can be used to target neuroblastomas and other tumor types.
- Cancers of the breast and testes can be successfully targeted with estrogen (or estrogen analogues) or androgen (or androgen analogues) respectively as cell-binding agents
- antibody refers to any immunoglobulin, any immunoglobulin fragment, such as Fab, Fab', F(ab') 2 , dsFv, sFv, minibodies, diabodies, tribodies, tetrabodies (Parham, J. Immunol. 131 : 2895-2902 (1983); Spring et al. J. Immunol. 113: 470-478 (1974); Nisonoff et al. Arch. Biochem. Biophys. 89: 230-244 (1960), Kim et al, Mol.
- any suitable antibody can be used as the cell-binding agent.
- Any suitable antibody can be used as the cell-binding agent.
- the selection of an appropriate antibody will depend upon the cell population to be targeted.
- the type and number of cell surface molecules (i.e., antigens) that are selectively expressed in a particular cell population will govern the selection of an appropriate antibody for use in the inventive composition.
- Cell surface expression profiles are known for a wide variety of cell types, including tumor cell types, or, if unknown, can be determined using routine molecular biology and histochemistry techniques.
- the antibody can be polyclonal or monoclonal, but is most preferably a monoclonal antibody.
- polyclonal antibodies refer to heterogeneous populations of antibody molecules, typically contained in the sera of immunized animals.
- Monoclonal antibodies refer to homogenous populations of antibody molecules that are specific to a particular antigen.
- Monoclonal antibodies are typically produced by a single clone of B lymphocytes ("B cells").
- B cells B cells
- Monoclonal antibodies may be obtained using a variety of techniques known to those skilled in the art, including standard hybridoma technology (see, e.g., Kohler and Milstein, Eur. J.
- the hybridoma method of producing monoclonal antibodies typically involves injecting any suitable animal, typically and preferably a mouse, with an antigen (i.e., an "immunogen"). The animal is subsequently sacrificed, and B cells isolated from its spleen are fused with human myeloma cells.
- an antigen i.e., an "immunogen”
- hybrid cell is produced (i.e., a "hybridoma"), which proliferates indefinitely and continuously secretes high titers of an antibody with the desired specificity in vitro.
- Any appropriate method known in the art can be used to identify hybridoma cells that produce an antibody with the desired specificity. Such methods include, for example, enzyme-linked immunosorbent assay (ELISA), Western blot analysis, and radioimmunoassay.
- ELISA enzyme-linked immunosorbent assay
- the population of hybridomas is screened to isolate individual clones, each of which secretes a single antibody species to the antigen. Because each hybridoma is a clone derived from fusion with a single B cell, all the antibody molecules it produces are identical in structure, including their antigen binding site and isotype.
- Monoclonal antibodies also may be generated using other suitable techniques including EBV-hybridoma technology (see, e.g., Haskard and Archer, J. Immunol. Methods, 74(2): 361-67 (1984), and Roder et al, Methods Enzymol., 121 : 140-67 (1986)), bacteriophage vector expression systems (see, e.g., Huse et al, Science, 246: 1275-81 (1989)), or phage display libraries comprising antibody fragments, such as Fab and scFv (single chain variable region) (see, e.g., U.S. Patents 5,885,793 and 5,969,108, and International Patent Application Publications WO 92/01047 and WO
- the monoclonal antibody can be isolated from or produced in any suitable animal, but is preferably produced in a mammal, more preferably a mouse or human, and most preferably a human. Methods for producing an antibody in mice are well known to those skilled in the art and are described herein. With respect to human antibodies, one of ordinary skill in the art will appreciate that polyclonal antibodies can be isolated from the sera of human subjects vaccinated or immunized with an appropriate antigen. Alternatively, human antibodies can be generated by adapting known techniques for producing human antibodies in non-human animals such as mice (see, e.g., U.S. Patents 5,545,806, 5,569,825, and
- human antibodies While being the ideal choice for therapeutic applications in humans, human antibodies, particularly human monoclonal antibodies, typically are more difficult to generate than mouse monoclonal antibodies.
- Mouse monoclonal antibodies induce a rapid host antibody response when administered to humans, which can reduce the therapeutic or diagnostic potential of the antibody-cytotoxic agent conjugate.
- a monoclonal antibody preferably is not recognized as "foreign" by the human immune system.
- phage display can be used to generate the antibody.
- phage libraries encoding antigen-binding variable (V) domains of antibodies can be generated using standard molecular biology and recombinant DNA techniques (see, e.g., Sambrook et al. (eds.), Molecular Cloning, A Laboratory Manual, 3 rd Edition, Cold Spring Harbor Laboratory Press, New York (2001)). Phage encoding a variable region with the desired specificity are selected for specific binding to the desired antigen, and a complete human antibody is reconstituted comprising the selected variable domain.
- Nucleic acid sequences encoding the reconstituted antibody are introduced into a suitable cell line, such as a myeloma cell used for hybridoma production, such that human antibodies having the characteristics of monoclonal antibodies are secreted by the cell (see, e.g., Janeway et al, supra, Huse et al, supra, and U.S. Patent 6,265,150).
- a suitable cell line such as a myeloma cell used for hybridoma production
- monoclonal antibodies can be generated from mice that are transgenic for specific human heavy and light chain immunoglobulin genes.
- Such methods are known in the art and described in, for example, U.S. Patents 5,545,806 and 5,569,825, and Janeway et al, supra.
- the antibody is a humanized antibody.
- a humanized antibody As used herein, a
- humanized antibody is one in which the complementarity-determining regions (CDR) of a mouse monoclonal antibody, which form the antigen binding loops of the antibody, are grafted onto the framework of a human antibody molecule. Owing to the similarity of the frameworks of mouse and human antibodies, it is generally accepted in the art that this approach produces a monoclonal antibody that is antigenically identical to a human antibody but binds the same antigen as the mouse monoclonal antibody from which the CDR sequences were derived. Methods for generating humanized antibodies are well known in the art and are described in detail in, for example, Janeway et al, supra, U.S. Patents 5,225,539, 5,585,089 and 5,693,761, European Patent No.
- Humanized antibodies can also be generated using the antibody resurfacing technology described in U.S. Patent 5,639,641 and Pedersen et al, J. Mol. Biol., 235: 959- 973 (1994). While the antibody employed in the conjugate of the inventive composition most preferably is a humanized monoclonal antibody, a human monoclonal antibody and a mouse monoclonal antibody, as described above, are also within the scope of the invention.
- Antibody fragments that have at least one antigen binding site, and thus recognize and bind to at least one antigen or receptor present on the surface of a target cell also are within the scope of the invention.
- proteolytic cleavage of an intact antibody molecule can produce a variety of antibody fragments that retain the ability to recognize and bind antigens.
- limited digestion of an antibody molecule with the protease papain typically produces three fragments, two of which are identical and are referred to as the Fab fragments, as they retain the antigen binding activity of the parent antibody molecule.
- F(ab') 2 fragment Cleavage of an antibody molecule with the enzyme pepsin normally produces two antibody fragments, one of which retains both antigen-binding arms of the antibody molecule, and is thus referred to as the F(ab') 2 fragment.
- Reduction of a F(ab') 2 fragment with dithiothreitol or mercaptoethylamine produces a fragment referred to as a Fab' fragment.
- a single-chain variable region fragment (sFv) antibody fragment which consists of a truncated Fab fragment comprising the variable (V) domain of an antibody heavy chain linked to a V domain of a light antibody chain via a synthetic peptide, can be generated using routine recombinant DNA technology techniques (see, e.g., Janeway et al, supra).
- disulfide-stabilized variable region fragments (dsFv) can be prepared by recombinant DNA technology (see, e.g., Reiter et al., Protein Engineering, 7: 697-704 (1994)).
- Antibody fragments in the context of the invention are not limited to these exemplary types of antibody fragments.
- Antibody fragments Any suitable antibody fragment that recognizes and binds to a desired cell surface receptor or antigen can be employed. Antibody fragments are further described in, for example, Parham, J. Immunol, 131 : 2895-2902 (1983), Spring et al., J. Immunol, 113: 470-478 (1974), and Nisonoff et al., Arch. Biochem. Biophys., 89: 230-244 (1960). Antibody-antigen binding can be assayed using any suitable method known in the art, such as, for example,
- RIA radioimmunoassay
- ELISA Western blot
- immunoprecipitation immunoprecipitation
- competitive inhibition assays see, e.g., Janeway et al, supra, and U.S. Patent Application Publication No. 2002/0197266 Al.
- the antibody can be a chimeric antibody or an antigen binding fragment thereof.
- chimeric it is meant that the antibody comprises at least two immunoglobulins, or fragments thereof, obtained or derived from at least two different species (e.g., two different immunoglobulins, such as a human immunoglobulin constant region combined with a murine immunoglobulin variable region).
- the antibody also can be a domain antibody (dAb) or an antigen binding fragment thereof, such as, for example, a camelid antibody (see, e.g., Desmyter et al, Nature Struct.
- a shark antibody such as, for example, a new antigen receptor (IgNAR) (see, e.g., Greenberg et al, Nature, 374: 168 (1995), and Stanfield et al, Science, 305: 1770-1773 (2004)).
- IgNAR new antigen receptor
- the monoclonal antibody J5 is a murine IgG2a antibody that is specific for Common Acute Lymphoblastic Leukemia Antigen (CALLA) (Ritz et al, Nature, 283: 583-585 (1980)), and can be used to target cells that express CALLA (e.g., acute lymphoblastic leukemia cells).
- CALLA Common Acute Lymphoblastic Leukemia Antigen
- the monoclonal antibody MY9 is a murine IgGl antibody that binds specifically to the CD33 antigen (Griffin et al, Leukemia Res., 8: 521 (1984)), and can be used to target cells that express CD33 (e.g., acute myelogenous leukemia (AML) cells).
- AML acute myelogenous leukemia
- the monoclonal antibody anti-B4 (also referred to as B4) is a murine IgGl antibody that binds to the CD 19 antigen on B cells (Nadler et al., J. Immunol. , 131 : 244-250 (1983)), and can be used to target B cells or diseased cells that express CD 19 (e.g., non- Hodgkin's lymphoma cells and chronic lymphoblastic leukemia cells).
- N901 is a murine monoclonal antibody that binds to the CD56 (neural cell adhesion molecule) antigen found on cells of neuroendocrine origin, including small cell lung tumor, which can be used in the conjugate to target drugs to cells of neuroendocrine origin.
- the J5, MY9, and B4 antibodies preferably are resurfaced or humanized prior to their use as part of the conjugate.
- the anti-B4 antibody is huB4.
- the anti-B4 antibody comprises a heavy chain and a light chain, wherein the heavy chain has the following sequence
- the monoclonal antibody C242 binds to the CanAg antigen (see, e.g., U.S. Patent 5,552,293), and can be used to target the conjugate to CanAg expressing tumors, such as colorectal, pancreatic, non-small cell lung, and gastric cancers.
