WO2014038823A1 - Grim19를 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물 - Google Patents

Grim19를 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물 Download PDF

Info

Publication number
WO2014038823A1
WO2014038823A1 PCT/KR2013/007908 KR2013007908W WO2014038823A1 WO 2014038823 A1 WO2014038823 A1 WO 2014038823A1 KR 2013007908 W KR2013007908 W KR 2013007908W WO 2014038823 A1 WO2014038823 A1 WO 2014038823A1
Authority
WO
WIPO (PCT)
Prior art keywords
obesity
grim19
lipid
fat
protein
Prior art date
Application number
PCT/KR2013/007908
Other languages
English (en)
French (fr)
Inventor
조미라
전주연
이선영
문영미
유준걸
변재경
손혜진
김은경
양은지
정정희
Original Assignee
가톨릭대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 가톨릭대학교 산학협력단 filed Critical 가톨릭대학교 산학협력단
Priority to US14/426,324 priority Critical patent/US20150297676A1/en
Publication of WO2014038823A1 publication Critical patent/WO2014038823A1/ko

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A61K38/1761Apoptosis related proteins, e.g. Apoptotic protease-activating factor-1 (APAF-1), Bax, Bax-inhibitory protein(s)(BI; bax-I), Myeloid cell leukemia associated protein (MCL-1), Inhibitor of apoptosis [IAP] or Bcl-2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872Intracellular protein regulatory factors and their receptors, e.g. including ion channels
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/46Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
    • G01N2333/47Assays involving proteins of known structure or function as defined in the subgroups
    • G01N2333/4701Details
    • G01N2333/4703Regulators; Modulating activity
    • G01N2333/4704Inhibitors; Supressors
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/04Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value
    • G01N2500/10Screening for compounds of potential therapeutic value involving cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/04Endocrine or metabolic disorders
    • G01N2800/044Hyperlipemia or hypolipemia, e.g. dyslipidaemia, obesity

Definitions

  • the present invention relates to a composition for preventing or treating obesity or lipid-related metabolic diseases comprising Grim19 (gene associated with retinoid-IFN-induced mortality 19) protein as an active ingredient.
  • Grim19 gene associated with retinoid-IFN-induced mortality 19
  • Obesity may be determined as a representative of overweight, and may be specifically determined as an increase in body fat (eg, abdominal obesity) at a specific site. Obesity has a higher prevalence and mortality rate than other diseases, and a four-fold mortality rate from diabetes disease, a two-fold mortality rate from cirrhosis disease, and a mortality rate from cerebrovascular disease. Is reported to be 1.6 times higher and 1.8 times more likely to die from coronary artery disease.
  • Obesity is a serious chronic syndrome with a variety of causes characterized by excessive accumulation of fat.
  • Patients with abdominal obesity are often associated with pathological conditions such as X-syndrome (insulin resistance, type 2 diabetes, hypertension and lipid metabolism abnormalities) and are a strong risk factor for early atherosclerosis, ischemic heart disease and cerebrovascular disease. Works.
  • the cause of obesity is the genetic predisposition is known to more than 70% and other environmental factors such as ingestion of high-fat intake or lack of exercise, but the cause of obesity, the immune system has been considered recently.
  • T cells are one of a group of cells that play a central role in the immune system as a biological defense system against various pathogens. T cells are produced in the thymus of the human body and undergo a series of differentiation processes to differentiate into T cells with unique characteristics.T cells, which have completed differentiation, are largely divided into type 1 helper cells (Th1) and type 2 according to their function. It is divided into helper cells (Th2). Among them, the main function of Th1 cells is involved in cell-mediated immunity, Th2 cells are involved in humoral immunity, and in the immune system, these two cell populations are balanced with each other so as not to overactivate each other.
  • immune diseases may be due to an imbalance between these two immune cells. For example, abnormally increased activity of Th1 cells may cause autoimmune diseases, and abnormal activity of Th2 cells may increase. It is known that immune diseases occur due to hypersensitivity reactions.
  • Tregs immunoregulatory T cells
  • Th17 cells are known to be formed through a process similar to the differentiation of Treg cells during the differentiation of undifferentiated T cells. That is, differentiation of Treg cells and Th17 cells is performed in the presence of TGF- ⁇ in common but does not require IL-6 in Treg cells, whereas IL-6 is present in combination with TGF- ⁇ in Th17 cells. Differentiate in situations In addition, differentiated Th17 cells are characterized by the secretion of IL-17.
  • obesity treatments include fat absorption inhibitors such as Genuine of Roche, Switzerland, and appetite reducing agents such as Meridia of Abbott, USA. These drugs cause side effects such as headache, blood pressure rise and diarrhea. There is this.
  • the present inventors have found that Grim19 effectively prevents obesity or lipid-related metabolic diseases through weight loss, fat cell reduction, total cholesterol, glucose and LDL-cholesterol, and white fat to brown fat.
  • the present invention has been completed by confirming that it can be treated.
  • an object of the present invention is to provide a pharmaceutical composition for the prevention or treatment of obesity or lipid-related metabolic diseases comprising Grim19 protein as an active ingredient.
  • Another object of the present invention to provide a pharmaceutical composition for the prevention or treatment of obesity or lipid-related metabolic diseases comprising Grim19 protein or a polynucleotide encoding the protein as an active ingredient according to the present invention.
  • the present invention further provides a method for screening a therapeutic agent for obesity or lipid-related metabolic disease.
  • the present invention provides a pharmaceutical composition for the prevention or treatment of obesity or lipid-related metabolic diseases containing Grim19 protein as an active ingredient.
  • the disease may be diabetes, hyperlipidemia, arteriosclerosis, hypertension, cardiovascular disease, fatty liver, obesity-derived inflammatory disease, obesity-derived autoimmune disease, obesity-derived cancer disease.
  • the Grim19 protein may have an amino acid sequence represented by SEQ ID NO: 1.
  • Grim19 may have the effect of weight loss, fat cell reduction, decrease in the amount of total cholesterol in the body and the conversion of white fat to brown fat.
  • the present invention also provides a pharmaceutical composition for the prevention or treatment of obesity or lipid-related metabolic diseases comprising the Grim19 protein according to the present invention or a polynucleotide encoding the protein as an active ingredient.
  • the disease may be diabetes, hyperlipidemia, arteriosclerosis, hypertension, cardiovascular disease, fatty liver, obesity-induced inflammatory disease, obesity-induced autoimmune disease or obesity-induced cancer disease.
  • the polynucleotide may have a nucleotide sequence represented by SEQ ID NO: 2 or SEQ ID NO: 3.
  • the polynucleotide may be contained in an expression vector.
  • the expression vector may be a plasmid or viral vector.
  • the present invention comprises the steps of: (a) culturing a Grim19 protein or a recombinant cell and a candidate material expressing the protein; And (b) measuring the effect on the activity of Grim19 protein or an increase in intracellular levels.
  • the activity or intracellular level of the Grim19 protein is immunoprecipitation (coimmunoprecipitation), radioimmunoassay (RIA), enzyme immunoassay (ELISA), immunohistochemistry, Western Blotting Or by flow cytometry (FACS).
  • the present invention first identified that Grim19 protein has an effect of preventing or treating obesity or lipid-related metabolic diseases, and thus the present invention provides a pharmaceutical for the prevention or treatment of obesity or lipid-related metabolic diseases containing Grim19 protein as an active ingredient. It is characterized by providing a suitable composition.
  • the present inventors have focused on the Grim19 gene in order to develop a novel obesity inhibitor for the treatment of metabolic diseases.
  • the Grim19 gene has been identified as a gene associated with cell death, and recently through yeast-2-hybrid screening, it interacts with STAT3.
  • the cell death regulator Grim-19 is an inhibitor of signal transducer and activator of transcription 3.Proc Natl Acad Sci USA. 2003; 100: 93429347).
  • PIAS3 and suppressor of cytokine signaling 3 have been cited as inhibitory feedback of STAT3, and SOCS proteins have the activity of inhibiting ligand-induced responses by inhibiting JAKs,
  • the PIAS protein is known to have activity that inhibits the phosphorylation of STAT3 (Starr R, Hilton DJ. Negative regulation of the JAK / STAT pathway. Bioessays 1999; 21: 4752).
  • Grim19 is also known to play a role in inhibiting STAT3-induced transcription. Interestingly, Grim19, unlike SOCS3 and PIAS3, has been shown to not inhibit the phosphorylation of tyrosin and serine residues or interfere with DNA binding. (Chung CD, Liao J, Liu B, Rao X, Jay P, Berta P. Specific inhibition of Stat3 signal transduction by PIAS 3. Science. 1997; 278: 18031805). However, little is known about the relationship between Grim19 and obesity or lipid-related metabolic diseases and the mechanism of treatment.
  • the present invention first identified that Grim19 protein can be used for the prevention or treatment of obesity or lipid-related metabolic diseases.
  • white fat plays a role of storing excess energy as triglyceride in the body. Therefore, when excess energy occurs due to lack of exercise or overeating, the number of white fat cells increases and eventually obesity is induced to become fat. .
  • brown fat is not fat that affects weight gain and obesity because it plays a role in consuming heat stored energy.
  • Grim19 has the effect of reducing blood glucose, triglyceride, total cholesterol, AST and ALT levels, where AST and ALT are associated with obesity or lipids. In metabolic diseases, this level appears to be increased.
  • the present inventors conducted a flow cytometry (FACS) analysis of inflammatory cytokines and spleen confocal tissue staining in splenocytes of normal and fed Grim19 TG mice fed high fat diet to investigate the relationship between obesity and inflammatory response. It was found that the protein can regulate the inflammatory response by mediating STAT3 (see FIGS. 7A to 7G).
  • FACS flow cytometry
  • the Grim19 protein of the present invention has the effect of treating metabolic diseases, and can also prevent or treat obesity diseases caused by immunomodulatory disorders.
  • the present invention can provide a pharmaceutical composition for preventing or treating obesity or lipid-related metabolic diseases containing Grim19 protein as an active ingredient, wherein the Grim19 protein included in the pharmaceutical composition of the present invention is substantially equivalent to the protein. And proteins with physiological activity.
  • Grim19 proteins having substantially equivalent physiological activity include the protein and its functional equivalents and functional derivatives.
  • the term “functional equivalent” refers to an amino acid sequence variant in which some or all of the native protein amino acids are substituted, or a part of the amino acids are deleted or added, and have substantially the same physiological activity as the native Grim19 protein.
  • “Functional derivative” means a protein that has been modified to increase or decrease the physicochemical properties of the Grim19 protein, and which has a physiological activity substantially equivalent to that of the native Grim19 protein.
  • the Grim19 protein refers to a protein having an amino acid sequence represented by SEQ ID NO: 1.
  • the obesity refers to a state having excessive body fat, and when the body fat is 25% of the body weight of the male and the body weight of the body of 30% or more, clinically, when the BMI (Body Mass Index) is 30.1 or more In this case, it is defined as the case where the current weight exceeds 20% of the ideal weight.
  • causes of obesity include genetic factors, environmental factors, and abnormal energy metabolism. Obesity can be classified into simple obesity and symptomatic obesity depending on the cause. Simple obesity is caused by overeating and lack of exercise, and symptomatic obesity is caused by endocrine, hypothalamic, hereditary, frontal and metabolic.
  • the Grim19 protein of the present invention has an excellent effect of inhibiting the differentiation of cytotoxic Th17 cells that produce and secrete inflammatory cytokines, and has the characteristics of inhibiting the function of abnormally activated immune cells and controlling the inflammatory response.
  • Regulatory T cells are excellent in activating effect, and can regulate the inflammatory environment associated with obesity by mediating STAT3 can prevent or treat obesity caused by abnormal obesity as well as simple obesity and symptomatic obesity.