- HuC242 is a humanized form of the monoclonal antibody C242 (see, e.g., U.S. Patent 5,552,293).
- the hybridoma from which HuC242 is produced is deposited with ECACC identification Number 90012601.
- HuC242 can be prepared using CDR-grafting methodology (see, e.g., U.S.
- HuC242 can be used to target the conjugate to tumor cells expressing the CanAg antigen, such as, for example, colorectal, pancreatic, non-small cell lung, and gastric cancer cells.
- an anti-MUC 1 antibody can be used as the cell-binding agent in the conjugate.
- Anti-MUC 1 antibodies include, for example, anti-HMFG-2 (see, e.g., Taylor-Papadimitriou et al, Int. J. Cancer, 28: 17-21 (1981)), hCTMOl (see, e.g., van Hof et al, Cancer Res., 56: 5179-5185 (1996)), and DS6.
- Prostate cancer cells also can be targeted with the conjugate by using an anti-prostate-specific membrane antigen (PSMA) as the cell-binding agent, such as J591 (see, e.g., Liu et al, Cancer Res., 57: 3629-3634 (1997)).
- PSMA anti-prostate-specific membrane antigen
- cancer cells that express the Her2 antigen such as breast, prostate, and ovarian cancers, can be targeted with the conjugate by using anti- HER2 antibodies, e.g., trastuzumab, as the cell-binding agent.
- Cells that express epidermal growth factor receptor (EGFR) and variants thereof, such as the type III deletion mutant, EGFPvvIII, can be targeted with the conjugate by using anti-EGFR antibodies.
- EGFR epidermal growth factor receptor
- Anti-EGFR antibodies are described in International Patent Application Nos. PCT/US11/058385 and PCT/US11/058378.
- Anti-EGFRvIII antibodies are described in U.S. Patents 7,736,644 and 7,628,986, and U.S. Patent Application Publications 2010/0111979; 2009/0240038;
- Anti-IGF-IR antibodies that bind to insulin- like growth factor receptor such as those described in U.S. Patent 7,982,024, also can be used in the conjugate.
- Antibodies that bind to CD27L, Cripto, CD138, CD38, EphA2, integrins, CD37, folate, CD20, PSGR, NGEP, PSCA, TMEFF2, STEAP1, endoglin, and Her3 also can be used in the conjugate.
- the antibody is selected from the group consisting of huN901, anti-CD33 antibody (e.g., huMy9-6), huB4, huC242, an anti-HER2 antibody (e.g., trastuzumab), bivatuzumab, sibrotuzumab, rituximab, huDS6, anti-mesothelin antibodies described in International Patent Application Publication WO 2010/124797 (such as MF-T), anti-cripto antibodies described in U.S. Patent Application Publication 2010/0093980 (such as huB3F6), anti-CD138 antibodies described in U.S. Patent Application Publication 2007/0183971 (such as B-B4 or humanized B-B4 or nBT062), anti-EGFR antibodies described in International Patent Application Publications WO 2012/058592 and WO
- 2012/058588 such as EGFR-7
- anti-EGFRvIII antibodies described U.S. Patents 7,736,644 and 7,628,986 and U.S. Patent Application Publications 2010/0111979, 2009/0240038, 2009/0175887, 2009/0156790 and 2009/0155282, humanized EphA2 antibodies described in International Patent Application Publications WO 2011/039721 and WO 2011/039724 (such as 2H11R35R74); anti-CD38 antibodies described in International Patent Application
- the antibody is not huN901, or CNT095.
- the anti-CD37 antibody is huCD37-3, wherein the antibody comprises a variable heavy chain and a variable light chain, wherein the variable heavy chain has the following sequence
- variable light chain has the following sequence
- DIQMTQSPSSLSVSVGERVTITCRASENIRSNLAWYQQKPGKSPKLLVNVATNLADG VPSRFSGSGSGTDYSLKINSLQPEDFGTYYCQHYWGTTWTFGQGTKLEIKR (SEQ ID NO: 4).
- the cell-binding agent preferably is an antibody
- the cell-binding agent also can be a non-antibody molecule.
- suitable non-antibody molecules include, for example, interferons (e.g., alpha, beta, or gamma interferon), lymphokines (e.g., interleukin 2 (IL-2), IL-3, IL-4, or IL-6), hormones (e.g., insulin), growth factors (e.g., EGF, TGF-alpha, FGF, and VEGF), colony-stimulating factors (e.g., G-CSF, M-CSF, and GM-CSF (see, e.g., Burgess, Immunology Today, 5: 155-158 (1984)), somatostatin, and transferrin (see, e.g., O'Keefe et al, J.
- interferons e.g., alpha, beta, or gamma interferon
- lymphokines
- GM-CSF which binds to myeloid cells
- IL-2 which binds to activated T-cells
- EGF epidermal growth factor
- Somatostatin can be used to target neuroblastoma cells and other tumor cell types.
- the conjugate can comprise any suitable cytotoxic agent.
- Suitable cytotoxic agents include, for example, maytansinoids and maytansinoid analogs, taxoids, CC-1065 and CC-1065 analogs, and dolastatin and dolastatin analogs.
- the cytotoxic agent is a maytansinoid, including maytansinol and maytansinol analogs. Maytansinoids are compounds that inhibit microtubule formation and are highly toxic to mammalian cells.
- Suitable maytansinol analogues include those having a modified aromatic ring and those having modifications at other positions.
- Such maytansinoids are described in, for example, U.S. Patents 4,256,746, 4,294,757, 4,307,016, 4,313,946, 4,315,929, 4,322,348, 4,331,598, 4,361,650, 4,362,663, 4,364,866, 4,424,219, 4,371,533, 4,450,254, 5,475,092, 5,585,499, 5,846,545, and 6,333,410.
- Examples of maytansinol analogs having a modified aromatic ring include:
- Examples of maytansinol analogs having modifications of positions other than an aromatic ring include: (1) C-9-SH (U.S. Patent 4,424,219) (prepared by the reaction of maytansinol with H 2 S or P 2 S 5 ), (2) C-14-alkoxymethyl (demethoxy/CH 2 OR) (U.S. Patent 4,331,598), (3) C-14-hydroxymethyl or acyloxymethyl (CH 2 OH or CH 2 OAc) (U.S. Patent 4,450,254) (prepared from Nocardia), (4) C-15-hydroxy/acyloxy (U.S. Patent 4,364,866) (prepared by the conversion of maytansinol by Streptomyces), (5) C-15-methoxy (U.S.
- Patents 4,313,946 and 4,315,929) isolated from Trewia nudiflora
- (6) C-18-N-demethyl U.S. Patents 4,362,663 and 4,322,348
- 4,5-deoxy U.S. Patent 4,371,533
- the conjugate utilizes the thiol- containing maytansinoid DM1, also known as N 2 -deacetyl-N 2 -(3-mercapto-l-oxopropyl)- maytansine, as the cytotoxic agent.
- DM1 is represented by formula (I):
- the conjugate utilizes the thiol- containing maytansinoid DM4, also known as N 2 -deacetyl-N 2 -(4-methyl-4-mercapto-l- oxopentyl)-maytansine, as the cytotoxic agent.
- DM4 is represented by formula (II):
- maytansines may be used in the context of the invention, including, for example, thiol and disulfide-containing maytansinoids bearing a mono or di-alkyl substitution on the carbon atom bearing the sulfur atom.
- Particularly preferred is a maytansinoid having at the C-3 position (a) C-14 hydroxymethyl, C-15 hydroxy, or C-20 desmethyl functionality, and (b) an acylated amino acid side chain with an acyl group bearing a hindered sulfhydryl group, wherein the carbon atom of the acyl group bearing the thiol functionality has one or two substituents, said substituents being CH 3 , C 2 H 5 , linear or branched alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, and further wherein one of the substituents
- Ri and R 2 are each independently CH 3 , C 2 3 ⁇ 4, linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H,
- A, B, D are cycloalkyl or cycloalkenyl having 3-10 carbon atoms, simple or substituted aryl, or heterocyclic aromatic, or heterocycloalkyl radical,
- R 3 , R 4 , R 5 , 5, R 7 , Rs, R 9 , Rio, R 11 , and Ri 2 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic, or heterocycloalkyl radical,
- 1, m, n, o, p, q, r, s, and t are each independently zero or an integer from 1 to 5, provided that at least two of 1, m, n, o, p, q, r, s and t are not zero at any one time, and wherein Z is H, SR or COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic, or heterocycloalkyl radical.
- Preferred embodiments of formula (III) include compounds of formula (III) wherein (a) Ri is H, R 2 is methyl and Z is H, (b) Ri and R 2 are methyl and Z is H, (c) Ri is H,
- R 2 is methyl, and Z is -SCH 3 , and (d) Ri and R 2 are methyl, and Z is -SCH 3 .
- Such additional maytansines also include compounds represented by formula (IV-
- Ri and R 2 are each independently CH 3 , C2H5, linear alkyl, or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H,
- R 3 , R4, R 5 , 5, R7, and Rg are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical,
- n are each independently an integer of from 1 to 5, and in addition n can be zero,
- Z is H, SR, or COR wherein R is linear or branched alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical, and
- Preferred embodiments of formulas (IV-L), (IV-D) and (IV-D,L) include compounds of formulas (IV-L), (IV-D) and (IV-D,L) wherein (a) Ri is H, R 2 is methyl, R 5 , R6, R7 , and Rs are each H, 1 and m are each 1, n is 0, and Z is H, (b) Ri and R 2 are methyl, R 5 , Re, R 7 , Rg are each H, 1 and m are 1 , n is 0, and Z is H, (c) Ri is H, R 2 is methyl, R 5 , R ⁇ ,
- R 7 , and Rg are each H, 1 and m are each 1 , n is 0, and Z is -SCH 3 , or (d) Ri and R 2 are methyl, R 5 , 5, R7, Rs are each H, 1 and m are 1 , n is 0, and Z is -SCH 3 .
- the cytotoxic agent is represented by formula (IV-L).
- Additional preferred maytansines also include compounds represented by formula
- Y represents (CR 7 R8)i(CR 5 R 6 ) m (CR 3 R 4 ) n CRiR 2 SZ
- Ri and R 2 are each independently CH 3 , C2H5, linear alkyl, or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H,
- R 3 , R 4 , R 5 , 5, R 7 , and Rg are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl, or heterocyclic aromatic or heterocycloalkyl radical,
- n are each independently an integer of from 1 to 5, and in addition n can be zero, and
- Z is H, SR or COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical.