  • obesity is significantly larger in fat cells than normal weights, and the physiological and physical properties and characteristics of fat cells are different from those in normal weights.
  • causes over 50 kinds of inflammatory substances are secreted in fat cells due to the proliferation of giant macrophages, which causes various inflammatory reactions and metabolic syndrome in our bodies.
  • obesity-derived diseases that cause obesity include type 2 diabetes, osteoarthritis, nonalcoholic fatty liver disease, sleep apnea, pulmonary embolism, hypertension, asthma, infertility, cancer, and depression.
  • people who are obese have a 2 times higher risk of diabetes and 1.5 times more likely to develop high blood pressure.
  • Highly obese people have 5 times higher diabetes and 2.5 times higher blood pressure. The higher the obesity, the greater the risk of complications.
  • the fat ratio can be up to 400 times the size of fat cells, but if you touch the enlarged fat cells are not only large, but as a tangerine grain is not broken well.
  • Normal-sized fat cells are made up of 85% fat and 15% moisture, which is weak when pressed between your fingers and clumps up.
  • fat cells which have grown at high obesity, are not only firm on the surface but also hard to break.
  • macrophages in our body begin to move. Originally, macrophages continue to multiply to eat fat cells by deciding that abnormal changes in the body are good cells or fat cells that play a role in getting rid of bad germs when our bodies get sick. So it grows up to 400 times the same size as larger fat cells, and turns into macrophages.
  • the present invention is a pharmaceutical composition for the prevention or treatment of inflammatory diseases or autoimmune diseases induced by obesity Can be provided.
  • the term 'treatment' unless stated otherwise, reverses, alleviates, inhibits, or prevents the disease or condition to which the term applies, or one or more symptoms of the disease or condition, As used herein, the term 'treatment' refers to the act of treating when 'treating' is defined as above.
  • the pharmaceutical composition for preventing or treating obesity or lipid related metabolic disease according to the present invention may include a pharmaceutically effective amount of Grim19 protein alone or may include one or more pharmaceutically acceptable carriers, excipients or diluents.
  • the pharmaceutically effective amount herein refers to an amount sufficient to prevent, ameliorate and treat symptoms of obesity or lipid related metabolic disease.
  • the pharmaceutically effective amount of the Grim19 protein according to the present invention is 0.5-100 mg / day / kg, preferably 0.5-5 mg / day / kg.
  • the pharmaceutically effective amount may be appropriately changed depending on the degree of obesity or lipid-related metabolic disease symptoms, the age, weight, health condition, sex, route of administration and duration of treatment of the patient.
  • pharmaceutically acceptable refers to a composition that is physiologically acceptable and does not normally cause an allergic reaction, such as gastrointestinal disorders, dizziness, or the like when administered to a human.
  • carriers, excipients and diluents include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, Polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil.
  • fillers, anti-coagulants, lubricants, wetting agents, fragrances, emulsifiers and preservatives may be further included.
  • compositions of the present invention may be formulated using methods known in the art to provide rapid, sustained or delayed release of the active ingredient after administration to a mammal.
  • the formulations may be in the form of powders, granules, tablets, emulsions, syrups, aerosols, soft or hard gelatin capsules, sterile injectable solutions, sterile powders.
  • composition for the prevention or treatment of obesity or lipid-related metabolic diseases according to the present invention can be administered through various routes including oral, transdermal, subcutaneous, intravenous or intramuscular, the dosage of the active ingredient is determined by the route of administration, patient It may be appropriately selected according to various factors such as age, sex, weight and severity of the patient, and the composition for preventing or treating obesity or lipid-related metabolic disease according to the present invention prevents, improves the symptoms of obesity or lipid-related metabolic disease Or in combination with a known compound having a therapeutic effect.
  • the present invention can provide a pharmaceutical composition for the prevention or treatment of obesity or lipid-related metabolic diseases comprising a Grim19 protein or a polynucleotide encoding the protein as an active ingredient.
  • the polynucleotide encoding the Grim19 protein may include DNA or RNA, and preferably has a DNA sequence represented by SEQ ID NO: 2.
  • the polynucleotide is introduced into an expression vector, such as a plasmid or viral vector, by targeting known methods and then the expression vector is targeted to the phenotype by infection or transduction by various methods known in the art. It can be introduced into the cell.
  • an expression vector such as a plasmid or viral vector
  • Plasmid expression vectors are FDA's approved gene delivery methods for human use that deliver plasmid DNA directly to human cells (Nabel, E.G., et al., Science, 249: 1285-1288, 1990). Plasmid DNA has the advantage that it can be homogeneously purified unlike viral vectors.
  • mammalian expression plasmids known in the art can be used. For example, but not limited to, pRK5 (European Patent No. 307,247), pSV16B (International Patent Publication No. 91/08291), pVL1392 (PharMingen), and the like are representative.
  • Plasmid expression vectors comprising polynucleotides according to the present invention are methods known in the art, such as, but not limited to, transient transfection, microinjection, transduction Cell fusion, calcium phosphate precipitation, liposome-mediated transfection, DEAE Dextran-mediated transfection, polybrene-mediated transfection Can be introduced into cells by electroporation, gene guns and other known methods for introducing DNA into cells (Wu et al., J. Bio. Chem., 267: 963-967, 1992; Wu and Wu, J. Bio. Chem., 263: 14621-14624, 1988).
  • the vector capable of expressing Grim19 may be administered by a known method.
  • it may be administered topically, parenterally, orally, nasal, intravenously, intramuscularly, subcutaneously or by other suitable means.
  • the present invention can provide a medicament for the prevention or treatment of obesity or lipid-related metabolic diseases, including a composition comprising a Grim19 protein or an expression vector comprising the polynucleotide encoding the protein as an active ingredient, and further, the present invention.
  • the present invention may provide a composition for inhibiting obesity or lipid-related metabolic disease, which comprises a Grim19 protein or an expression vector including the polynucleotide encoding the protein as an active ingredient.
  • the present invention comprises the steps of: (a) culturing a Grim19 protein or a recombinant cell and a candidate material expressing the protein; And (b) measuring the effect of increasing the activity or intracellular levels of Grim19 protein, wherein the activity or intracellular level of Grim19 protein may be determined. It can be measured by immunoprecipitation, radioimmunoassay (RIA), enzyme immunoassay (ELISA), immunohistochemistry, Western blotting or flow cytometry (FACS).
  • RIA radioimmunoassay
  • ELISA enzyme immunoassay
  • FACS flow cytometry
  • the substance that can be a therapeutic agent for obesity or lipid-related metabolic diseases according to the present invention may be a substance that increases the activity or intracellular levels of Grim19 protein in the above method, wherein the increase in the intracellular level is expressed by Grim19 This increases or inhibits the degradation of Grim19 to increase the concentration of Grim19 protein.
  • the effect of reducing fat cells and total cholesterol content in the body was excellent, and the effect of inhibiting the differentiation of cytotoxic Th17 cells, which produce and secrete inflammatory cytokines, is excellent.
  • the inflammatory environment associated with the present invention can be used in the manufacture of therapeutic foods and functional foods that can effectively treat obesity or lipid-related metabolic diseases.
  • 1 is a group fed 60kcal high fat feed to Grim19 TG mice, a group fed 60kcal high fat feed to C57BL / 6 (H-2kb) mice as a control mouse, a group fed 16kcal general feed to experimental animals up to 10 weeks It is the result of measuring weight every week.
  • 2A and 2B show the results of observing the human body and the torso of the dead animals and the body weight of the dead animals on day 61 according to one embodiment of the present invention and measuring the body weight.
  • Figure 3 shows the results of hematoxylin and eosin staining and oil red O (Oil red O) staining with a frozen section (7 ⁇ m) obtained in the liver of a dead mouse according to an embodiment of the present invention.
  • 4a and 4b are the results of observing the shape and weight by cutting off the fat portion of the retroperitoneal and interscapular region of the experimental animal killed in accordance with an embodiment of the present invention.
  • Figure 5 shows the results obtained by measuring the weight of the white and brown fat separated from the normal scapula and the scapula region of the normal diet control and Grim19 TG mouse according to an embodiment of the present invention.
  • 6A and 6B are graphs of glucose, triglycerides, total cholesterol, HDL-cholesterol, LDL-cholesterol, AST, and ALT concentrations of three groups of animal serum according to one embodiment of the present invention.
  • Figure 7a shows the results of the flow cytometry (FACS) analysis of inflammatory cytokines in the spleen cells of Grim19 TG mice, WT mice fed a high fat diet and normal WT mice.
  • FACS flow cytometry
  • 7B to 7F are photographs and graphs showing the results of confocal tissue staining of spleen cells of Grim19 TG mice, WT mice fed high-fat feed, and normal WT mice.
  • Figure 7g shows the results confirmed by Western blotting analysis of phosphorylation changes of STAT3 by Grim19 in accordance with an embodiment of the present invention.
  • Figure 9 is a hematoxylin and eosin stained pictures showing the effect of Grim19 on the fat cells in liver tissue when ingesting high fat feed, HFD shows high fat died (high fat died).
  • 10A is an oil red o staining photograph showing the effect of Grim19 on adipocyte differentiation.
  • 10B to 10E are graphs showing expression levels of white fat and brown fat related genes in cells transformed with Grim19.
  • 11A and 11B are graphs showing changes in brown fat gene expression in mice transformed with Grim19 in cold stress.
  • the present inventors first constructed a Grim19 overexpression vector so that the Grim19 protein could be overexpressed.
  • Grim19 cDNA was synthesized by codon optimization with codons that are well expressed in mammals (see Table 1) (TOPgenetech, Canada), and cut with restriction enzymes BamH1 and Xho1 and inserted into pcDNA3.1 + (promega) to obtain Grim19 cDNA. Inserted recombinant vector pcDNA3.1 + Grim19 was made, and E. coli was transformed with the recombinant vector, and plasmid DNA was obtained by plasmid extraction kit (Qiagan).
  • the overexpression of Grim19 was confirmed by Western blot, and the Grim19 overexpression vector was transferred to macrogen to request TG mice.
  • the TG production process in Macrogen was performed by first moving Grim19 cDNA to TG vector to make an expression vector, zygote from the oviduct of female mouse that induced hyperovulation by PMSG and hCG hormone injection, and microinjecting Grim19 DNA solution under microscope. (microinjection) and survivors were screened and transplanted into surrogate mother's fallopian tubes to deliver. After 2 weeks, the mice were cut off their tails to extract genomic DNA to confirm the insertion of genes, and to confirm germline transmission by PCR through genomic DNA, the transgenic Grim19 mice were maintained.
  • transgenic Grim19 TG mice and normal mice were fed with a high fat feed of 60 kcal, and the other normal mice (C57BL / 6 (H-2kb)) were fed with a normal feed of 16 kcal.
  • Ingestion was performed and the following experiments were conducted with these three groups.
  • Example 1 The animal models of the three groups performed in Example 1 were sacrificed on day 61, when the obesity index was significantly different, and the size of the torso and liver of the sacrificed mice were visually observed.
  • the body size of the mice fed a high-fat feed was observed to be about 1.5 times larger than the mice fed a normal feed, the liver also appears to be yellow as fat accumulation of fat.
  • the liver also appears to be yellow as fat accumulation of fat.
  • Grim19 TG mice fed a high-fat obese diet showed similar body size and shape and color of liver tissue as the mice fed the normal diet.
  • Example ⁇ 2-1> After removing the tissue from each group of mouse liver used in the experiment of Example ⁇ 2-1> and freezing section (7 ⁇ m), the section was stained with hematoxylin and eogene and oil red o O) staining was performed to observe the adipocytes.
  • mice fed the high fat diet were significantly increased and the fat cells were larger than the mice fed the normal diet (normal mice), whereas the Grim19 TG mice fed the high fat obese diet were significantly different from those of the normal mice. It appeared to show almost similar fat cells (FIG. 3).
  • mice fed the high-fat feed was found to increase the fat in the region between the posterior peritoneum and the scapula more than three times compared to the mice fed the normal feed.
  • Grim19 TG mice that had been fed a high fat diet were shown to have a similar fat band (FAT PAD) as normal diet mice.
  • the present inventors have found that the Grim19 of the present invention can effectively suppress obesity due to high fat intake through the histological observation and analysis.
  • the present inventors have been found that the Grim19 of the present invention has the effect of preventing and inhibiting obesity through the above experiments, and furthermore, experiments to determine how Grim19 affects the formation of white fat and brown fat in vivo Was performed.
  • white fat stores excess energy as triglyceride in the body. Therefore, when excess energy occurs due to lack of exercise or overeating, the number of white fat cells increases and eventually obesity is induced to make fat. do.
  • brown fat is not fat that affects weight gain and obesity because it plays a role in consuming heat stored energy.
  • the present inventors examined 10 weeks in a group in which Grim19 TG mice were fed normal normal feed and a group in which normal mice were not transformed normal diet. After breeding, they were killed and mice were dissected to analyze the degree of accumulation and specific gravity (weight) of brown and white fat.
  • mice of each group used in the experiments of Example ⁇ 2-1> were anesthetized with isoflurane and blood was collected from the heart. The collected blood was centrifuged in a centrifuge tube and centrifuged at 3000 rpm for 20 minutes to separate serum and frozen at -70 °C until analysis.
  • glucose, triglyceride, total cholesterol, HDL-cholesterol, LDL-cholesterol, AST, ALT concentration contained in serum was analyzed using an automatic analyzer (Kuadro, Italy).
  • the present inventors performed flow cytometry (FACS) analysis of inflammatory cytokines in splenocytes of WT mice and Grim19 TG mice fed high fat diet to investigate the relationship between obesity and inflammatory response.
  • FACS flow cytometry
  • T helper cell (TH2) and Treg cells associated with the anti-inflammatory response were significantly increased in the Grim19 TG mouse group (FIG. 7A).
  • splenic confocal tissue staining of Grim19 of the present invention inhibited Th17 cells, a disease associated with the inflammatory response, inhibited the expression of p-STAT 727, 705, and the activity of Regulatory T cells (Treg) It was found that palpation or increase and expression of p-STAT5 was increased (FIGS. 7B-7F).
  • the Grim19 protein of the present invention is a molecule capable of inhibiting STAT3 and is known to be particularly involved in the regulation of p-STAT3 727.
  • STAT3 activity was observed in Grim19 TG mice, indicating that p-STAT3 was significantly inhibited in Grim19 TG mice compared to control WT mice. This phenomenon was observed in Grim19 TG mice fed obese diets. It could be seen that the same appears (Fig. 7g).
  • the Grim19 protein of the present invention is thought to be able to modulate the inflammatory response by STAT3.
  • the present inventors have shown that the Grim19 protein according to the present invention has an excellent effect on reducing fat cells and reducing total cholesterol content in the body.
  • Grim19 is a lipid such as obesity and hyperlipidemia. It can be seen that it can be used for the prevention and treatment of related metabolic diseases.
  • Grim19 has an excellent effect of inhibiting the differentiation of cytotoxic Th17 cells that produce and secrete inflammatory cytokines, and Grim19 can prevent and treat obesity through the effect of Grim19 modulating the inflammatory response mediated by STAT3. I could see that.
  • C57BL / 6 (H-2kb) Grim19 TG mice fed 60Kcal high fat or 16Kcal normal feed and control mice
  • C57BL / Liver tissues were obtained from each mouse fed a high fat diet of 60 Kcal and a normal diet of 16 Kcal at 6 (H-2 kb) and examined by electron microscopy.
  • C57BL / 6 (H-2kb) Grim19 TG mice were fed 60Kcal high fat or 16Kcal normal feed and control mice C57BL / Abdominal fat was taken from each mouse fed 6 (H-2kb) 60 Kcal high fat diet and 16 Kcal normal feed and then made into paraffin blocks.
  • the paraffin block was cut into 7 ⁇ m thick sections, and hematoxylin and eosin staining were performed in the same manner as in Example ⁇ 2-2>.
  • the cells incubated in 24-well were subjected to oil red o staining as it is.
  • the cells were immersed in 10% formalin for about 30 minutes and washed with tertiary distilled water. After the pretreatment with 60% isopropanol and reacted with oil red o for about 5 minutes, washed again with tertiary distilled water, counter staining with hematoxylin and observed under a microscope.
  • RT-PCR was carried out using an ABI PCR apparatus with a LightCycler FastStart DNAmaster SYBR green I (Takara) fluorescent dye, and the reaction compound for this was 1 ⁇ l of 1 ⁇ g diluted cDNA synthesized in 1 ⁇ g, LightCycler FastStart DNAmaster 10 ⁇ l of SYBR green I (Takara) and 1 ⁇ l of Taqman probe (Applied biosystems) were mixed and used to make 20 ⁇ l of the final volume with distilled water. Reaction conditions were made 50 reactions in total at 95 degreeC 10 second and 60 degreeC 30 second.
  • Cycle threshold (Ct) values were analyzed to express the mRNA expression levels of C / EBP-a, Agt, aP2, Pank3, Adiponectin, Resistin, LPL, and Leptin as relative quantification with mRNA expression of ⁇ -actin, a house keeping gene. It was.
  • the primer used in the RT-PCR is C / EBP-a (Forward: 5'-CAA GAA CAG CAA CGA GTA CCG-3 '(SEQ ID NO: 4), Reverse: 5'-GTC ACT GGT CAA CTC CAG CAC-3' , (SEQ ID NO: 5)), Agt (Forward: 5'-GCA CCC TGG TCT CTT TCT ACC-3 '(SEQ ID NO: 6), Reverse: 5'-TGT GTC CAT CTA GTC GGG AGG-3' (SEQ ID NO: 7) )), aP2 (Forward: 5'-GAT GCC TTT GTG GGA ACC T-3 '(SEQ ID NO: 8), Reverse: 5'-CTG TCG TCT GCG GTG ATT T-3' (SEQ ID NO: 9)), PANK3 ( Forward: 5'-TGC TCT AGT GTC CCA TTT CTG CCT-3 '(SEQ ID NO: 10), Reverse: 5
  • RT-PCR was carried out using an ABI PCR apparatus with a LightCycler FastStart DNAmaster SYBR green I (Takara) fluorescent dye, and the reaction compound for this was 1 ⁇ l of 1 ⁇ g diluted cDNA synthesized in 1 ⁇ g, LightCycler FastStart DNAmaster 10 ⁇ l of SYBR green I (Takara) and 1 ⁇ l of Taqman probe (Applied biosystems) were mixed and used to make 20 ⁇ l of the final volume with distilled water. Reaction conditions were made 50 reactions in total at 95 degreeC 10 second and 60 degreeC 30 second.
  • the Ct values were analyzed and expressed as the expression level of mRNA of UCP1, Elvol3, PGC1a, Fgf21, Cidea, Cox7a1, PRDM16, and Cytochrom C1, relative to the mRNA expression of ⁇ -actin, a house keeping gene.
  • the primer used in the RT-PCR is UCP1 (Forward: 5'-CTT TGC CTC ACT CAG GAT TGG-3 '(SEQ ID NO: 20), Reverse: 5'-ACT GCC ACA CCT CCA GTC ATT-3' (SEQ ID NO: 21) )), Elvol3 (Forward: 5'-CGG GTT AAA AAT GGA CCT GA-3 '(SEQ ID NO: 22), Reverse: 5'-CCA ACA ACG ATG AGC AAC AG-3' (SEQ ID NO: 23)), PGC1 ⁇ ( Forward: 5'-GTC AAC AGC AAA AGC CAC AA-3 '(SEQ ID NO: 24), Reverse: 5'-TCT GGG GTC AGA GGA AGA GA-3' (SEQ ID NO: 25)), FGF21 (Forward: 5'- CCT CTA GGT TTC TTT GCC AAC AG-3 '(SEQ ID NO: 26), Reverse: 5'-AAG CTG CAG GCC
  • Atherosclerosis begins in the formation of artherosclerotic plaques as macrophages are activated into foam cells by lipids oxidized by ROS (Reactive Oxygen Species) present in the vessel wall.
  • THP1 cells which are macrophage cell lines, progenitor cells of atherosclerotic plaques that induce atherosclerosis, were cultured in 48-well plates at 2 ⁇ 10 5 for 24 hours, and then treated with PMA 160 nM to activate the cells. After 24 hours, PAF was transfected with 10 ⁇ g / ml to form atherosclerotic plaque progenitor cells, which were transformed to overexpress Grim19. After incubation for 24 hours, oil red o staining was performed. At this time, the cells expressing red after oil red o staining are cells in which foam cells are formed.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Hematology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Physics & Mathematics (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Pathology (AREA)
  • Biotechnology (AREA)
  • Oncology (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Diabetes (AREA)
  • Obesity (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)

Abstract

본 발명은 Grim19 단백질을 유효성분으로 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물에 관한 것으로, 특히 면역반응의 이상 또는 유전적, 대사적, 환경적 복잡한 요인의 상호작용에 의해 유발되는 대사성 질환을 예방 또는 치료할 수 있는 Grim19 단백질을 유효성분으로 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물에 관한 것이다. 본 발명에 따른 상기 Grim19 단백질의 경우, 지방세포 감소효과 및 체내 총 콜레스테롤 함량 감소 효과가 우수한 것으로 나타났으며 뿐만 아니라 염증성 사이토카인을 생성 및 분비하는 세포 독성 Th17 세포의 분화를 억제하는 효과가 우수하고, 비만과 관련된 염증 환경을 Grim19가 STAT3를 매개하여 염증반응을 조절하는 효과가 우수하다는 사실을 확인함으로써, 비만 또는 지질 관련 대사성 질환을 효과적으로 치료할 수 있는 치료제 및 기능성 식품의 제조에 사용될 수 있는 효과가 있다.

Description

Grim19를 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물
본 발명은 Grim19(gene associated with retinoid-IFN-induced mortality 19) 단백질을 유효성분으로 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물에 관한 것이다.
비만에 대한 늘어나는 경각심과 비만의 원인을 이해하고 이에 대응하고자 하는 전 지구적 노력에도 불구하고, 비만은 가속적으로 증가하는 추세이다(Mitchell et al., Implications for female fertility and obesity. Reproduction. 2005;130:583-97). 2007년 국민건강영양조사 결과에 의하면 최근 5년 동안 국내 비만 인구 비율이 해마다 3%씩 증가하여, 현재 비만자 비율이 전체인구 중 32.7%(남 33.1%, 여 32.2%)이며, 연령별로는 중장년층이 평균 44%로 청년층(22%)의 두 배나 되고, 비만으로 인한 질환이 늘어나면서 2007년 기준으로 사회경제적 비용은 1조8239억 원에 이르는 것으로 추정되고 있다.
비만 문제가 심각해짐에 따라 비만 자체가 곧 질병이라는 인식이 확산되고있다. 비만 진행 여부의 판단은 대표적으로 과체중 여부로 판단할 수 있으며, 구체적으로 특정 부위에서의 체지방의 증가(예를 들어, 복부 비만 등)로 판단할 수 있다. 비만으로 분류된 경우 즉, 비만자는 다른 질병에 비해 유병률과 사망률이 높고 정상체중을 가진 사람과 비교하여 당뇨병 질환으로 인한 사망률은 4배, 간경변증 질환으로 인한 사망률은 2배, 뇌혈관질환으로 인한 사망률은 1.6배 및 관상동맥질환으로 인한 사망률은 1.8배 정도 높은 것으로 보고되고 있다.