- Preferred embodiments of formula (V) include compounds of formula (V) wherein (a) Ri is H, R 2 is methyl, R 5 , 5, R 7 , and Rg are each H; 1 and m are each 1; n is 0; and Z is H, (b) Ri and R 2 are methyl; R 5 , 5, R 7 , Rs are each H, 1 and m are 1; n is 0; and Z is H, (c) Ri is H, R 2 is methyl, R 5 , 5, R 7 , and Rg are each H, 1 and m are each 1, n is 0, and Z is -SCH 3 , or (d) Ri and R 2 are methyl, R 5 , R ⁇ , R 7 , R 8 are each H, 1 and m are 1, n is 0, and Z is - SCH 3 .
- Still further preferred maytansines include compounds represented by formula (VI-L), (VI-D), or (VI-D,L):
- VI-L (VI-D) (VI-D, L)
- Y 2 represents (CR 7 R 8 )i(CR 5 R 6 ) m (CR 3 R 4 ) n CRiR 2 SZ 2 ,
- Ri and R 2 are each independently CH 3 , C 2 3 ⁇ 4, linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and wherein R 2 also can be H,
- R 3 , R 4 , R 5 , 5, R 7 , and Rg are each independently H, CH 3 , C 2 H 5 , linear cyclic alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical,
- n are each independently an integer of from 1 to 5, and in addition n can be zero,
- Z 2 is SR or COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical, and
- May is a maytansinoid.
- Additional preferred maytansines include compounds represented by formula (VII):
- Ri and R 2 are each independently CH 3 , C 2 3 ⁇ 4, linear branched or alkyl or alkenyl having from 1 to 10 carbon atoms, cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical, and in addition R 2 can be H,
- A, B, and D each independently is cycloalkyl or cycloalkenyl having 3 to 10 carbon atoms, simple or substituted aryl, or heterocyclic aromatic or heterocycloalkyl radical, wherein R 3 , R4, R 5 , 5, R7, Rs, R9, Rio, R11, and Ri 2 are each independently H, CH 3 , C 2 H 5 , linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, phenyl, substituted phenyl or heterocyclic aromatic or heterocycloalkyl radical,
- 1, m, n, o, p, q, r, s, and t are each independently zero or an integer of from 1 to 5, provided that at least two of 1, m, n, o, p, q, r, s and t are not zero at any one time, and wherein Z 2 is SR or -COR, wherein R is linear alkyl or alkenyl having from 1 to 10 carbon atoms, branched or cyclic alkyl or alkenyl having from 3 to 10 carbon atoms, or simple or substituted aryl or heterocyclic aromatic or heterocycloalkyl radical.
- Preferred embodiments of formula (VII) include compounds of formula (VII), wherein Ri is H and R 2 is methyl.
- the cytotoxic agent used in the conjugate can be a taxane or derivative thereof.
- Taxanes are a family of compounds that includes paclitaxel (Taxol®), a cytotoxic natural product, and docetaxel (Taxotere®), a semi-synthetic derivative, which are both widely used in the treatment of cancer. Taxanes are mitotic spindle poisons that inhibit the depolymerization of tubulin, resulting in cell death. While docetaxel and paclitaxel are useful agents in the treatment of cancer, their antitumor activity is limited because of their non-specific toxicity towards normal cells. Further, compounds like paclitaxel and docetaxel themselves are not sufficiently potent to be used in conjugates of cell-binding agents.
- a preferred taxane for use in the preparation of a cytotoxic conjugate is the taxane of formula (VIII):
- the cytotoxic agent also can be CC-1065 or a derivative thereof.
- CC-1065 is a potent anti-tumor antibiotic isolated from the culture broth of Streptomyces zelensis.
- CC- 1065 is about 1000-fold more potent in vitro than commonly used anti-cancer drugs, such as doxorubicin, methotrexate, and vincristine (Bhuyan et al, Cancer Res., 42: 3532-3537 (1982)).
- CC-1065 and its analogs are disclosed in U.S. Patents 5,585,499, 5,846,545, 6,340,701, and 6,372,738.
- cytotoxic potency of CC-1065 has been correlated with its alkylating activity and its DNA-binding or DNA-intercalating activity. These two activities reside in separate parts of the molecule.
- the alkylating activity is contained in the cyclopropapyrrolomdole (CPI) subunit and the DNA-binding activity resides in the two pyrroloindole subunits of CC-1065.
- CPI cyclopropapyrrolomdole
- DNA-binding activity resides in the two pyrroloindole subunits of CC-1065.
- CC-1065 analogs are known in the art and also can be used as the cytotoxic agent in the conjugate (see, e.g., Warpehoski et al, J. Med. Chem., 31: 590-603 (1988)).
- CC-1065 analogs have been developed in which the CPI moiety is replaced by a cyclopropabenzindole (CBI) moiety (Boger et al, J. Org. Chem., 55: 5823- 5833 (1990), and Boger et al, Bioorg. Med. Chem. Lett., 1: 115-120 (1991)).
- CBI cyclopropabenzindole
- CC- 1065 analogs maintain the high in vitro potency of the parental drug, without causing delayed toxicity in mice.
- these compounds are alkylating agents that covalently bind to the minor groove of DNA to cause cell death.
- CC-1065 analogs can be greatly improved by changing the in vivo distribution through targeted delivery to a tumor site, resulting in lower toxicity to non-targeted tissues, and thus, lower systemic toxicity.
- conjugates of analogs and derivatives of CC-1065 with cell-binding agents that specifically target tumor cells have been generated (see, e.g., U.S. Patents 5,475,092, 5,585,499, and 5,846,545).
- conjugates typically display high target-specific cytotoxicity in vitro, and anti-tumor activity in human tumor xenograft models in mice (see, e.g., Chari et al., Cancer Res., 55: 4079-4084 (1995)).
- Drugs such as methotrexate, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil, calicheamicin, tubulysin and tubulysin analogs, duocarmycin and duocarmycin analogs, dolastatin and dolastatin analogs also can be used as the cytotoxic agents of the invention.
- Doxarubicin and daunorubicin compounds can also be used as the cytotoxic agent.
- the cell-binding agent cytotoxic agent conjugates may be prepared by in vitro methods.
- a linking group is used. Suitable linking groups are well known in the art and include disulfide groups, acid labile groups, photolabile groups, peptidase labile groups, and esterase labile groups, as well as
- the cell-binding agent is modified by reacting a bifunctional crosslinking reagent with the cell-binding agent, thereby resulting in the covalent attachment of a linker molecule to the cell-binding agent.
- a bifunctional crosslinking reagent refers to a reagent that possesses two reactive groups; one of which is capable of reacting with a cell-binding agent, while the other one is capable of reacting with the cytotoxic agent to link the cell-binding agent with the cytotoxic agent, thereby forming a conjugate.
- any suitable bifunctional crosslinking reagent can be used in connection with the invention, so long as the linker reagent provides for retention of the therapeutic, e.g., cytotoxicity, and targeting characteristics of the cytotoxic agent and the cell-binding agent, respectively, while providing an acceptable toxicity profile.
- the linker molecule joins the cytotoxic agent to the cell-binding agent through chemical bonds (as described above), such that the cytotoxic agent and the cell-binding agent are chemically coupled (e.g., covalently bonded) to each other.
- the cell binding agent is chemically coupled to the cytotoxic agent via chemical bonds selected from the group consisting of disulfide bonds, acid labile bonds, photolabile bonds, peptidase labile bonds, and esterase labile bonds.
- the bifunctional crosslinking reagent comprises non-cleavable linkers.
- a non-cleavable linker is any chemical moiety that is capable of linking a cytotoxic agent, such as a maytansinoid, a taxane, or a CC-1065 analog, to a cell-binding agent in a stable, covalent manner.
- non-cleavable linkers are substantially resistant to acid- induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the cytotoxic agent or the cell-binding agent remains active.
- Suitable crosslinking reagents that form non-cleavable linkers between a cytotoxic agent and the cell-binding agent are well known in the art.
- the cytotoxic agent is chemically coupled to the cell-binding agent through a thioether bond.
- the cytotoxic agent is linked to the cell-binding agent through an amide bond.
- non-cleavable linkers include linkers having a maleimido-based moeity or a haloacetyl-based moiety for reaction with the cytotoxic agent.
- Such bifunctional crosslinking agents are well known in the art (see U.S. Patent Application Publication Nos.
- Cross-linking reagents comprising a haloacetyl-based moiety include N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB), N-succinimidyl iodoacetate (SIA), N-succinimidyl bromoacetate (SBA), N- succinimidyl 3-(bromoacetamido)propionate (SBAP), bis-maleimidopolyethyleneglycol (BMPEO), BM(PEO) 2 , BM(PEO) 3 , N-( -maleimidopropyloxy)succinimide ester (BMPS), 5- maleimidovaleric acid NHS, HBVS, 4-(4-N-maleimidophenyl)-butyric acid hydrazide » HCl (MPBH), Succinimidyl-(4-vinylsulfonyl)benzoate (SVSB), di
- BMDB bis-maleimidohexane
- BMH bis-maleimidoethane
- BMOE bis-maleimidoethane
- sulfo-SMCC sulfosuccinimidyl(4-iodo- acetyl)aminobenzoate
- sulfo-SIAB m-Maleimidobenzoyl-N-hydroxysulfosuccinimide ester
- sulfo-MBS N-(y-maleimidobutryloxy)sulfosuccinimde ester
- sulfo-GMBS ⁇ -( ⁇ - maleimidocaproyloxy)sulfosuccimido ester
- sulfo-EMCS ⁇ -( ⁇ - maleimidoundecanoyloxy
- the linking reagent is a cleavable linker.
- suitable cleavable linkers include disulfide containing linkers, acid labile linkers, photolabile linkers, peptidase labile linkers, and esterase labile linkers.
- Disulfide containing linkers are linkers cleavable through disulfide exchange, which can occur under physiological conditions.
- Acid labile linkers are linkers cleavable at acid pH. For example, certain intracellular compartments, such as endosomes and lysosomes, have an acidic pH (pH 4-5), and provide conditions suitable to cleave acid labile linkers.
- Photo labile linkers are useful at the body surface and in many body cavities that are accessible to light. Furthermore, infrared light can penetrate tissue. Peptidase labile linkers can be used to cleave certain peptides inside or outside cells (see e.g., Trouet et al, Proc. Natl. Acad. Sci. USA, 79: 626-629 (1982), and Umemoto et al., Int. J. Cancer, 43: 677-684 (1989)). In one embodiment, the cleavable linker is cleaved under mild conditions, i.e., conditions within a cell under which the activity of the cytotoxic agent is not affected.
- the cytotoxic agent is linked to a cell-binding agent through a disulfide bond.
- the linker molecule comprises a reactive chemical group that can react with the cell-binding agent.
- the bifunctional crosslinking reagent comprises a reactive moiety that can form an amide bond with a lysine residue of the cell-binding agent.
- reactive ester moieties such as N- succinimidyl ester, N-sulfosuccinimidyl ester, nitrophenyl ⁇ e.g., 2 or 4-nitrophenyl) ester, dinitrophenyl ⁇ e.g., 2,4-
- Preferred reactive chemical groups for reaction with the cell-binding agent are N- succinimidyl esters and N-sulfosuccinimidyl esters.