또한, 복부 비만은 동맥경화성 죽종형성(atheroma formation)의 원인으로 보고되었으며(Kunitomi M et al., Relationship between reduced serum IGF-I levels and accumulation of visceral fat in Japanese men. Int J Obes Relat Metab Disord. 2002;26:361-9), 기타 고혈압, 고지혈증, 면역체계의 이상 및 고인슐린증 등의 여러 질환의 원인으로 보고되고 있으며, 결과적으로 심혈관질환의 이환률(morbidity)과 사망률(mortality) 증가의 원인이 되는 것으로 보고되고 있다(Hida K, et al., Visceral adipose tissue-derived serine protease inhibitor: a unique insulin-sensitizing adipocytokine in obesity. Proc Natl Acad Sci USA. 2005;102:10610-5).
비만은 지방의 과다 축적으로 특징 지워지는 다양한 원인을 가진 심각한 만성 증후군이다. 비만 치료의 목표는 크게 두 가지로서, 첫 번째는 과량의 지방을 연소시켜 체중을 감소시키는 것이며, 두 번째는 대사성 불균형을 개선시키는 것이다. 복부 비만을 보이는 환자는 흔히 X-증후군(인슐린 저항성, 제 2형 당뇨병, 고혈압 및 지질대사 이상)과 같은 병적인 상태와 관련되어 있으며, 조기 동맥경화, 허혈성 심질환 및 뇌혈관 질환의 강력한 위험인자로 작용한다.
비만의 원인은 유전적인 소인이 70% 이상으로 알려져 있고 그 외 환경요인으로 고지방식의 섭취나 운동부족 등이 알려져 있지만 최근 비만의 원인으로 면역계의 이상도 고려되고 있다.
각종 병원체에 대한 생체 방어 시스템으로 면역계에서 중심적 역할을 담당하는 세포군의 하나로 T 세포가 있다. T 세포는 인체의 흉선에서 생성되며 일련의 분화 과정을 거치면서 고유의 특성을 지닌 T 세포로 분화하게 되는데, 분화를 완료한 T 세포는 그 기능에 따라 크게 1형 보조 세포(Th1)와 2형 보조 세포(Th2)로 구분된다. 이 중에서 Th1 세포의 주된 기능은 세포 매개성 면역에 관여하고, Th2 세포는 체액성 면역에 관여하며, 면역계에서 이러한 두 세포 집단은 서로 과활성화되지 않도록 서로 견제를 통해 면역계의 균형을 유지하고 있다.
따라서 면역질환의 대부분은 이러한 두 면역 세포간의 불균형에 기인하는 것으로 볼 수 있는데, 예를 들어 Th1 세포의 활성이 비정상적으로 증가하는 경우 자가면역질환이 발생할 수 있고, Th2 세포의 활성이 비정상적으로 증가하는 경우 과민반응에 의한 면역질환이 발생하는 것으로 알려져 있다.
한편, Th1 세포의 분화에 대한 최근 연구 결과에 따르면, Th1 세포의 활성을 조절할 수 있는 새로운 그룹인 면역조절 T 세포(Treg)의 존재가 알려지면서 이를 이용한 면역질환의 치료에 대한 연구가 대두되고 있는데, Treg 세포는 비정상적으로 활성화된 면역세포의 기능을 억제하여 염증 반응을 제어하는 특성이 있어, Treg 세포의 활성을 증가시키는 작용을 통해 면역질환을 치료하는 실험들이 많이 보고되고 있다.
또한, Treg 세포 이 외에 분화 과정에서 만들어지는 또 다른 그룹으로 Th17 세포가 있는데, Th17 세포는 미분화 T세포의 분화 과정에서 Treg 세포의 분화와 유사한 과정을 거치며 형성되는 것으로 알려져 있다. 즉, Treg 세포와 Th17 세포의 분화는 공통적으로 TGF-β의 존재 하에서 이루어지지만 Treg 세포의 경우 IL-6을 필요로 하지 않는 반면, Th17 세포의 경우에는 TGF-β와 함께 IL-6가 존재하는 상황에서 분화를 한다. 또한, 분화된 Th17 세포는 IL-17을 분비하는 것을 특징으로 한다.
한편, 현재 사용되고 있는 비만치료제로는 스위스 로슈의 제니칼과 같은 지방흡수 억제제와 미국 애보트의 메리디아와 같은 식욕감퇴제가 많이 사용되고 있는데, 이러한 약제들에서 두통, 혈압상승, 설사 등의 부작용이 발생하는 문제점이 있다.
따라서 부작용이 없고 저렴하면서도 치료 효과가 우수한 새로운 비만 치료제의 개발이 필요한 실정이다.
이에 본 발명자들은 Grim19가 체중 감소 효과, 지방세포 감소 효과, 체내 총 콜레스테롤, 글루코스 및 LDL-콜레스테롤을 감소시키는 효과 및 백색지방을 갈색지방으로 전환시키는 작용을 통해 비만 또는 지질 관련 대사성 질환을 효과적으로 예방 또는 치료할 수 있다는 사실을 확인함으로써 본 발명을 완성하였다.
따라서 본 발명의 목적은 Grim19 단백질을 유효성분으로 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명의 다른 목적은 본 발명에 따른 Grim19 단백질 또는 상기 단백질을 암호화하는 폴리뉴클레오티드를 유효성분으로 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
나아가 본 발명은 비만 또는 지질 관련 대사성 질환 치료제 스크리닝 방법을 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 Grim19 단백질을 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
본 발명의 한 구현예에 있어서, 상기 질환은 당뇨, 고지혈증, 동맥경화, 고혈압, 심혈관 질환, 지방간, 비만 유래 염증질환, 비만 유래 자가면역질환, 비만 유래 암 질환일 수 있다.
본 발명의 한 구현예에 있어서, 상기 Grim19 단백질은 서열번호 1로 표시되는 아미노산 서열을 갖는 것일 수 있다.
본 발명의 한 구현예에 있어서, 상기 Grim19는 체중 감소, 지방세포 감소, 체내 총 콜레스테롤의 함량 감소 및 백색지방의 갈색지방으로의 전환 효과를 갖는 것일 수 있다.
또한, 본 발명은 상기 본 발명에 따른 Grim19 단백질 또는 상기 단백질을 암호화하는 폴리뉴클레오티드를 유효성분으로 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물을 제공한다.
본 발명의 한 구현예에 있어서, 상기 질환은 당뇨, 고지혈증, 동맥경화, 고혈압, 심혈관 질환, 지방간, 비만유래 염증질환, 비만유래 자가면역질환 또는 비만유래 암 질환일 수 있다.
본 발명의 한 구현예에 있어서, 상기 폴리뉴클레오티드는 서열번호 2 또는 서열번호 3으로 표시되는 염기서열을 갖는 것일 수 있다.
본 발명의 한 구현예에 있어서, 상기 폴리뉴클레오티드는 발현 벡터 내에 포함되어 있는 것일 수 있다.
본 발명의 한 구현예에 있어서, 상기 발현 벡터는 플라스미드 또는 바이러스성 벡터일 수 있다.
또한, 본 발명은, (a) Grim19 단백질 또는 상기 단백질을 발현하는 재조합 세포와 후보물질을 배양하는 단계; 및 (b) Grim19 단백질의 활성 또는 세포 내 수준 증가에 미치는 효과를 측정하는 단계를 포함하는, 비만 또는 지질 관련 대사성 질환 치료제 스크리닝 방법을 제공한다.
본 발명의 한 구현예에 있어서, 상기 Grim19 단백질의 활성 또는 세포 내 수준은 면역침전법(coimmunoprecipitation), 방사능면역분석법(RIA), 효소면역분석법(ELISA), 면역조직화학, 웨스턴 블롯(Western Blotting) 또는 유세포 분석법(FACS)으로 측정하는 것일 수 있다.
본 발명은 Grim19 단백질이 비만 또는 지질 관련 대사성 질환을 예방 또는 치료할 수 있는 효과가 있음을 최초로 규명하였으며, 따라서 본 발명은 Grim19 단백질을 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물을 제공함에 그 특징이 있다.
본 발명자들은 대사성 질환의 치료를 위한 새로운 비만 억제제를 개발하기 위해 Grim19 유전자에 주목 하였는데, 상기 Grim19는 세포의 죽음과 관련된 유전자로 밝혀졌고, 최근에는 yeast-2-hybrid 스크리닝을 통해 STAT3와 상호작용을 하는 파트너로 알려진 바 있다(Zhang J, Yang J, Roy SK, Tininini S, Hu J, Bromberg JF. The cell death regulator Grim-19 is an inhibitor of signal transducer and activator of transcription 3. Proc Natl Acad Sci USA. 2003;100:93429347). 초기 STAT3 관련 인자들이 거론되었을 때, PIAS3 및 SOCS3(suppressor of cytokine signaling 3)는 STAT3의 억제 피드백으로 거론된 바 있고, SOCS 단백질은 JAKs을 억제하여 리간드에 의해 유도되는 반응을 억제하는 활성이 있으며, PIAS 단백질은 STAT3의 인산화를 억제하는 활성이 있는 것으로 알려져 있다(Starr R, Hilton DJ. Negative regulation of the JAK/STAT pathway. Bioessays 1999;21:4752).
Grim19 또한 STAT3에 의해 유도되는 전사를 억제하는 역할을 하는 것으로 알려져 있는데 흥미롭게도 Grim19는 SOCS3 및 PIAS3와는 달리 타이로신(tyrosin)과 세린(serine) 잔기의 인산화를 억제하거나 DNA 결합을 방해하지 않는다는 내용이 밝혀진 바 있다(Chung CD, Liao J, Liu B, Rao X, Jay P, Berta P. Specific inhibition of Stat3 signal transduction by PIAS3. Science. 1997;278:18031805). 그러나 Grim19가 비만 또는 지질 관련 대사성 질환과 관련하여 이들 질환과의 관련성 및 치료 기작에 관한 연구에 대해서는 전혀 알려진 바가 없다.
따라서 본 발명에서는 Grim19 단백질이 비만 또는 지질 관련 대사성 질환의 예방 또는 치료를 위한 용도로 사용할 수 있다는 사실을 최초로 규명하였다.
즉, 이러한 결과는 본 발명의 한 구현예에 의해 확인할 수 있었는데, Grim19 형질전환(transgenic, 이하 "TG"라 함) 마우스(Grim19가 과발현되도록 형질전환된 마우스)에 고지방 사료를 먹인 군의 경우, Grim19로 형질전환시키지 않은 정상 마우스에 고지방 식이로 비만을 유도한 마우스 군에 비해 체중의 증가가 현저하게 감소하는 것으로 나타났고, 거의 일반 정상식이를 먹인 정상 마우스와 유사한 체중을 보이는 것으로 나타났다(도 1 참조).
또한, 다른 한 구현예를 통해 Grim19 단백질이 지방세포 수 및 크기를 현저하게 감소시키는 효과가 있으며, 백색지방의 감소와 갈색지방의 증가를 유도함을 확인할 수 있었다.
특히 백색지방은 체내에서 과잉의 에너지를 중성지방(Triglyceride)으로 저장하는 역할을 하며, 따라서 운동부족이나 과식으로 에너지 과잉이 발생하게 되면 백색 지방세포 수가 늘어나게 되고 결국 비만이 유도되어 살찌기 쉬운 체질로 된다. 그러나 갈색지방은 저장된 에너지를 열로 소모시키는 역할을 하고 있기 때문에 체중 증가 및 비만에 작용하는 지방이 아니다.
따라서 이러한 사실로 볼 때, Grim19는 비만을 유도하는 지방인 백색지방은 감소시키고 반면 체중을 줄이는 갈색지방은 증가시키는 활성까지 가지고 있어 더욱 효과적으로 비만을 예방 및 치료할 수 있다는 것을 알 수 있었다.
또한, Grim19는 혈중 글루코스(Glucose), 트리글리세라이드(Tryglyceride), 총 콜레스테롤(Total cholesterol), AST 및 ALT의 함량을 감소시키는 효과를 가지는데, 여기서 AST 및 ALT는 간기능검사 수치로서 비만 또는 지질 관련 대사성 질환에서는 이 수치가 증가되어 있는 것으로 나타난다.
따라서 본 발명의 Grim19는 비만뿐만 아니라 지질 관련 대사성 질환도 예방 및 치료할 수 있는 효과가 있다는 것을 알 수 있었다.
나아가 본 발명자들은 비만과 염증 반응의 관계를 조사해보고자, 고지방 사료를 먹인 정상 마우스와 Grim19 TG 마우스의 비장세포에서 염증성 사이토카인을 유세포(FACS)분석 및 비장 confocal 조직 염색을 한 결과, 본 발명의 Grim19 단백질이 STAT3를 매개하여 염증반응을 조절할 수 있음을 알 수 있었다(도 7a 내지 도 7g 참조).
따라서 Grim19에 대한 이러한 실험 결과를 토대로 볼 때, 본 발명의 Grim19 단백질은 대사성 질환을 치료할 수 있는 효과가 있으며, 면역조절 이상으로 유발되는 비만 질환도 예방 또는 치료할 수 있다는 사실을 알 수 있다.
그러므로 본 발명은 Grim19 단백질을 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물을 제공할 수 있으며, 본 발명의 약학적 조성물에 포함되는 Grim19 단백질은 상기 단백질과 실질적으로 동등한 생리 활성을 갖는 단백질을 포함한다. 실질적으로 동등한 생리 활성을 갖는 Grim19 단백질에는 상기 단백질과 그 기능적 동등물(functional equivalent) 및 기능적 유도체(functional derivative)가 포함된다.
상기 "기능적 동등물"에는 천연형 단백질 아미노산 중 일부 또는 전부가 치환되거나, 아미노산의 일부가 결실 또는 부가된 아미노산 서열 변형체로서 천연형 Grim19 단백질과 실질적으로 동등한 생리활성을 갖는 것을 말한다. "기능적 유도체"는 상기 Grim19 단백질의 물리 화학적 성질을 증가 또는 감소시키기 위한 변형을 가한 단백질로서 천연형 Grim19 단백질과 실질적으로 동등한 생리 활성을 갖는 것을 의미한다.
바람직하게 상기 Grim19 단백질은 서열번호 1로 표시되는 아미노산 서열을 가지는 단백질을 말한다.
본 발명에서 상기 비만은 과다한 체지방을 가진 상태를 의미하며, 남자는 체지방이 체중의 25%, 여자는 체중의 30% 이상일 때, 임상적으로는 BMI(Body Mass Index:체질량지수)가 30.1 이상인 경우, 현재 체중이 이상체중을 20% 초과하는 경우로 정의된다. 비만의 원인으로는 유전적 요인, 환경적 요인, 에너지 대사의 이상 등이 있다. 비만의 종류에는 원인에 따라서 단순비만과 증후성 비만으로 분류할 수 있다. 단순 비만은 과식과 운동 부족이 그 원인이며, 증후성 비만은 내분비, 시상하부성, 유전, 전두엽 및 대사성 등으로 발생한다.
또한, 본 발명의 Grim19 단백질은 염증성 사이토카인을 생성 및 분비하는 세포 독성 Th17 세포의 분화를 억제하는 효과가 우수하고, 비정상적으로 활성화된 면역세포의 기능을 억제하고 염증 반응을 제어하는 특성을 갖는 면역조절 T 세포(Treg)는 활성화 시키는 효과가 우수하며, STAT3를 매개하여 비만과 관련된 염증 환경을 조절할 수가 있어 단순비만과 증후성 비만뿐만 아니라 면역조절의 이상으로 인해 생기는 비만도 예방 또는 치료할 수 있다.
참고로 비만은 정상체중인 사람에 비해 지방세포의 크기가 매우 커져 있고, 지방세포의 생리학적, 물리적 성질과 성상이 정상체중인 사람들에서 보이는 특징과 달라 신체 특히 복강 내 혈액 및 림프구의 흐름에 장애를 일으킨다. 또한 거대 대식세포의 증식으로 지방세포 내에서 50여 종의 염증 물질이 과다 분비되는데, 이는 우리 몸에서 각종 염증 반응을 일으키고 대사장애 증후군을 유발하는 등 각종 합병증을 동반하게 된다. 따라서 비만이 유발하는 비만 유래 질환으로는 제 2형 당뇨, 골관절염, 비알코올성 지방간증, 수면무호흡증, 폐색전증, 고혈압, 천식, 불임, 암, 우울증 등이 있다. 정상체중인 사람과 비교했을 때 비만인 사람은 당뇨에 걸릴 위험이 2배, 고혈압이 생길 확률은 1.5배이며, 고도비만의 사람의 경우는 당뇨 5배, 고혈압은 2.5배로 높은 편이다. 비만도가 높을수록 합병증의 위험도 그만큼 높다.
또한, 고도비만이 되면 지방세포의 크기가 400배까지 커질 수 있는데, 이렇게 커진 지방세포를 만져보면 크기만 큰 것이 아니라 귤 알갱이처럼 탱탱해서 잘 깨지지 않는다. 보통 크기의 지방세포는 85%의 지방과 15%의 수분으로 이루어져 있어 손가락 사이에 넣고 누르면 약해서 뭉그러진다. 그러나 고도비만이 되어 커져버린 지방세포는 표면이 탱탱할 뿐 아니라 단단해서 여간해서는 깨지지 않는다. 지방세포가 이렇게 변형되면 우리 몸의 대식세포가 움직이기 시작한다. 원래 대식세포는 우리 몸에 병이 생겼을 때 나쁜 균들을 없애는 역할을 하는 좋은 세포이나 지방세포가 비정상적으로 커지면 대식세포는 몸 안에 이상한 변화가 일어났다고 판단하여 지방세포를 잡아먹기 위해 계속 증식한다. 그래서 커진 지방세포와 같은 크기인 400배까지 커져, 거대대식세포로 변하게 되는 것이다.
일반적인 대식세포의 활동은 우리 몸이 가진 자체 정화장치이다. 나쁜 균들이 몸 안으로 들어오면 대식세포가 자기 몸에서 염증인자를 분비해 나쁜 균을 해치움으로써 우리 몸을 건강한 상태로 유지한다. 그러나 400배나 커져 버린 대식세포는 더 이상 정화장치로서의 역할을 못한다. 오히려 필요하지도 않은 각종 염증인자들을 과도하게 분비해 우리 몸을 위협한다. 염증 반응이 계속 일어나면 몸 안에 혈관이 늘어나고, 그로 인해 혈관 사이에 상처가 생기고 섬유화되어 몸속 곳곳의 혈액 순환에 문제가 생긴다. 혈액 순환이 잘 되지 않으면 대식세포는 더 많은 염증인자를 분비한다. 다시 염증인자는 불필요한 혈관들을 만들어 혈액순환을 방해한다. 이렇게 되면 인슐린이 작용해야 할 곳에 인슐린이 제대로 작용할 수 없어 당뇨가 생기고, 섬유화 된 좁은 혈관을 뚫고 혈액이 들어가려고 하다 보니 압력이 강해져 고혈압이 생긴다. 비만으로 인한 합병증은 거대대식세포가 어느 위치에서 염증반응을 일으키느냐에 따라 달라지는데 관절에 가서 염증 반응을 일으키면 관절염, 폐에 가서 일으키면 폐색전증이 일어난다. 온몸에서 이런 염증 반응이 일어나고 있다면 비만인 사람은 면역체계 자체가 정상인보다 약해질 수 밖에 없다.
따라서 본 발명의 Grim19 단백질은 비만 뿐만 아니라 비만으로 인해 유도되는 염증질환 또는 자가면역질환의 치료에도 사용될 수 있으므로, 본 발명은 비만으로 인해 유도되는 염증질환 또는 자가면역질환의 예방 또는 치료용 약학적 조성물을 제공할 수 있다.
본 발명에서 상기 '치료'란, 달리 언급되지 않는 한, 상기 용어가 적용되는 질환 또는 질병, 또는 상기 질환 또는 질병의 하나 이상의 증상을 역전시키거나, 완화시키거나, 그 진행을 억제하거나, 또는 예방하는 것을 의미하며, 본원에서 사용된 상기 '치료'란 용어는 '치료하는'이 상기와 같이 정의될 때 치료하는 행위를 말한다.
본 발명에 따른 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물은 약학적으로 유효한 양의 Grim19 단백질을 단독으로 포함하거나 하나 이상의 약학적으로 허용되는 담체, 부형제 또는 희석제를 포함할 수 있다. 상기에서 약학적으로 유효한 양이란 비만 또는 지질 관련 대사성 질환의 증상을 예방, 개선 및 치료하기에 충분한 양을 말한다.
본 발명에 따른 Grim19 단백질의 약학적으로 유효한 양은 0.5∼100 ㎎/day/체중㎏, 바람직하게는 0.5∼5 ㎎/day/체중㎏이다. 그러나 상기 약학적으로 유효한 양은 비만 또는 지질 관련 대사성 질환 증상의 정도, 환자의 연령, 체중, 건강상태, 성별, 투여 경로 및 치료기간 등에 따라 적절히 변화될 수 있다.
또한, 상기에서 "약학적으로 허용되는"이란 생리학적으로 허용되고 인간에게 투여될 때, 통상적으로 위장 장애, 현기증과 같은 알레르기 반응 또는 이와 유사한 반응을 일으키지 않는 조성물을 말한다. 상기 담체, 부형제 및 희석제의 예로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 유화제 및 방부제 등을 추가로 포함할 수 있다.
또한, 본 발명의 조성물은 포유동물에 투여된 후 활성 성분의 신속, 지속 또는 지연된 방출을 제공할 수 있도록 당업계에 공지된 방법을 사용하여 제형화될 수 있다. 제형은 분말, 과립, 정제, 에멀젼, 시럽, 에어로졸, 연질 또는 경질 젤라틴 캅셀, 멸균 주사용액, 멸균 분말의 형태일 수 있다.
또한, 본 발명에 따른 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물은 경구, 경피, 피하, 정맥 또는 근육을 포함한 여러 경로를 통해 투여될 수 있으며, 활성 성분의 투여량은 투여 경로, 환자의 연령, 성별, 체중 및 환자의 중증도 등의 여러 인자에 따라 적절히 선택될 수 있고, 본 발명에 따른 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물은 비만 또는 지질 관련 대사성 질환의 증상을 예방, 개선 또는 치료하는 효과를 가지는 공지의 화합물과 병행하여 투여할 수 있다.
또한, 본 발명은 Grim19 단백질 또는 상기 단백질을 암호화하는 폴리뉴클레오티드를 유효성분으로 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물을 제공할 수 있다.
상기 Grim19 단백질을 암호화하는 폴리뉴클레오티드는 DNA 또는 RNA를 포함할 수 있으며, 바람직하게는 서열번호 2로 표시되는 DNA 서열을 갖는다.
여기서 상기 폴리뉴클레오티드는 플라스미드 또는 바이러스 벡터와 같은 발현 벡터 내로 공지의 방법에 의해 도입시킨 후 상기 발현 벡터를 당업계에 공지된 다양한 방법으로 감염(infection) 또는 형질도입(transduction)에 의해 발현형으로 표적 세포 내에 도입시킬 수 있다.