- the linker molecule comprises a reactive chemical group, preferably a dithiopyridyl group, that can react with the cytotoxic agent to form a disulfide bond.
- Bifunctional crosslinking reagents that enable the linkage of the cell-binding agent with the cytotoxic agent via disulfide bonds are known in the art and include, for example, N-succinimidyl 3-(2-pyridyldithio)propionate (SPDP) (see, e.g., Carlsson et al, Biochem.
- N-succinimidyl 4-(2- pyridyldithio)butanoate SPDB
- SPDB N-succinimidyl 4-(2- pyridyldithio)pentanoate
- SPP N-succinimidyl 4-(2- pyridyldithio)pentanoate
- SPP N- succinimidyl-4-(2-pyridyldithio)2-sulfo butanoate
- sulfo-SPDB N- succinimidyl-4-(2-pyridyldithio)2-sulfo butanoate
- Other bifunctional crosslinking reagents that can be used to introduce disulfide groups are known in the art and are described in U.S.
- linkers can be derived from dicarboxylic acid based moieties.
- Suitable dicarboxylic acid based moieties include, but are not limited to, ⁇ , ⁇ - dicarboxylic acids of the general formula (IX):
- X is a linear or branched alkyl, alkenyl, or alkynyl group having 2 to 20 carbon atoms
- Y is a cycloalkyl or cycloalkenyl group bearing 3 to 10 carbon atoms
- Z is a substituted or unsubstituted aromatic group bearing 6 to 10 carbon atoms, or a substituted or unsubstituted heterocyclic group wherein the hetero atom is selected from N, O or S, and wherein 1, m, and n are each 0 or 1, provided that 1, m, and n are all not zero at the same time.
- Final purified cell-binding agent cytotoxic agent conjugates produced by the inventive process comprise a cytotoxic agent, a bifunctional crosslinking agent, and a cell- binding agent.
- the cytotoxic agent is DM1
- the bifunctional crosslinking agent is SMCC
- the cell-binding agent is huCD37-3 antibody.
- the cytotoxic agent is DM1
- the bifunctional crosslinking agent is SMCC
- the cell-binding agent is EGFR-7R antibody.
- the cytotoxic agent is DM1
- the bifunctional crosslinking agent is SMCC
- the cell-binding agent is an anti-EFGRvIII antibody.
- the cytotoxic agent is DM1, the bifunctional crosslinking agent is SMCC, and the cell-binding agent is an anti-CD27L antibody.
- the cytotoxic agent is DM1
- the bifunctional crosslinking agent is SMCC
- the cell-binding agent is trastuzumab.
- This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
- An antibody-SMCC-DMl conjugate was prepared by the one-step process (as described in U.S. Patent Application Publication No. 2012/0253021).
- the reaction mixture was continuously pumped through a PVDF filter and the filtrate was collected and analyzed for DM1 dimer species.
- DM1 dimer species including DM1 -DM1 and DM1-MCC-DM1, that were present prior to the PVDF filtration (see Fig. 1A), were efficiently removed by PVDF filtration (see Fig. IB).
- This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane alone and in combination with an ion exchange chromatography membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
- An antibody-SMCC-DMl conjugate was prepared by the one-step process (as described in U.S. Patent Application Publication No. 2012/0253021).
- the reaction mixture was filtered through a PVDF membrane filter or a combination of PVDF membrane filter and a Q membrane (an ion exchange chromatography membrane). As shown in Table 1 below, the combination of a PVDF membrane filter and Q membrane removed more DM1 dimer species than the PVDF membrane filter alone.
- This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising repeatedly subjecting a mixture comprising a cell- binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell- binding agent cytotoxic agent conjugate.
- An antibody-SMCC-DMl conjugate was prepared by the one-step process (as described in U.S. Patent Application Publication No. 2012/0253021).
- the reaction mixture was filtered through a PVDF membrane filter either two or three times.
- the percent of DM1 dimers (DM1 -DM1 and DMl-MCC-DMl) was measured before and after each filtration. As shown in Figure 2, additional PVDF membrane filtration can further remove the DM1 dimer species.
- This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
- huN901-SPP-DMl conjugate was prepared by the one-step process (as described in U.S. Patent Application Publication No. 2012/0253021). Briefly, huN901 antibody was diafiltered into modification buffer (50 mM potassium phosphate, 2 mM
- reaction mixture was then filtered through a 0.22 ⁇ Dura pore PVDF filter.
- the amount of free cytotoxic agent present in the reaction mixture before and after PVDF filtration was measured by HPLC. The results are shown in Table 3 below.
- This example demonstrates a process for preparing a purified cell-binding agent cytotoxic agent conjugate comprising subjecting a mixture comprising a cell-binding agent cytotoxic agent conjugate and one or more impurities to a PVDF membrane to remove at least a portion of the impurities from the mixture, thereby providing a purified cell-binding agent cytotoxic agent conjugate.
- HuN901 antibody was modified at a concentration of 16.0 mg/ml with SPP at a ratio of 11.0 mg/g antibody (4.7X molar ratio) in 50 mM KPi , 50 mM KC1, 2 mM EDTA, pH 7.5 buffer with 5% (v/v) DMA for a total of 180 minutes at 23°C with constant stirring.
- the modified antibody was then conjugated at a concentration of 2.5 mg/ml with a 1.8 fold molar excess of DM1 relative to initial SPP linker in 15 mM KPi buffer with 2mM EDTA, 7.7 mM citric acid and 5% DMA at pH 5.3 for 23 hrs at 23°C with constant stirring.
- the reaction mixture was filtered through a 0.22um Dura pore PVDF filter.
- the amount of free cytotoxic agent present in the reaction mixture before and after PVDF filtration was measured by HPLC. The results are shown in Table 4 below.
- DMl-SPP-DMl 0.1% Not detectable
- the amount of all free cytotoxic agent species measured i.e., DM1 -TP A, DM1, DM1 -DM1, and DMl-SPP-DMl
- DM1 -TP A a free cytotoxic agent species measured
- DM1 -DM1 a cytotoxic agent dimer species measured
- DMl-SPP-DMl a cytotoxic agent dimer species
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Analytical Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Separation Using Semi-Permeable Membranes (AREA)
- Treatment Of Liquids With Adsorbents In General (AREA)
- Solid-Sorbent Or Filter-Aiding Compositions (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (17)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2015535823A JP6345181B2 (ja) | 2012-10-04 | 2013-10-04 | 細胞結合剤細胞毒性剤コンジュゲートを精製するためのpvdf膜の使用 |
HK16101357.7A HK1213288A1 (zh) | 2012-10-04 | 2013-10-04 | 使用pvdf膜純化細胞結合劑細胞毒性劑綴合物 |
MX2015004257A MX359599B (es) | 2012-10-04 | 2013-10-04 | Uso de una membrana de pvdf para purificar conjugados de agentes de unión celular y agentes citotóxicos. |
SG11201502429YA SG11201502429YA (en) | 2012-10-04 | 2013-10-04 | Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates |
AU2013326881A AU2013326881B2 (en) | 2012-10-04 | 2013-10-04 | Use of a PVDF membrane to purify cell-binding agent cytotoxic agent conjugates |
CN201380061552.7A CN105209592A (zh) | 2012-10-04 | 2013-10-04 | 使用pvdf膜纯化细胞结合剂细胞毒性剂缀合物 |
NZ707091A NZ707091A (en) | 2012-10-04 | 2013-10-04 | Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates |
US14/430,701 US10035817B2 (en) | 2012-10-04 | 2013-10-04 | Method of purifying cell-binding agent-cytotoxic agent conjugates with a PVDF membrane |
EP13844268.6A EP2904089A4 (en) | 2012-10-04 | 2013-10-04 | USE OF A PVDF MEMBRANE FOR PURIFYING CELL BINDING AGENT-CYTOTOXIC AGENT CONJUGATES |
RU2015116882A RU2661083C2 (ru) | 2012-10-04 | 2013-10-04 | Использование пвдф-мембраны для очистки конъюгатов клеточно-связывающий агент - цитотоксический агент |
IN3202DEN2015 IN2015DN03202A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) | 2012-10-04 | 2013-10-04 | |
CA 2886993 CA2886993A1 (en) | 2012-10-04 | 2013-10-04 | Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates |
IL238110A IL238110B (en) | 2012-10-04 | 2015-04-02 | Using a polyvinyl difluoride membrane to purify conjugates of a cytotoxic factor and a cell-binding factor |
ZA201502992A ZA201502992B (en) | 2012-10-04 | 2015-04-30 | Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates |
US16/023,005 US20190031712A1 (en) | 2012-10-04 | 2018-06-29 | Use of a PVDF membrane to purify cell-binding agent cytotoxic agent conjugates |
AU2018241056A AU2018241056A1 (en) | 2012-10-04 | 2018-10-03 | Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates |
IL268378A IL268378A (en) | 2012-10-04 | 2019-07-31 | Using a polyvinyl difluoride membrane to purify conjugates of a cytotoxic factor and a cell-binding factor |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201261709891P | 2012-10-04 | 2012-10-04 | |
US61/709,891 | 2012-10-04 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/430,701 A-371-Of-International US10035817B2 (en) | 2012-10-04 | 2013-10-04 | Method of purifying cell-binding agent-cytotoxic agent conjugates with a PVDF membrane |
US16/023,005 Continuation US20190031712A1 (en) | 2012-10-04 | 2018-06-29 | Use of a PVDF membrane to purify cell-binding agent cytotoxic agent conjugates |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2014055877A1 true WO2014055877A1 (en) | 2014-04-10 |
Family
ID=50435472