플라스미드 발현 벡터는 사람에게 사용할 수 있는 FDA의 승인된 유전자 전달 방법으로 사람 세포에 직접적으로 플라스미드 DNA를 전달하는 방법이다(Nabel, E.G., et al., Science, 249:1285-1288, 1990). 플라스미드 DNA는 바이러스 벡터와는 달리 균질하게 정제될 수 있는 장점이 있다. 본 발명에서 사용할 수 있는 플라스미드 발현 벡터로는 당업계에 공지된 포유동물 발현 플라스미드를 사용할 수 있다. 예를 들면, 이에 한정되지는 않으나 pRK5(유럽특허 제307,247호), pSV16B(국제특허공개 제91/08291호) 및 pVL1392(PharMingen) 등이 대표적이다.
본 발명에 따른 폴리뉴클레오티드를 포함하는 플라스미드 발현 벡터(plasmid expression vector)는 당업계에 공지된 방법, 예를 들어 이에 한정되지는 않으나, 일시적 형질감염(transient transfection), 미세주사, 형질도입(transduction), 세포융합, 칼슘 포스페이트 침전법, 리포좀 매개된 형질감염(liposome-mediated transfection), DEAE 덱스트란-매개된 형질감염(DEAE Dextran-mediated transfection), 폴리브렌-매개된 형질감염(polybrene-mediated transfection), 전기침공법(electropora tion), 유전자 건(gene gun) 및 세포 내로 DNA를 유입시키기 위한 다른 공지의 방법에 의해 세포 내로 도입할 수 있다(Wu et al., J. Bio. Chem., 267:963-967, 1992; Wu and Wu, J. Bio. Chem., 263:14621-14624, 1988).
상기 Grim19를 발현시킬 수 있는 벡터는 공지의 방법에 의해 투여될 수 있다. 예를 들면, 국소적으로, 비경구, 경구, 비강, 정맥, 근육 내, 피하 내 또는 다른 적절한 수단에 의해 투여될 수 있다.
따라서 본 발명은 Grim19 단백질 또는 상기 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 발현벡터를 유효성분으로 함유하는 조성물을 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약제를 제공할 수 있으며, 나아가 본 발명은 Grim19 단백질 또는 상기 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 발현벡터를 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환 억제용 조성물을 제공할 수 있다.
나아가 본 발명은, (a) Grim19 단백질 또는 상기 단백질을 발현하는 재조합 세포와 후보물질을 배양하는 단계; 및 (b) Grim19 단백질의 활성 또는 세포 내 수준 증가에 미치는 효과를 측정하는 단계를 포함하는, 비만 또는 지질 관련 대사성 질환 치료제 스크리닝 방법을 제공할 수 있으며, 이때 상기 Grim19 단백질의 활성 또는 세포 내 수준은 면역침전법(coimmunoprecipitation), 방사능면역분석법(RIA), 효소면역분석법(ELISA), 면역조직화학, 웨스턴 블롯(Western Blotting) 또는 유세포 분석법(FACS)으로 측정할 수 있다.
특히 본 발명에 따른 비만 또는 지질 관련 대사성 질환의 치료제가 될 수 있는 물질은 상기와 같은 방법에서 Grim19 단백질의 활성 또는 세포 내 수준을 증가시키는 물질일 수 있으며, 여기서 상기 세포 내 수준 증가는 Grim19의 발현이 증가되거나 또는 Grim19의 분해가 억제되어 Grim19 단백질의 농도가 증가되는 것을 말한다.
본 발명에 따른 상기 Grim19 단백질의 경우, 지방세포 감소효과 및 체내 총 콜레스테롤 함량 감소 효과가 우수한 것으로 나타났으며 염증성 사이토카인을 생성 및 분비하는 세포 독성 Th17 세포의 분화를 억제하는 효과가 우수하고, 비만과 관련된 염증 환경을 Grim19가 STAT3를 매개하여 염증반응을 조절하는 효과가 우수하다는 사실을 확인함으로써, 비만 또는 지질 관련 대사성 질환을 효과적으로 치료할 수 있는 치료제 및 기능성 식품의 제조에 사용될 수 있는 효과가 있다.
도 1은 Grim19 TG 마우스에 60kcal 고지방사료를 먹인 군, 대조군 마우스로 C57BL/6(H-2kb) 마우스에 60kcal 고지방사료를 먹인 군, 16kcal의 일반 사료를 먹인 군으로 실험동물을 구분하여 10주까지 매주 체중을 측정한 결과이다.
도 2a 및 도 2b는 본 발명의 일 실시예에 따라 61일 째에 각 실험동물을 치사시키고 치사된 동물의 간과 몸통을 육안으로 관찰한 결과 및 체중을 측정한 결과이다.
도 3은 본 발명의 일 실시예에 따라 치사된 마우스의 간에서 얻어진 동결절편(7㎛)으로 헤마톡실린과 에오진 염색과 오일 레드 오(Oil red O) 염색을 한 결과를 나타낸다.
도 4a 및 도 4b는 본 발명의 일 실시예에 따라 치사된 실험동물의 후복막(Retroperitoneal) 및 견갑골사이(Interscapular) 부위의 지방 부분을 절취하여 모양과 무게를 관찰한 결과이다.
도 5는 본 발명의 일 실시예에 따라 정상식이 대조군과 Grim19 TG 마우스의 견갑골 사이 부위의 백색지방과 갈색지방을 분리하여 무게를 측정한 결과를 나타낸 것이다.
도 6a 및 도 6b는 본 발명의 일 실시예에 따라 3군의 실험동물 혈청의 글루코스, 트리글리세라이드, 총 콜레스테롤, HDL-콜레스테롤, LDL-콜레스테롤, AST, ALT 농도를 측정한 그래프이다.
도 7a는 Grim19 TG 마우스, 고지방 사료를 먹인 WT 마우스 및 일반 WT 마우스의 비장세포에서 염증성 사이토카인을 유세포(FACS) 분석한 결과를 나타낸 것이다.
도 7b 내지 도 7f는 Grim19 TG 마우스, 고지방 사료를 먹인 WT 마우스 및 일반 WT 마우스의 비장세포를 confocal 조직 염색한 결과를 보여주는 사진 및 그래프이다.
도 7g는 본 발명의 일 실시예에 따라 Grim19에 의한 STAT3의 인산화 변화를 웨스턴블롯팅 분석을 통해 확인한 결과를 나타낸 것이다.
도 8은 Grim19가 고지방 사료 섭취시 간조직 내 지방세포에 미치는 영향을 보여주는 전자현미경 사진이다.
도 9는 Grim19가 고지방 사료 섭취시 간조직 내 지방세포에 미치는 영향을 보여주는 헤마톡실린 및 에오진 염색 사진으로서, HFD는 고지방 사료(high fat died)를 나타낸다.
도 10a는 Grim19가 지방세포 분화에 미치는 영향을 보여주는 오일 레드 오 염색 사진이다.
도 10b 내지 도 10e는 Grim19로 형질전환된 세포에서 백색지방 및 갈색지방 관련 유전자의 발현 정도를 보여주는 그래프이다.
도 11a 및 도 11b는 저온 스트레스 상태에서 Grim19로 형질전환된 마우스에서의 갈색지방 유전자의 발현 변화를 보여주는 그래프이다.
도 12는 Grim19가 고지혈증후군을 억제하는지 여부를 보여주는 인간 대식세포주에 대한 염색 사진 및 그래프이다.
이하 본 발명을 실시예에 의하여 더욱 상세하게 설명한다. 이들 실시예는 단지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 범위가 이들 실시예에 국한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1. Grim19의 체중감소 효과 분석
본 발명자들은 Grim19가 비만을 치료할 수 있는 효과가 있는지를 확인하기 위하여, 우선 Grim19 단백질이 과발현될 수 있도록 Grim19 과발현벡터를 제작하였다. Grim19의 cDNA를 코돈최적화를 통해 포유류에서 발현이 잘되는 코돈으로 교체하여 합성하였고(표 1 참고)(TOPgenetech, Canada), 제한효소 BamH1과 Xho1으로 잘라 pcDNA3.1+ (promega)에 삽입하여 Grim19 cDNA가 삽입된 재조합 벡터 pcDNA3.1+Grim19를 만들고 재조합된 벡터로 E.coli를 형질전환시킨 다음 플라스미드 추출 키트(plasmid extraction kit, Qiagan)로 플라스미드 DNA를 확보하였다.
이후 NIH3T3 세포에 형질도입하여 Grim19의 과발현을 웨스턴 블롯(western blot)으로 확인 한 후 이 Grim19 과발현 벡터를 마크로젠에 전달하여 TG 마우스 제작을 의뢰하였다. 마크로젠에서 시행한 TG 제작과정은 우선 TG 벡터에 Grim19 cDNA를 옮겨 발현벡터를 만들고 PMSG와 hCG 호르몬 주사로 과배란을 유도한 암컷마우스의 난관으로부터 접합자(zygote)를 채란하고 현미경하에서 Grim19 DNA 용액을 미세주입(microinjection)하고 생존한 것을 선별하여 대리모의 난관에 이식하여 분만하게 하였다. 태어난 생쥐가 2주정도 지난 후에 꼬리를 잘라 genomic DNA를 추출하여 유전자의 삽입여부를 확인하였고 genomic DNA를 통한 PCR로 생식세포 전달(germline transmission)여부를 확인하여 형질전환된 Grim19 마우스를 유지하였다.
이후, 형질전환된 Grim19 TG 마우스와 정상 마우스(C57BL/6(H-2kb))에 60kcal의 고지방 사료로 섭취하게 하였고, 다른 정상 마우스(C57BL/6(H-2kb))에는 16kcal의 일반 사료를 섭취하게 하였으며, 이러한 3개의 군을 대상으로 하기 실험을 진행하였다.
상기 3개의 동물 실험군을 대상으로 10주까지 매주 체중을 측정하였는데, 그 결과, 정상 마우스에 고지방 사료로 섭취하게 한 경우, 정상의 일반 사료를 섭취하게 한 경우에 비해 시간이 지남에 따라 체중이 점점 증가하여 비만화 되어가는 것으로 나타난 반면, Grim19 단백질이 발현되도록 형질전환된 Grim19 TG 마우스의 경우 고지방 사료를 섭취하게 하였음에도 불구하고 체중이 증가하지 않고 거의 정상 식이를 한 마우스와 유사한 것으로 나타났다(도 1).
따라서 이러한 결과를 통해 본 발명자들은 Grim19가 체중 증가 현상을 억제하는 활성을 가지고 있어 비만을 억제할 수 있는 효과가 있다는 것을 알 수 있었다.