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2013/063480 WO2014055877A1 (en) | 2012-10-04 | 2013-10-04 | Use of a pvdf membrane to purify cell-binding agent cytotoxic agent conjugates |
Country Status (15)
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106999604A (zh) * | 2014-09-02 | 2017-08-01 | 伊缪诺金公司 | 用于配制抗体药物缀合物组合物的方法 |
US11040084B2 (en) * | 2014-04-29 | 2021-06-22 | Genequantum Healthcare (Suzhou) Co., Ltd. | Stable antibody-drug conjugate, preparation method therefor, and use thereof |
US11717576B2 (en) | 2021-03-08 | 2023-08-08 | Genequantum Healthcare (Suzhou) Co., Ltd. | Antibody-immune agonist conjugate and applications thereof |
WO2024193570A1 (en) * | 2023-03-21 | 2024-09-26 | Genequantum Healthcare (Suzhou) Co., Ltd. | Combination of antibody-drug conjugate and cancer therapy, and use thereof |
Families Citing this family (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
PT1928503E (pt) | 2005-08-24 | 2012-10-19 | Immunogen Inc | Processo para preparação de conjugados de anticorpo e maitansinóide |
TR201907573T4 (tr) | 2009-06-03 | 2019-06-21 | Immunogen Inc | Konjugasyon yöntemleri̇ |
EP2691155B1 (en) | 2011-03-29 | 2018-11-14 | Immunogen, Inc. | Preparation of maytansinoid antibody conjugates by a one-step process |
RU2661083C2 (ru) | 2012-10-04 | 2018-07-11 | Иммуноджен, Инк. | Использование пвдф-мембраны для очистки конъюгатов клеточно-связывающий агент - цитотоксический агент |
CN105797603A (zh) * | 2016-04-13 | 2016-07-27 | 伊美特(上海)环保科技有限公司 | 一种亲水性中空纤维超滤膜及其制备工艺 |
CN106995639A (zh) * | 2017-04-18 | 2017-08-01 | 安徽省康宇水电机械成套设备有限公司 | 一种低成本水下防腐材料 |
CN108549763B (zh) * | 2018-04-09 | 2021-06-01 | 电子科技大学 | 一种用于离子推进器数值模拟的电荷交换碰撞mcc方法 |
CN112830937B (zh) * | 2019-11-22 | 2025-04-04 | 上海医药集团股份有限公司 | 一种美登素dm1聚合物的制备方法 |
CN117177775A (zh) | 2021-04-14 | 2023-12-05 | 启德医药科技(苏州)有限公司 | 连接子、缀合物及其应用 |
Citations (67)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
US4563304A (en) | 1981-02-27 | 1986-01-07 | Pharmacia Fine Chemicals Ab | Pyridine compounds modifying proteins, polypeptides or polysaccharides |
GB2188638A (en) | 1986-03-27 | 1987-10-07 | Gregory Paul Winter | Chimeric antibodies |
WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
US5552293A (en) | 1991-07-03 | 1996-09-03 | Pharmacia Aktiebolag | Tumor antigen specific antibody |
US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
WO1999005317A1 (en) * | 1997-07-28 | 1999-02-04 | The New York Blood Center, Inc. | Method for purifying viral nucleic acids |
WO1999006587A2 (en) | 1997-08-01 | 1999-02-11 | Morphosys Ag | Novel method and phage for the identification of nucleic acid sequences encoding members of a multimeric (poly)peptide complex |
US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US5958872A (en) | 1996-04-01 | 1999-09-28 | Apoptosis Technology, Inc. | Active survival domains of IGF-IR and methods of use |
US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
US6333410B1 (en) | 2000-08-18 | 2001-12-25 | Immunogen, Inc. | Process for the preparation and purification of thiol-containing maytansinoids |
US6340701B1 (en) | 1999-11-24 | 2002-01-22 | Immunogen Inc | Cytotoxic agents comprising taxanes and their therapeutic use |
US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
US20020197266A1 (en) | 2000-02-08 | 2002-12-26 | Waldemar Debinski | Immunotherapy using interleukin 13 receptor subunit alpha 2 |
US6534660B1 (en) | 2002-04-05 | 2003-03-18 | Immunogen, Inc. | CC-1065 analog synthesis |
US6596757B1 (en) | 2002-05-14 | 2003-07-22 | Immunogen Inc. | Cytotoxic agents comprising polyethylene glycol-containing taxanes and their therapeutic use |
US6596743B2 (en) | 1999-04-20 | 2003-07-22 | Hoffmann-La Roche Inc. | Carbamic acid derivatives |
US6630579B2 (en) | 1999-12-29 | 2003-10-07 | Immunogen Inc. | Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use |
US6716821B2 (en) | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
US6756397B2 (en) | 2002-04-05 | 2004-06-29 | Immunogen, Inc. | Prodrugs of CC-1065 analogs |
US6780327B1 (en) | 1999-02-25 | 2004-08-24 | Pall Corporation | Positively charged membrane |
US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
US20060127407A1 (en) | 2004-12-09 | 2006-06-15 | Qiming Chen | Anti-integrin immunoconjugates, methods and uses |
US20060182750A1 (en) | 2005-02-11 | 2006-08-17 | Immunogen, Inc. | Process for preparing stable drug conjugates |
US20070183971A1 (en) | 2004-08-30 | 2007-08-09 | Biotest Ag | Immunoconjugates targeting syndecan-1 expressing cells and use thereof |
US20080050310A1 (en) | 2006-05-30 | 2008-02-28 | Genentech, Inc. | Antibodies and immunoconjugates and uses therefor |
WO2008047242A2 (en) | 2006-10-19 | 2008-04-24 | Sanofi-Aventis | Novel anti-cd38 antibodies for the treatment of cancer |
WO2008057683A2 (en) * | 2006-10-03 | 2008-05-15 | Novo Nordisk A/S | Methods for the purification of polypeptide conjugates |
US7374762B2 (en) | 2003-05-14 | 2008-05-20 | Immunogen, Inc. | Drug conjugate composition |
US7390898B2 (en) | 2002-08-02 | 2008-06-24 | Immunogen Inc. | Cytotoxic agents containing novel potent taxanes and their therapeutic use |
US20090156790A1 (en) | 2003-06-27 | 2009-06-18 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US20090274713A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen Inc. | Cross-linkers and their uses |
US20100047257A1 (en) * | 2006-07-18 | 2010-02-25 | Sanofi-Aventis | Antagonist antibody for the treatment of cancer |
US20100093980A1 (en) | 2005-03-04 | 2010-04-15 | Biogen Idec Ma Inc. | Methods of Humanizing Immunoglobulin Variable Regions Through Rational Modification Of Complementarity Determining Residues |
US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
US7811572B2 (en) | 2005-08-24 | 2010-10-12 | Immunogen, Inc. | Process for preparing purified drug conjugates |
WO2010124797A1 (en) | 2009-04-29 | 2010-11-04 | Bayer Schering Pharma Aktiengesellschaft | Anti-mesothelin immunoconjugates and uses therefor |
US20110003969A1 (en) | 2009-06-03 | 2011-01-06 | Immunogen Inc. | Conjugation methods |
WO2011039721A1 (en) | 2009-10-02 | 2011-04-07 | Sanofi-Aventis | New maytansinoids and the use of said maytansinoids to prepare conjugates with an antibody |
WO2011039724A1 (en) | 2009-10-02 | 2011-04-07 | Sanofi-Aventis | Antibodies that specifically bind to the epha2 receptor |
US7982024B2 (en) | 2001-01-05 | 2011-07-19 | Amgen Fremont Inc. | Antibodies to insulin-like growth factor I receptor |
WO2011106528A1 (en) | 2010-02-24 | 2011-09-01 | Immunogen, Inc. | Folate receptor 1 antibodies and immunoconjugates and uses thereof |
US20110256153A1 (en) | 2010-03-12 | 2011-10-20 | Jutta Deckert | CD37-Binding Molecules and Immunoconjugates Thereof |
WO2012019024A2 (en) | 2010-08-04 | 2012-02-09 | Immunogen, Inc. | Her3-binding molecules and immunoconjugates thereof |
WO2012058592A2 (en) | 2010-10-29 | 2012-05-03 | Immunogen, Inc. | Non-antagonistic egfr-binding molecules and immunoconjugates thereof |
WO2012058588A2 (en) | 2010-10-29 | 2012-05-03 | Immunogen, Inc. | Novel egfr-binding molecules and immunoconjugates thereof |
US20120253021A1 (en) | 2011-03-29 | 2012-10-04 | Immunogen, Inc. | Preparation of maytansinoid antibody conjugates by a one-step process |
WO2012135517A2 (en) | 2011-03-29 | 2012-10-04 | Immunogen, Inc. | Preparation of maytansinoid antibody conjugates by a one-step process |
Family Cites Families (99)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
SE430062B (sv) | 1977-03-04 | 1983-10-17 | Pharmacia Fine Chemicals Ab | Kopplings- eller tioleringsreagens |
US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
US4664911A (en) | 1983-06-21 | 1987-05-12 | Board Of Regents, University Of Texas System | Immunotoxin conjugates employing toxin B chain moieties |
DE3584012D1 (de) | 1985-01-22 | 1991-10-10 | Saint Gobain Vitrage | Verfahren zur herstellung eines pulvers auf basis von indium-formiat zur herstellung einer duennen beschichtung auf einem substrat, insbesondere auf glas. |
GB8600582D0 (en) | 1986-01-10 | 1986-02-19 | Ca Minister Nat Defence | Purifying biological materials |
US4859449A (en) | 1987-09-14 | 1989-08-22 | Center For Molecular Medicine And Immunology | Modified antibodies for enhanced hepatocyte clearance |
US5241078A (en) | 1988-06-14 | 1993-08-31 | Cetus Oncology | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
US5024834A (en) | 1988-07-12 | 1991-06-18 | Cetus Corporation | Thioether linked immunotoxin conjugates |
CA2006408A1 (en) | 1988-12-27 | 1990-06-27 | Susumu Iwasa | Bispecific monoclonal antibody, its production and use |
US5714149A (en) | 1989-02-10 | 1998-02-03 | Celltech Therapeutics Limited | Crosslinked antibodies and processes for their preparation |
CA2026147C (en) | 1989-10-25 | 2006-02-07 | Ravi J. Chari | Cytotoxic agents comprising maytansinoids and their therapeutic use |
US6316003B1 (en) | 1989-12-21 | 2001-11-13 | Whitehead Institute For Biomedical Research | Tat-derived transport polypeptides |
US5137877B1 (en) | 1990-05-14 | 1996-01-30 | Bristol Myers Squibb Co | Bifunctional linking compounds conjugates and methods for their production |
CA2048078A1 (en) | 1990-11-15 | 1992-05-16 | Wolfgang A. Wrasidlo | Chemical modification of antibodies for creation of immunoconjugates |
US5252714A (en) | 1990-11-28 | 1993-10-12 | The University Of Alabama In Huntsville | Preparation and use of polyethylene glycol propionaldehyde |
SE470006B (sv) | 1991-09-26 | 1993-10-25 | Corline Systems Ab | Nytt konjugat, dess framställning och användning samt substrat preparerat med konjugatet |
US5556623A (en) | 1993-03-30 | 1996-09-17 | Eli Lilly And Company | Antibody-drug conjugates |
IL111748A0 (en) | 1993-12-03 | 1995-01-24 | Zeneca Ltd | Proteins |
US5580853A (en) | 1994-03-22 | 1996-12-03 | New England Deaconess Hospital | Modified polypeptides with increased biological activity |
US5747446A (en) | 1994-03-22 | 1998-05-05 | Beth Israel Deaconess Medical Center | Modified polypeptides with increased biological activity |
US5919758A (en) | 1994-03-22 | 1999-07-06 | Beth Israel Deaconess Medical Center | Modified polypeptides with altered biological activity |
US5612474A (en) | 1994-06-30 | 1997-03-18 | Eli Lilly And Company | Acid labile immunoconjugate intermediates |
AU5908296A (en) | 1995-05-31 | 1996-12-24 | Fred Hutchinson Cancer Research Center | Compositions and methods for targeted delivery of effector m olecules |
WO1998026747A2 (en) | 1996-12-17 | 1998-06-25 | Terman David S | Superantigen based methods and compositions for treatment of diseases |
US6462070B1 (en) | 1997-03-06 | 2002-10-08 | The General Hospital Corporation | Photosensitizer conjugates for pathogen targeting |
US6371975B2 (en) | 1998-11-06 | 2002-04-16 | Neomend, Inc. | Compositions, systems, and methods for creating in situ, chemically cross-linked, mechanical barriers |
DE69827507T2 (de) | 1997-06-11 | 2006-03-09 | Borean Pharma A/S | Trimerisierendes modul |
US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
US5965714A (en) | 1997-10-02 | 1999-10-12 | Connaught Laboratories, Inc. | Method for the covalent attachment of polysaccharides to protein molecules |
CA2305599A1 (en) | 1997-10-03 | 1999-04-15 | Galenica Pharmaceuticals, Inc. | Imine-forming polysaccharides, preparation thereof and the use thereof as adjuvants and immunostimulants |
US6121236A (en) | 1998-03-24 | 2000-09-19 | The Children's Medical Center Corporation | Multivalent ligands which modulate angiogenesis |
JP2002513028A (ja) | 1998-04-28 | 2002-05-08 | ガレニカ ファーマシューティカルズ, インコーポレイテッド | ポリサッカリド抗原結合体 |
US5981564A (en) | 1998-07-01 | 1999-11-09 | Universite Laval | Water-soluble derivatives of paclitaxel, method for producing same and uses thereof |
CA2331789C (en) | 1998-07-13 | 2013-09-10 | Board Of Regents, The University Of Texas System | Cancer treatment methods using therapeutic conjugates that bind to aminophospholipids |
AUPQ014799A0 (en) | 1999-05-04 | 1999-05-27 | Access Pharmaceuticals Australia Pty Limited | Amplification of folate-mediated targeting to tumor cells using polymers |
EP2266607A3 (en) | 1999-10-01 | 2011-04-20 | Immunogen, Inc. | Immunoconjugates for treating cancer |
US6632979B2 (en) | 2000-03-16 | 2003-10-14 | Genentech, Inc. | Rodent HER2 tumor model |
US7097840B2 (en) | 2000-03-16 | 2006-08-29 | Genentech, Inc. | Methods of treatment using anti-ErbB antibody-maytansinoid conjugates |
US6596503B1 (en) | 2000-08-18 | 2003-07-22 | East Carolina University | Monoclonal antibody DS6, tumor-associated antigen CA6, and methods of use thereof |
US20060062786A1 (en) | 2000-11-08 | 2006-03-23 | Human Genome Sciences, Inc. | Antibodies that immunospecifically bind to TRAIL receptors |
KR20030091978A (ko) | 2001-01-29 | 2003-12-03 | 아이덱 파마슈티칼즈 코포레이션 | 변형된 항체 및 사용 방법 |
US6875886B2 (en) | 2001-02-07 | 2005-04-05 | Beth Israel Deaconess Medical Center, Inc. | Modified PSMA ligands and uses related thereto |
EP1610751A4 (en) | 2001-04-26 | 2006-05-24 | Univ Texas | THERAPEUTIC AGENT / LIGAND CONJUGATE COMPOSITIONS, ITS SYNTHESIS PROCESSES AND ITS APPLICATION |
KR100863624B1 (ko) | 2001-05-11 | 2008-10-15 | 보드 오브 리전츠, 더 유니버시티 오브 텍사스 시스템 | Cd26을 발현하는 세포와 연관된 질환의 치료제로사용되는 항-cd26 단클론항체 |
EP1258255A1 (en) | 2001-05-18 | 2002-11-20 | Boehringer Ingelheim International GmbH | Conjugates of an antibody to CD44 and a maytansinoid |
EP1392360B1 (en) | 2001-06-01 | 2011-11-30 | Cornell Research Foundation, Inc. | Modified antibodies to prostate-specific membrane antigen and uses thereof |
US6576802B2 (en) | 2001-06-04 | 2003-06-10 | Shell Oil Company | One-step production of 1, 3-propanediol from ethylene oxide and syngas with a catalyst with a phospholanoalkane ligand |
EP1455817B1 (en) | 2001-12-11 | 2008-12-31 | Merck & Co., Inc. | Staphylococcus aureus exopolysaccharide and process |
JP2005532258A (ja) | 2002-01-03 | 2005-10-27 | スミスクライン・ビーチャム・コーポレイション | 免疫コンジュゲートの調製方法 |
US8877901B2 (en) | 2002-12-13 | 2014-11-04 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US7591994B2 (en) | 2002-12-13 | 2009-09-22 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
ES2545067T3 (es) | 2002-04-26 | 2015-09-08 | Genentech, Inc. | Purificación de proteínas basada en la no afinidad |
CA2483552A1 (en) | 2002-05-02 | 2003-11-13 | Wyeth Holdings Corporation | Calicheamicin derivative-carrier conjugates |
US20090068178A1 (en) | 2002-05-08 | 2009-03-12 | Genentech, Inc. | Compositions and Methods for the Treatment of Tumor of Hematopoietic Origin |
WO2005117986A2 (en) | 2004-06-01 | 2005-12-15 | Genentech, Inc. | Antibody drug conjugates and methods |
EP1551875A4 (en) | 2002-06-21 | 2006-06-28 | Biogen Idec Inc | TAMPON PREPARATIONS FOR CONCENTRATING ANTIBODIES AND METHODS FOR USE THEREOF |
EP1542723B1 (en) | 2002-08-16 | 2011-02-23 | ImmunoGen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
US7538092B2 (en) | 2002-10-08 | 2009-05-26 | Fresenius Kabi Deutschland Gmbh | Pharmaceutically active oligosaccharide conjugates |
ES2368215T3 (es) | 2002-10-30 | 2011-11-15 | Nuevolution A/S | Codificación enzimática. |
SI1578446T1 (sl) | 2002-11-07 | 2015-07-31 | Immunogen, Inc. | Protitelesa proti-cd33 in metoda za zdravljenje akutne mieloidne levkemije z uporabo istega |
US7276497B2 (en) | 2003-05-20 | 2007-10-02 | Immunogen Inc. | Cytotoxic agents comprising new maytansinoids |
MXPA05011811A (es) | 2003-05-20 | 2006-02-17 | Immunogen Inc | Agentes citotoxicos mejorados que comprenden nuevos maitansinoides. |
WO2005002597A1 (en) | 2003-07-02 | 2005-01-13 | Polycord, Inc. | Method for delivering polymerized therapeutic agent compositions and compositions thereof |
CN1878568A (zh) | 2003-11-05 | 2006-12-13 | 盘林京有限公司 | Cdim结合抗体的增强的b细胞细胞毒性 |
US20050175619A1 (en) | 2004-02-05 | 2005-08-11 | Robert Duffy | Methods of producing antibody conjugates |
US20110064754A1 (en) | 2005-03-03 | 2011-03-17 | Center For Molecular Medicine And Immunology | Immunoconjugates Comprising Poxvirus-Derived Peptides and Antibodies Against Antigen-Presenting Cells for Subunit-Based Poxvirus Vaccines |
EP1610818A4 (en) | 2004-03-03 | 2007-09-19 | Millennium Pharm Inc | MODIFIED ANTIBODIES AGAINST A PROSTATE-SPECIFIC MEMBRANE-ANTIGEN AND USE THEREOF |
US8470315B2 (en) | 2004-04-13 | 2013-06-25 | Quintessence Biosciences, Inc. | Non-natural ribonuclease conjugates as cytotoxic agents |
US20060073528A1 (en) | 2004-05-14 | 2006-04-06 | Jean-Michel Lecerf | Measurement methods |
RU2402548C2 (ru) | 2004-05-19 | 2010-10-27 | Медарекс, Инк. | Химические линкеры и их конъюгаты |
JP4806680B2 (ja) | 2004-05-19 | 2011-11-02 | メダレックス インコーポレイテッド | 自己犠牲リンカー及び薬剤複合体 |
TW200630106A (en) | 2004-10-08 | 2006-09-01 | Wyeth Corp | Immunotherapy of autoimmune disorders |
US20080305044A1 (en) | 2004-11-29 | 2008-12-11 | Seattle Genetics, Inc. | Engineered Antibodies and Immunoconjugates |
US7408030B2 (en) | 2005-01-13 | 2008-08-05 | North Carolina State University | Purification of immunoglobulins using affinity chromatography and peptide ligands |
US20110166319A1 (en) | 2005-02-11 | 2011-07-07 | Immunogen, Inc. | Process for preparing purified drug conjugates |
WO2006113623A2 (en) | 2005-04-15 | 2006-10-26 | Immunogen, Inc. | Elimination of heterogeneous or mixed cell population in tumors |
GB2427360A (en) | 2005-06-22 | 2006-12-27 | Complex Biosystems Gmbh | Aliphatic prodrug linker |
SI2233156T1 (sl) * | 2005-07-15 | 2013-09-30 | Angiochem Inc. | Uporaba polipeptidov aprotinina kot nosilce v farmacevtskih konjugatih |
NZ623901A (en) | 2005-08-03 | 2015-10-30 | Immunogen Inc | Immunoconjugate formulations |
JP2009508938A (ja) | 2005-09-22 | 2009-03-05 | ハダシット メディカル リサーチ サーヴィスィズ アンド ディベロップメント リミテッド | 治療上活性な化合物の結合体 |
AU2006294554B2 (en) | 2005-09-26 | 2013-03-21 | E. R. Squibb & Sons, L.L.C. | Antibody-drug conjugates and methods of use |
EP1959958A4 (en) | 2005-11-14 | 2010-07-14 | Univ Southern California | INTEGRIN-BINDING SMALL MOLECULES |
US7964415B2 (en) | 2006-04-26 | 2011-06-21 | Cardiogenics Inc. | Stable water-soluble polyethylenimine conjugates and methods of use thereof |
US20080213349A1 (en) | 2006-09-11 | 2008-09-04 | Deepak Ramesh Thakker | Liposome Complexes Containing Pharmaceutical Agents and Methods |
PL2019104T3 (pl) * | 2007-07-19 | 2014-03-31 | Sanofi Sa | Środki cytotoksyczne obejmujące nowe pochodne tomaymycyny i ich zastosowanie terapeutyczne |
GB0811743D0 (en) | 2008-06-26 | 2008-07-30 | Hemosol Biopharma Inc | Composition |
WO2010057160A1 (en) | 2008-11-17 | 2010-05-20 | Enzon Pharmaceuticals, Inc. | Releasable fusogenic lipids for nucleic acids delivery systems |