표 1 Grim19의 서열
Grim19 단백질서열 (서열번호 1) MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIFGYWRMMRWNQERRRLLIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPLIGEMYGLRTKEEMSNANFGFTWYT
Grim19 cDNA서열 (서열번호 2) GGATCCAGTATGGCGGCGTCGAAGGTGAAGCAGGACATGCCCCCGCCAGGGGGCTACGGCCCCATCGACTACAAGCGGAACCTGCCCCGCCGGGGACTGTCGGGGTACAGCATGTTTGCTGTGGGCATCGGGGCCTTGATCTTTGGCTACTGGAGAATGATGAGGTGGAACCAGGAGCGCAGGCGCCTGCTGATTGAGGACTTGGAGGCCAGGATCGCCCTCATGCCGCTCTTCCAGGCAGAGAAGGACCGGAGGACCCTGCAGATTCTCCGGGAAAACCTGGAGGAGGAAGCCATCATCATGAAGGATGTGCCCAACTGGAAGGTGGGCGAGTCTGTGTTCCATACCACACGATGGGTGCCACCCCTCATTGGCGAGATGTATGGGTTGCGCACCAAGGAGGAGATGAGCAATGCCAACTTCGGCTTCACCTGGTACACTTAGGGCCTCGAG
codon optimized Grim19 (서열번호 3) GGATCCAGTATGGCTGCCAGCAAGGTGAAGCAGGACATGCCCCCTCCTGGCGGCTACGGCCCCATCGACTACAAGAGAAACCTGCCCAGAAGAGGCCTGAGCGGCTACAGCATGTTCGCCGTGGGCATCGGCGCCCTGATCTTCGGCTACTGGAGAATGATGAGATGGAACCAGGAGAGACGGAGACTGCTGATCGAGGACCTGGAGGCCAGAATCGCCCTGATGCCCCTGTTCCAGGCCGAGAAGGACAGAAGAACCCTGCAGATCCTGAGAGAGAACCTGGAGGAGGAGGCCATCATCATGAAGGACGTGCCCAACTGGAAGGTGGGCGAGAGCGTGTTCCACACCACAAGATGGGTGCCTCCCCTGATCGGCGAGATGTACGGCCTGAGAACCAAGGAGGAGATGAGCAACGCCAACTTCGGCTTCACCTGGTACACCTAGGGACTCGAG
실시예 2. 조직학적 분석을 통한 Grim19의 비만 억제 효과
<2-1> 육안관찰에 의한 체중 및 조직 크기 비교
상기 실시예 1에서 수행한 3개 군의 동물 모델을 대상으로 비만지수가 유의성 있게 차이나는 시기인 61일째에 각 군의 마우스를 희생시키고, 희생된 마우스의 몸통과 간의 크기를 육안으로 관찰하였다.
그 결과, 도 2a 및 도 2b에 나타낸 바와 같이, 일반 사료를 먹인 마우스에 비해 고지방 사료를 먹인 마우스의 경우 몸통 크기가 약 1.5배 정도 커진 것으로 관찰되었고, 간 역시 지방의 축적으로 노란색을 띄는 것으로 나타났으나, 고지방 비만 사료를 먹인 Grim19 TG 마우스는 일반 사료를 먹인 마우스와 유사한 몸통 크기 및 유사한 간 조직의 형태 및 색을 유지하는 것으로 나타났다.
<2-2> 면역조직화학적 염색
상기 실시예 <2-1>의 실험에 사용된 각 군의 마우스 간으로부터 조직을 떼어내고 동결절편(7㎛)화 시킨 후, 상기 절편을 헤마톡실린과 에오진 염색 및 오일 레드 오(Oil red O)염색을 수행하여 지방세포를 관찰하였다.
그 결과, 일반사료를 먹인 마우스 군(정상마우스)에 비해 고지방 사료를 먹인 마우스의 경우, 지방세포가 확연히 많아지고 지방세포 크기도 커진 것으로 나타난 반면, 고지방 비만 사료를 먹인 Grim19 TG 마우스는 정상 마우스와 거의 유사한 지방세포를 보이는 것으로 나타났다(도 3).
<2-3> 부위별 FAT PAD의 관찰 및 무게 측정
상기 실시예 <2-1>의 실험에 사용된 각 군의 마우스를 대상으로 후복막(Retroperitoneal), 및 견갑골사이(Interscapular) 부위의 지방 부분을 절취하고 모양과 무게를 관찰하였다.
그 결과, 도 4a 및 도 4b에 나타낸 바와 같이, 고지방 사료를 먹은 마우스는 일반 사료를 먹은 마우스에 비해 후복막과 견갑골사이 부위의 지방이 3배 이상으로 증가되어 있는 것으로 나타났다. 한편, 고지방 식이를 섭취하게 한 Grim19 TG 마우스는 정상식이 마우스와 거의 유사한 지방대(FAT PAD)를 보이는 것으로 나타났다.
따라서 본 발명자들은 이러한 조직학적 관찰 및 분석을 통해 본 발명의 Grim19가 고지방 섭취로 인한 비만을 효과적으로 억제할 수 있다는 것으로 알 수 있었다.
실시예 3. Grim19 TG 마우스의 갈색 지방 및 백색 지방 비교 분석
본 발명자들은 상기 실험을 통해 본 발명의 Grim19가 비만을 예방 및 억제하는 효과가 있다는 것을 알 수 있었으며, 나아가 Grim19가 생체 내에서 백색 지방과 갈색 지방의 형성 여부에 어떠한 영향을 주는지 확인하기 위한 실험을 수행하였다.
한편, 백색지방은 체내에서 과잉의 에너지를 중성지방(Triglyceride)으로 저장하는 역할을 하며, 따라서 운동부족이나 과식으로 에너지 과잉이 발생하게 되면 백색 지방세포 수가 늘어나게 되고 결국 비만이 유도되어 살찌기 쉬운 체질로 된다. 그러나 갈색지방은 저장된 에너지를 열로 소모시키는 역할을 하고 있기 때문에 체중 증가 및 비만에 작용하는 지방이 아니다.
이에 본 발명자들은 Grim19가 생체 내에서 백색 지방과 갈색 지방에 미치는 영향을 조사하기 위해 Grim19 TG 마우스를 정상 일반 사료로 사육한 군과 형질전환시키지 않은 정상 마우스를 정상 일반 사료로 사육한 군을 10주 동안 사육한 후, 이들을 치사시켜, 마우스를 해부하여 갈색지방과 백색지방의 축적 정도와 비중(무게)을 분석하였다.
정상식이 대조군과 Grim19 TG 마우스의 견갑골 사이 부위의 백색지방과 갈색 지방을 분리하여 무게를 측정한 결과, Grim19 TG 마우스의 백색지방은 정상 마우스군에 비해 감소되어 있는 것으로 나타났고, 반면에 갈색지방은 Grim19 TG 마우스군이 정상 마우스 군에 비해 증가되어 있음을 확인할 수 있었다(도 5).
또한, 백색지방과 갈색지방의 비(ratio)를 조사한 결과, Grim19가 과발현된 in vivo 마우스 모델에서는 백색지방의 발달은 감소하고 있는 것으로 나타났고, 따라서 이렇게 감소된 백색지방 세포가 갈색지방세포로 전환되어 유지됨을 알 수 있었다.
실시예 4. Grim19의 지질 관련 대사성 질환의 예방 또는 치료 효과 분석
본 발명자들은 본 발명의 Grim19가 지질 관련 대사성 질환을 예방 또는 치료할 수 있는 효과가 있는지 확인하기 위해, 상기 실시예 <2-1>의 실험에 사용된 각 군의 마우스를 대상으로 혈액 내 글루코스, 트리글리세라이드, 콜레스테롤 및 유리지방산의 함량을 분석하였다. 즉, 상기 실시예 <2-1>의 실험에 사용된 각 군의 마우스를 이소플루란(Isoflurane)으로 마취시킨 후 심장으로부터 혈액을 채혈하였다. 채혈한 혈액은 원심분리관에 담아 3000 rpm에서 20분간 원심분리하여 혈청을 분리하였고, -70℃에서 분석 시까지 냉동보관하였다.
이후 혈청에 함유된 글루코스, 트리글리세라이드, 총 콜레스테롤, HDL-콜레스테롤, LDL-콜레스테롤, AST, ALT 농도는 자동분석기기(Kuadro, Italy)를 이용해 분석하였다.
그 결과, 비만 유도된 마우스에 비해 비만 사료를 먹인 Grim19 TG 마우스가 혈청에서의 글루코스, 트리글리세라이드, 총 콜레스테롤, HDL-콜레스테롤, LDL-콜레스테롤, AST, ALT의 농도가 현저하게 감소된 것으로 나타났으며, 비만 사료를 섭취한 Grim19 TG 마우스에서 위의 성분들의 함량은 일반 사료를 먹인 정상마우스 군과 거의 유사한 것으로 나타났다(도 6a 및 도 6b).
따라서 이러한 결과를 통해, 본 발명자들은 본 발명의 Grim19가 비만으로 인해 혈액 내에서 증가된 글루코스, 트리글리세라이드, 콜레스테롤, AST 및 ALT의 함량을 감소시키는 작용이 우수한 것으로 나타났고, 따라서 고콜레스테롤 및 지방의 축적으로 유발되는 비만 및 고지혈증 질환과 함께 비만과 지질 대사 이상으로 유발될 수 있는 대사성 질환을 Grim19가 예방 및 치료할 수 있다는 것을 알 수 있었다.
실시예 5. Grim19의 T helper cell 조절과 STAT3 조절
나아가 본 발명자들은 비만과 염증 반응의 관계를 조사해보고자, 고지방 사료를 먹인 WT 마우스와 Grim19 TG 마우스의 비장세포에서 염증성 사이토카인을 유세포(FACS)분석을 하였다. 대조군으로는 일반 사료를 먹인 WT 마우스를 사용하였다.
그 결과, 항염증 반응과 관련된 T helper cell(TH2)와 Treg의 세포가 Grim19 TG 마우스군에서 월등히 증가되어 있음을 알 수 있었다(도 7a).
또한, 비장 confocal 조직 염색을 통해서 본 발명의 Grim19가 염증반응과 관련된 병인 Th17세포를 억제시키고, p-STAT 727, 705의 발현을 억제시켰으며, 조절 T 세포(Regulatory T cell: Treg)의 활성은 촉진 또는 증가시키고 p-STAT5의 발현은 증가시킴을 알 수 있었다(도 7b 내지 도 7f).
본 발명의 Grim19 단백질은 STAT3를 억제할 수 있는 분자로 특히 p-STAT3 727의 조절과 관련되어 있다고 알려져 있다. 먼저 Grim19 TG 마우스에서 STAT3의 활성 정도를 관찰한 결과, Grim19 TG 마우스에서 대조군인 일반 WT 마우스에 비해 p-STAT3가 현저하게 억제되어 있음을 알 수 있었으며, 이러한 현상은 비만 사료를 먹은 Grim19 TG 마우스에서도 동일하게 나타남을 알 수 있었다(도 7g).
따라서 비만과 관련된 염증 환경을 본 발명의 Grim19 단백질이 STAT3를 매개하여 염증반응을 조절할 수 있을 것으로 사료된다.
결론적으로, 상기 결과들을 통해 본 발명자들은 본 발명에 따른 Grim19 단백질의 경우, 지방세포 감소효과 및 체내 총 콜레스테롤 함량 감소 효과가 우수한 것으로 나타났으며 따라서 이러한 약리기전을 통해 Grim19가 비만과 고지혈증 등의 지질 관련 대사질환을 예방 및 치료하기 위한 용도로 사용할 수 있음을 알 수 있었다.
나아가 Grim19가 염증성 사이토카인을 생성 및 분비하는 세포 독성 Th17 세포의 분화를 억제하는 효과가 우수하고, 비만과 관련된 염증 환경을 Grim19가 STAT3를 매개하여 염증반응을 조절하는 효과를 통해 비만의 예방 및 치료할 수 있다는 사실을 알 수 있었다.
실시예 6. Grim19가 간조직 내 지방세포에 미치는 영향
Grim19가 고지방 사료 섭취시 간조직 내 지방세포에 미치는 영향을 확인하기 위하여, C57BL/6(H-2kb) background의 Grim19 TG 마우스에 60Kcal 고지방 사료 또는 16Kcal의 일반 사료를 먹인 마우스와 대조군 마우스인 C57BL/6(H-2kb)에 60Kcal의 고지방 사료와 16Kcal의 일반 사료를 먹인 각각의 마우스에서 간 조직을 얻은 후 전자 현미경으로 조사하였다.
그 결과, 고지방 식이를 한 C57BL/6 마우스의 간과 비교하여 Grim19 TG 마우스의 간의 지방 크기가 감소된 것을 확인하였다(도 8).