IL271761B (en) | 2009-02-05 | 2022-09-01 | Immunogen Inc | (12as)-8-methoxy-9-benzyloxy-11,12,12a,13-tetrahydro-6h-indolo[2,1-c][1,4]benzodiazepin-6-one, 4-benzyloxy-5-methoxy-2-nitrobenzoic acid and processes for preparing the same |
FR2947269B1 (fr) | 2009-06-29 | 2013-01-18 | Sanofi Aventis | Nouveaux composes anticancereux |
US20120149732A1 (en) | 2010-12-14 | 2012-06-14 | Alexander Chucholowski | Multifunctional linkers and methods for the use thereof |
MX343337B (es) | 2011-02-15 | 2016-11-01 | Immunogen Inc | Metodos de preparacion de conjugados. |
JP2014510757A (ja) | 2011-03-29 | 2014-05-01 | イムノゲン インコーポレーティッド | 均質性が改善された複合体を製造する工程 |
EA028805B1 (ru) | 2011-04-01 | 2018-01-31 | Иммьюноджен, Инк. | Способы повышения эффективности folr1 терапии рака |
US20130071482A1 (en) | 2011-09-20 | 2013-03-21 | The University Of Kentucky Research Foundation | Block copolymer cross-linked nanoassemblies as modular delivery vehicles |
HK1203364A1 (en) | 2011-12-13 | 2015-10-30 | Immunogen, Inc. | Use of n-hydroxysuccinimide to improve conjugate stability |
RU2661083C2 (ru) | 2012-10-04 | 2018-07-11 | Иммуноджен, Инк. | Использование пвдф-мембраны для очистки конъюгатов клеточно-связывающий агент - цитотоксический агент |
RU2015116883A (ru) * | 2012-10-04 | 2016-11-27 | Иммуноджен, Инк. | Применение ионообменной мембраны для удаления примесей из конъюгатов клеточносвязывающего агента с цитотоксическим агентом |
WO2014055842A1 (en) | 2012-10-04 | 2014-04-10 | Immunogen, Inc. | Process for preparing stable antibody maytansinoid conjugates |
WO2014086835A1 (en) | 2012-12-05 | 2014-06-12 | Ruprecht-Karls-Universität Heidelberg | Conjugates of proteins and multivalent cell-penetrating peptides and their uses |
-
2013
- 2013-10-04 RU RU2015116882A patent/RU2661083C2/ru not_active IP Right Cessation
- 2013-10-04 SG SG11201502429YA patent/SG11201502429YA/en unknown
- 2013-10-04 MX MX2015004257A patent/MX359599B/es active IP Right Grant
- 2013-10-04 HK HK16101357.7A patent/HK1213288A1/zh unknown
- 2013-10-04 RU RU2018122734A patent/RU2018122734A/ru not_active Application Discontinuation
- 2013-10-04 US US14/430,701 patent/US10035817B2/en not_active Expired - Fee Related
- 2013-10-04 NZ NZ707091A patent/NZ707091A/en not_active IP Right Cessation
- 2013-10-04 WO PCT/US2013/063480 patent/WO2014055877A1/en active Application Filing
- 2013-10-04 CN CN201810870142.1A patent/CN109200290A/zh active Pending
- 2013-10-04 IN IN3202DEN2015 patent/IN2015DN03202A/en unknown
- 2013-10-04 SG SG10201702737TA patent/SG10201702737TA/en unknown
- 2013-10-04 CN CN201380061552.7A patent/CN105209592A/zh active Pending
- 2013-10-04 JP JP2015535823A patent/JP6345181B2/ja active Active
- 2013-10-04 CA CA 2886993 patent/CA2886993A1/en not_active Abandoned
- 2013-10-04 EP EP13844268.6A patent/EP2904089A4/en not_active Withdrawn
- 2013-10-04 AU AU2013326881A patent/AU2013326881B2/en not_active Ceased
-
2015
- 2015-04-02 IL IL238110A patent/IL238110B/en active IP Right Grant
- 2015-04-30 ZA ZA201502992A patent/ZA201502992B/en unknown
-
2018
- 2018-05-22 JP JP2018097686A patent/JP2018158925A/ja active Pending
- 2018-06-29 US US16/023,005 patent/US20190031712A1/en not_active Abandoned
- 2018-10-03 AU AU2018241056A patent/AU2018241056A1/en not_active Abandoned
-
2019
- 2019-07-31 IL IL268378A patent/IL268378A/en unknown
-
2020
- 2020-02-07 JP JP2020019654A patent/JP2020079294A/ja active Pending
Patent Citations (93)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
US4361650A (en) | 1978-03-24 | 1982-11-30 | Takeda Chemical Industries, Ltd. | Fermentation process of preparing demethyl maytansinoids |
US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
US4563304A (en) | 1981-02-27 | 1986-01-07 | Pharmacia Fine Chemicals Ab | Pyridine compounds modifying proteins, polypeptides or polysaccharides |
US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
GB2188638A (en) | 1986-03-27 | 1987-10-07 | Gregory Paul Winter | Chimeric antibodies |
US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
EP0239400B1 (en) | 1986-03-27 | 1994-08-03 | Medical Research Council | Recombinant antibodies and methods for their production |
US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
US5416064A (en) | 1989-10-25 | 1995-05-16 | Immunogen, Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5552293A (en) | 1991-07-03 | 1996-09-03 | Pharmacia Aktiebolag | Tumor antigen specific antibody |
US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US5585499A (en) | 1992-03-25 | 1996-12-17 | Immunogen Inc. | Cyclopropylbenzindole-containing cytotoxic drugs |
US5846545A (en) | 1992-03-25 | 1998-12-08 | Immunogen, Inc. | Targeted delivery of cyclopropylbenzindole-containing cytotoxic drugs |
US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
US5958872A (en) | 1996-04-01 | 1999-09-28 | Apoptosis Technology, Inc. | Active survival domains of IGF-IR and methods of use |
WO1999005317A1 (en) * | 1997-07-28 | 1999-02-04 | The New York Blood Center, Inc. | Method for purifying viral nucleic acids |
WO1999006587A2 (en) | 1997-08-01 | 1999-02-11 | Morphosys Ag | Novel method and phage for the identification of nucleic acid sequences encoding members of a multimeric (poly)peptide complex |
US7396465B2 (en) | 1999-02-25 | 2008-07-08 | Pall Corporation | Positively charged membrane |
US7223341B2 (en) | 1999-02-25 | 2007-05-29 | Pall Corporation | Positively charged membrane |
US7094347B2 (en) | 1999-02-25 | 2006-08-22 | Pall Corporation | Positively charged membrane |
US6851561B2 (en) | 1999-02-25 | 2005-02-08 | Pall Corporation | Positively charged membrane |
US6780327B1 (en) | 1999-02-25 | 2004-08-24 | Pall Corporation | Positively charged membrane |
US6596743B2 (en) | 1999-04-20 | 2003-07-22 | Hoffmann-La Roche Inc. | Carbamic acid derivatives |
US6340701B1 (en) | 1999-11-24 | 2002-01-22 | Immunogen Inc | Cytotoxic agents comprising taxanes and their therapeutic use |
US6372738B2 (en) | 1999-11-24 | 2002-04-16 | Immunogen Inc. | Cytotoxic agents comprising taxanes and their therapeutic use |
US6436931B1 (en) | 1999-11-24 | 2002-08-20 | Immunogen Inc. | Cytotoxic agents comprising taxanes and their therapeutic use |
US6706708B2 (en) | 1999-11-24 | 2004-03-16 | Immunogen, Inc. | Cytotoxic agents comprising taxanes and their therapeutic use |
US6630579B2 (en) | 1999-12-29 | 2003-10-07 | Immunogen Inc. | Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use |
US20020197266A1 (en) | 2000-02-08 | 2002-12-26 | Waldemar Debinski | Immunotherapy using interleukin 13 receptor subunit alpha 2 |
US6333410B1 (en) | 2000-08-18 | 2001-12-25 | Immunogen, Inc. | Process for the preparation and purification of thiol-containing maytansinoids |
US7982024B2 (en) | 2001-01-05 | 2011-07-19 | Amgen Fremont Inc. | Antibodies to insulin-like growth factor I receptor |
US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
US6716821B2 (en) | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
US6756397B2 (en) | 2002-04-05 | 2004-06-29 | Immunogen, Inc. | Prodrugs of CC-1065 analogs |
US6586618B1 (en) | 2002-04-05 | 2003-07-01 | Immunogen Inc. | CC-1065 analog synthesis |
US6534660B1 (en) | 2002-04-05 | 2003-03-18 | Immunogen, Inc. | CC-1065 analog synthesis |
US7329760B2 (en) | 2002-04-05 | 2008-02-12 | Immunogen Inc. | CC-1065 analog synthesis |
US6596757B1 (en) | 2002-05-14 | 2003-07-22 | Immunogen Inc. | Cytotoxic agents comprising polyethylene glycol-containing taxanes and their therapeutic use |
US7390898B2 (en) | 2002-08-02 | 2008-06-24 | Immunogen Inc. | Cytotoxic agents containing novel potent taxanes and their therapeutic use |
US7374762B2 (en) | 2003-05-14 | 2008-05-20 | Immunogen, Inc. | Drug conjugate composition |
US20090240038A1 (en) | 2003-06-27 | 2009-09-24 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US7736644B2 (en) | 2003-06-27 | 2010-06-15 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US20100111979A1 (en) | 2003-06-27 | 2010-05-06 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US7628986B2 (en) | 2003-06-27 | 2009-12-08 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US20090175887A1 (en) | 2003-06-27 | 2009-07-09 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US20090155282A1 (en) | 2003-06-27 | 2009-06-18 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US20090156790A1 (en) | 2003-06-27 | 2009-06-18 | Amgen Fremont Inc. | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US20080145374A1 (en) | 2003-10-10 | 2008-06-19 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates and methods of making said conjugates |
US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
US20070183971A1 (en) | 2004-08-30 | 2007-08-09 | Biotest Ag | Immunoconjugates targeting syndecan-1 expressing cells and use thereof |
US20060127407A1 (en) | 2004-12-09 | 2006-06-15 | Qiming Chen | Anti-integrin immunoconjugates, methods and uses |
US20060182750A1 (en) | 2005-02-11 | 2006-08-17 | Immunogen, Inc. | Process for preparing stable drug conjugates |
US20100093980A1 (en) | 2005-03-04 | 2010-04-15 | Biogen Idec Ma Inc. | Methods of Humanizing Immunoglobulin Variable Regions Through Rational Modification Of Complementarity Determining Residues |
US7811572B2 (en) | 2005-08-24 | 2010-10-12 | Immunogen, Inc. | Process for preparing purified drug conjugates |
US20080050310A1 (en) | 2006-05-30 | 2008-02-28 | Genentech, Inc. | Antibodies and immunoconjugates and uses therefor |
US20100047257A1 (en) * | 2006-07-18 | 2010-02-25 | Sanofi-Aventis | Antagonist antibody for the treatment of cancer |
WO2008057683A2 (en) * | 2006-10-03 | 2008-05-15 | Novo Nordisk A/S | Methods for the purification of polypeptide conjugates |
WO2008047242A2 (en) | 2006-10-19 | 2008-04-24 | Sanofi-Aventis | Novel anti-cd38 antibodies for the treatment of cancer |
US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
US20090274713A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen Inc. | Cross-linkers and their uses |
WO2010124797A1 (en) | 2009-04-29 | 2010-11-04 | Bayer Schering Pharma Aktiengesellschaft | Anti-mesothelin immunoconjugates and uses therefor |
US20110003969A1 (en) | 2009-06-03 | 2011-01-06 | Immunogen Inc. | Conjugation methods |
WO2011039721A1 (en) | 2009-10-02 | 2011-04-07 | Sanofi-Aventis | New maytansinoids and the use of said maytansinoids to prepare conjugates with an antibody |
WO2011039724A1 (en) | 2009-10-02 | 2011-04-07 | Sanofi-Aventis | Antibodies that specifically bind to the epha2 receptor |
WO2011106528A1 (en) | 2010-02-24 | 2011-09-01 | Immunogen, Inc. | Folate receptor 1 antibodies and immunoconjugates and uses thereof |
US20120009181A1 (en) | 2010-02-24 | 2012-01-12 | Ab Olga | Folate Receptor 1 Antibodies and Immunoconjugates and Uses Thereof |
US20110256153A1 (en) | 2010-03-12 | 2011-10-20 | Jutta Deckert | CD37-Binding Molecules and Immunoconjugates Thereof |
WO2012019024A2 (en) | 2010-08-04 | 2012-02-09 | Immunogen, Inc. | Her3-binding molecules and immunoconjugates thereof |
WO2012058592A2 (en) | 2010-10-29 | 2012-05-03 | Immunogen, Inc. | Non-antagonistic egfr-binding molecules and immunoconjugates thereof |
WO2012058588A2 (en) | 2010-10-29 | 2012-05-03 | Immunogen, Inc. | Novel egfr-binding molecules and immunoconjugates thereof |
US20120253021A1 (en) | 2011-03-29 | 2012-10-04 | Immunogen, Inc. | Preparation of maytansinoid antibody conjugates by a one-step process |
WO2012135517A2 (en) | 2011-03-29 | 2012-10-04 | Immunogen, Inc. | Preparation of maytansinoid antibody conjugates by a one-step process |
WO2012135522A2 (en) | 2011-03-29 | 2012-10-04 | Immunogen, Inc. | Process for manufacturing conjugates of improved homogeneity |
Non-Patent Citations (37)
Title |
---|
"Antibodies: A Laboratory Manual", 1988, CSH PRESS |
"Immunobiology", 2001, GARLAND PUBLISHING |
"Molecular Cloning, A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
BHUYAN, CANCER RES., vol. 42, 1982, pages 3532 - 3537 |
BOGER ET AL., BIOORG. MED. CHEM. LETT., vol. 1, 1991, pages 115 - 120 |
BOGER ET AL., J. ORG. CHEM., vol. 55, 1990, pages 5823 - 5833 |
BURGESS, IMMUNOLOGY TODAY, vol. 5, 1984, pages 155 - 158 |
CARLSSON ET AL., BIOCHEM. J., vol. 173, 1978, pages 723 - 737 |
CARTER, NATURE REVS., vol. 6, 2006, pages 343 - 357 |
CASSIDY, P ET AL.: "Purification Of Staphylococcal Alpha-Toxin By Adsorption Chromatography On Glass.", INFECTION AND IMMUNITY., vol. 13, March 1976 (1976-03-01), pages 982 - 986, XP055184079 * |
CHARI ET AL., CANCER RES., vol. 55, 1995, pages 4079 - 4084 |
CHEMICAL ABSTRACTS, Columbus, Ohio, US; abstract no. 341498-08-6 |
DESMYTER ET AL., NATURE STRUCT. BIOL., vol. 3, 1996, pages 752 |
GREENBERG ET AL., NATURE, vol. 374, 1995, pages 168 |
GRIFFIN ET AL., LEUKEMIA RES., vol. 8, 1984, pages 521 |
HASKARD; ARCHER, J. IMMUNOL. METHODS, vol. 74, no. 2, 1984, pages 361 - 67 |
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 81 |
KAHN, D ET AL.: "Purification Of Plasmid DNA By Tangential Flow Filtration.", BIOTECHNOLOGY AND BIOENGINEERING., vol. 69, 15 May 2000 (2000-05-15), pages 100 - 106, XP002151908 * |
KIM ET AL., MOL. CANCER THER., vol. 7, 2008, pages 2486 - 2497 |
KOHLER; MILSTEIN, EUR. J. IMMUNOL., vol. 5, 1976, pages 511 - 519 |
LIU ET AL., CANCER RES., vol. 57, 1997, pages 3629 - 3634 |
NADLER ET AL., J. IMMUNOL., vol. 131, 1983, pages 244 - 250 |
NISONOFF ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 89, 1960, pages 230 - 244 |
O'KEEFE ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 932 - 937 |
PARHAM, J. IMMUNOL., vol. 131, 1983, pages 2895 - 2902 |
PEDERSEN ET AL., J. MOL. BIOL., vol. 235, 1994, pages 959 - 973 |
REITER ET AL., PROTEIN ENGINEERING, vol. 7, 1994, pages 697 - 704 |
RITZ ET AL., NATURE, vol. 283, 1980, pages 583 - 585 |
RODER ET AL., METHODS ENZYMOL., vol. 121, 1986, pages 140 - 67 |
ROGUSKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 969 - 73 |
SPRING ET AL., J. IMMUNOL., vol. 113, 1974, pages 470 - 478 |
STANFIELD ET AL., SCIENCE, vol. 305, 2004, pages 1770 - 1773 |
TAYLOR-PAPADIMITRIOU ET AL., INT. J. CANCER, vol. 28, 1981, pages 17 - 21 |
TROUET ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 626 - 629 |
UMEMOTO ET AL., INT. J. CANCER, vol. 43, 1989, pages 677 - 684 |
VAN HOF ET AL., CANCER RES., vol. 56, 1996, pages 5179 - 5185 |
WARPEHOSKI ET AL., J. MED. CHEM., vol. 31, 1988, pages 590 - 603 |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11040084B2 (en) * | 2014-04-29 | 2021-06-22 | Genequantum Healthcare (Suzhou) Co., Ltd. | Stable antibody-drug conjugate, preparation method therefor, and use thereof |
US11911435B2 (en) | 2014-04-29 | 2024-02-27 | Genequantum Healthcare (Suzhou) Co., Ltd. | Stable antibody-drug conjugate, preparation method therefor, and use thereof |
US11911434B2 (en) | 2014-04-29 | 2024-02-27 | Genequantum Healthcare (Suzhou) Co., Ltd. | Stable antibody-drug conjugate, preparation method therefor, and use thereof |
CN106999604A (zh) * | 2014-09-02 | 2017-08-01 | 伊缪诺金公司 | 用于配制抗体药物缀合物组合物的方法 |
US10603388B2 (en) | 2014-09-02 | 2020-03-31 | Immunogen, Inc. | Methods for formulating antibody drug conjugate compositions |
US11717576B2 (en) | 2021-03-08 | 2023-08-08 | Genequantum Healthcare (Suzhou) Co., Ltd. | Antibody-immune agonist conjugate and applications thereof |
WO2024193570A1 (en) * | 2023-03-21 | 2024-09-26 | Genequantum Healthcare (Suzhou) Co., Ltd. | Combination of antibody-drug conjugate and cancer therapy, and use thereof |
Also Published As
Publication number | Publication date |
---|---|
JP2016502501A (ja) | 2016-01-28 |
US20150225446A1 (en) | 2015-08-13 |
ZA201502992B (en) | 2019-10-30 |
CN109200290A (zh) | 2019-01-15 |
RU2015116882A (ru) | 2016-11-27 |
AU2013326881B2 (en) | 2018-08-02 |
IL268378A (en) | 2019-09-26 |
EP2904089A1 (en) | 2015-08-12 |
NZ707091A (en) | 2018-12-21 |
HK1213288A1 (zh) | 2016-06-30 |
IL238110A0 (en) | 2015-05-31 |
JP6345181B2 (ja) | 2018-06-20 |
AU2013326881A1 (en) | 2015-05-07 |
SG11201502429YA (en) | 2015-04-29 |
JP2018158925A (ja) | 2018-10-11 |
RU2018122734A (ru) | 2018-07-24 |
IL238110B (en) | 2019-08-29 |
JP2020079294A (ja) | 2020-05-28 |
MX2015004257A (es) | 2016-02-09 |
CN105209592A (zh) | 2015-12-30 |
SG10201702737TA (en) | 2017-05-30 |
EP2904089A4 (en) | 2016-05-25 |
CA2886993A1 (en) | 2014-04-10 |
AU2018241056A1 (en) | 2018-10-25 |
US10035817B2 (en) | 2018-07-31 |
MX359599B (es) | 2018-09-12 |
RU2661083C2 (ru) | 2018-07-11 |
IN2015DN03202A (GUID-C5D7CC26-194C-43D0-91A1-9AE8C70A9BFF.html) | 2015-10-02 |
US20190031712A1 (en) | 2019-01-31 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11744900B2 (en) | Preparation of maytansinoid antibody conjugates by a one-step process | |
US20190031712A1 (en) | Use of a PVDF membrane to purify cell-binding agent cytotoxic agent conjugates | |
AU2012236403B2 (en) | Process for manufacturing conjugates of improved homogeneity | |
US20150306242A1 (en) | Process for preparing stable antibody maytansinoid conjugates | |
WO2012135522A2 (en) | Process for manufacturing conjugates of improved homogeneity | |
EP2903450A1 (en) | Use of an ion exchange membrane to remove impurities from cell-binding agent cytotoxic agent conjugates | |
EP2790724A1 (en) | Use of n-hydroxysuccinimide to improve conjugate stability | |
NZ616516B2 (en) | Process for manufacturing conjugates of improved homogeneity | |
NZ616509B2 (en) | Preparation of maytansinoid antibody conjugates by a one-step process | |
NZ712414B2 (en) | Preparation of antibody maytansinoid conjugates |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WWE | Wipo information: entry into national phase |
Ref document number: 2013844268 Country of ref document: EP |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13844268 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 14430701 Country of ref document: US |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/004257 Country of ref document: MX |
|
ENP | Entry into the national phase |
Ref document number: 2886993 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 238110 Country of ref document: IL |
|
ENP | Entry into the national phase |
Ref document number: 2015535823 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015007358 Country of ref document: BR |
|
WWE | Wipo information: entry into national phase |
Ref document number: IDP00201502610 Country of ref document: ID |
|
ENP | Entry into the national phase |
Ref document number: 2015116882 Country of ref document: RU Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2013326881 Country of ref document: AU Date of ref document: 20131004 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 112015007358 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150401 |