실시예 7. Grim19가 복부지방 내 지방세포에 미치는 영향
Grim19가 고지방 사료 섭취시 복부지방 내 지방세포에 미치는 영향을 확인하기 위하여, C57BL/6(H-2kb) background의 Grim19 TG 마우스에 60Kcal 고지방 사료 또는 16Kcal의 일반 사료를 먹인 마우스와 대조군 마우스인 C57BL/6(H-2kb)에 60Kcal의 고지방 사료와 16Kcal의 일반 사료를 먹인 각각의 마우스에서 복부지방을 취한 후 이를 파라핀 블록으로 만들었다. 상기 파라핀 블록을 7 ㎛ 두께의 절편으로 자른 후 실시예 <2-2>와 동일한 방식으로 헤마톡실린과 에오진 염색을 수행하였다.
그 결과, 고지방 식이를 한 C57BL/6 마우스의 복부 지방보다 Grim19의 복부지방의 지방 크기가 감소된 것을 확인하였다(도 9).
실시예 8. Grim19가 지방세포 분화에 미치는 영향
3T3 지방전구세포(pre-adipocyte)에 Grim19를 형질전환시켜 Grim19 유전자를 과발현시킨 후 지방세포로 분화를 유도하였다. 이를 위하여, 형질전환시킨 당일에 분화 배지(3T3-L1 Differentiation Medium(DM-2-L1), Zenbio)로 교체한 후 3일간 배양하였고, 이후 유지 배지(3T3-L1 Adipocyte Medium(AM-1-L1), Zenbio)로 교체한 후 지방세포의 분화 정도를 관찰하였다. 대조군으로는 pcDNA 3.1로 형질전환된 지방전구세포를 사용하였다. 상기 지방세포의 분화 정도는 실시예 <2-2>와 동일한 방식으로 오일 레드 오 염색을 통해 확인하였다. 구체적으로, 24-웰에 배양시킨 세포를 그대로 오일 레드 오 염색을 진행하였다. 먼저 세포를 10% 포르말린에 30분 정도 침지시킨 후 3차 증류수로 세척하였다. 이 후 60% 이소프로판올로 전처리한 후 오일 레드 오로 5분 정도 반응시켰고, 다시 3차 증류수로 세척한 후 헤마톡실린으로 카운터 염색을 진행하고 현미경으로 관찰하였다.
그 결과, Grim19를 형질전환시킨 세포에서 오일 레드 오 양성 세포가 감소되어 있었으며, 이로부터 Grim19가 지방세포로의 분화를 억제 시켜줌을 확인하였다(도 10a).
또한, 상기 분화된 세포로부터 추출한 RNA로부터 cDNA를 합성한 후 백색지방에서 발현하는 유전자를 실시간 PCR로 조사하였다. RT-PCR은 LightCycler FastStart DNAmaster SYBR green I(Takara) 형광 염료로 ABI PCR 장치를 이용하여 수행하였고, 이를 위한 반응 화합물은 1㎍으로 합성한 cDNA를 1/3로 희석한 것 1㎕, LightCycler FastStart DNAmaster SYBR green I (Takara) 10㎕, Taqman probe (Applied biosystems) 1㎕를 혼합한 후 증류수로 최종 부피를 20㎕로 만들어 사용하였다. 반응 조건은 95℃ 10초, 60℃ 30초로 총 50회 반응시켰다. Cycle threshold(Ct) 값을 분석하여 C/EBP-a, Agt, aP2, Pank3, Adiponectin, Resistin, LPL 및 Leptin의 mRNA의 발현량을 house keeping gene인 β-actin의 mRNA 발현양과의 상대정량으로 나타내었다.
상기 RT-PCR에서 사용한 프라이머는 C/EBP-a(Forward: 5'-CAA GAA CAG CAA CGA GTA CCG-3'(서열번호 4), Reverse: 5'-GTC ACT GGT CAA CTC CAG CAC-3', (서열번호 5)), Agt(Forward: 5'-GCA CCC TGG TCT CTT TCT ACC-3'(서열번호 6), Reverse: 5'-TGT GTC CAT CTA GTC GGG AGG-3'(서열번호 7)), aP2(Forward: 5'-GAT GCC TTT GTG GGA ACC T-3'(서열번호 8), Reverse: 5'-CTG TCG TCT GCG GTG ATT T-3'(서열번호 9)), PANK3(Forward: 5'-TGC TCT AGT GTC CCA TTT CTG CCT-3'(서열번호 10), Reverse: 5'-AGC TGG AAC AGC AAC TAG GAA-3'(서열번호 11)), Adiponectin (Forward: 5'-GTC AGT GGA TCT GAC GAC ACC AA-3'(서열번호 12), Reverse: 5'-ATG CCT GCC ATC CAA CCT G-3'(서열번호 13)), Resistin(Forward: 5'-AAG AAC CTT TCA TTT CCC CTC CT-3'(서열번호 14), Reverse: 5'-GTC CAG CAA TTT AAG CCA ATG TT-3'(서열번호 15)), LPL(Forward: 5'-GGA AGA GAT TTC TCA GAC ATC G-3'(서열번호 16), Reverse: 5'-CTA CAA TGA CAT TGG AGT CAG G-3'(서열번호 17)), Leptin(Forward: 5'-CCT CAT CAA GAC CAT TGT CAC C-3'(서열번호 18), Reverse: 5'-TCT CCA GGT CAT TGG CTA TCT G-3'(서열번호 19))을 사용하였다. 그 결과, 백색지방 유전자의 발현이 대조군에 비해 모두 감소되어 있음을 확인하였다(도 10b 및 도 10c).
아울러, 상기 분화된 세포로부터 추출한 RNA로부터 cDNA를 합성한 후 갈색지방에서 발현하는 유전자를 실시간 PCR로 조사하였다. RT-PCR은 LightCycler FastStart DNAmaster SYBR green I(Takara) 형광 염료로 ABI PCR 장치를 이용하여 수행하였고, 이를 위한 반응 화합물은 1㎍으로 합성한 cDNA를 1/3로 희석한 것 1㎕, LightCycler FastStart DNAmaster SYBR green I (Takara) 10㎕, Taqman probe (Applied biosystems) 1㎕를 혼합한 후 증류수로 최종 부피를 20㎕로 만들어 사용하였다. 반응 조건은 95℃ 10초, 60℃ 30초로 총 50회 반응시켰다. Ct 값을 분석하여 UCP1, Elvol3, PGC1a, Fgf21, Cidea, Cox7a1, PRDM16, Cytochrom C1의 mRNA의 발현량을 house keeping gene인 β-actin의 mRNA 발현양과의 상대정량으로 나타내었다.
상기 RT-PCR에서 사용한 프라이머는 UCP1(Forward: 5'-CTT TGC CTC ACT CAG GAT TGG-3'(서열번호 20), Reverse: 5'-ACT GCC ACA CCT CCA GTC ATT-3'(서열번호 21)), Elvol3(Forward: 5'-CGG GTT AAA AAT GGA CCT GA-3'(서열번호 22), Reverse: 5'-CCA ACA ACG ATG AGC AAC AG-3'(서열번호 23)), PGC1α(Forward: 5'-GTC AAC AGC AAA AGC CAC AA-3'(서열번호 24), Reverse: 5'-TCT GGG GTC AGA GGA AGA GA-3'(서열번호 25)), FGF21(Forward: 5'-CCT CTA GGT TTC TTT GCC AAC AG-3'(서열번호 26), Reverse: 5'-AAG CTG CAG GCC TCA GGA T-3'(서열번호 27)), Cidea(Forward: 5'-GCC GTG TTA AGG ATT CTG CTG-3'(서열번호 28), Reverse: 5'-TGC TCT TCT GTA TCG CCC AGT-3'(서열번호 29)), Cox7a1(Forward: 5'-AGA AAA CCG TGT GGC AGA GA-3'(서열번호 30), Reverse: 5'-CAG CGT CAT GGT CAG TCT GT-3'(서열번호 31)), PRDM16(Forward: 5'-GAC ATT CCA ATC CCA CCA GA-3'(서열번호 32), Reverse: 5'-CAC CTC TGT ATC CGT CAG CA-3'(서열번호 33)), Cytochrom C1(Forward: 5'-GCT ACC CAT GGT CTC ATG GT-3'(서열번호 34), Reverse: 5'-CAT CAT CAT TAG GGC CAT CC-3'(서열번호 35))을 사용하였다. 그 결과, Grim19로 형질전환된 세포에서 갈색지방 유전자의 발현이 대조군에 비해 모두 증가되어 있었고, 이로부터 Grim19에 의해 갈색지방으로 유도될 수 있음을 확인하였다(도 10d 및 도 10e).
실시예 9. 스트레스 상태에서의 갈색지방 유전자의 변화 조사
Grim19 TG 마우스와 대조군인 C57BL/6 마우스에 정상 사료와 고지방 사료를 11주간 먹여서 비만을 유도하였고, 이 후 4℃에 15시간 노출시킨 후 희생시켰다. 복부지방에서 RNA를 얻어 cDNA로 합성한 후 상기 실시예 8과 동일한 방식으로 갈색지방에서 발현하는 유전자를 실시간 PCR로 조사하였다.
그 결과, 갈색지방 유전자가 대조군에 비해 모두 증가되어 있음을 확인하였다(도 11a 및 도 11b). 상기 결과는 갈색 지방이 생성될 수 있는 상태에서 Grim19에 의해 갈색 지방 유전자의 발현이 촉진된다는 것을 나타내며, 이로부터 Grim19에 의해 갈색 지방이 증가될 수 있음을 알 수 있었다.
실시예 10. Grim19를 이용한 고지혈증후군 억제 효과 조사
동맥경화반(Artherosclerotic plaque)의 형성에서 대식세포가 혈관벽에 존재하는 ROS(Reactive Oxygen Species)에 의해 산화된 지질에 의해서 거품 세포(foam cell)로 활성화되면서 동맥경화는 시작된다. 동맥경화를 유발하는 동맥경화반의 전구세포인 대식세포의 세포주인 THP1 세포를 2×105 씩 48-웰 플레이트에 24시간 배양한 후, 세포를 활성화시키기 위해 PMA 160 nM을 처리하였다. 24시간 후 동맥경화를 유발하는 동맥경화반 전구세포를 형성시키기 위해서 PAF를 10㎍/㎖ 처리함과 동시에 Grim19가 과발현될 수 있도록 형질전환시켰다. 24시간 배양한 후 오일 레드 오 염색을 진행하였다. 이때 오일 레드 오 염색 후 붉은색으로 발현하는 세포가 거품 세포가 형성된 세포이다.
그 결과, Grim19를 형질전환시킨 세포에서 거품 세포가 억제되는 것을 확인하였다(도 12).
이제까지 본 발명에 대하여 그 바람직한 실시예들을 중심으로 살펴보았다. 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자는 본 발명의 본질적인 특성에서 벗어나지 않는 범위에서 변형된 형태로 구현될 수 있음을 이해할 수 있을 것이다. 그러므로 개시된 실시예들은 한정적인 관점이 아니라 설명적인 관점에서 고려되어야 한다. 본 발명의 범위는 전술한 설명이 아니라 특허청구범위에 나타나 있으며, 그와 동등한 범위 내에 있는 모든 차이점은 본 발명에 포함된 것으로 해석되어야 할 것이다.

Claims (11)

  1. Grim19 단백질을 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  2. 청구항 1에 있어서,
    상기 지질 관련 대사성 질환은 당뇨, 고지혈증, 동맥경화, 고혈압, 심혈관 질환, 지방간, 비만유래 염증질환, 비만 유래 자가면역질환 및 비만 유래 암 질환으로 이루어진 군으로부터 선택되는 것을 특징으로 하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  3. 청구항 1에 있어서,
    상기 Grim19 단백질은 서열번호 1로 표시되는 아미노산 서열을 갖는 것을 특징으로 하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  4. 청구항 1에 있어서,
    상기 Grim19는 체중 감소, 지방세포 감소, 체내 총 콜레스테롤의 함량 감소 및 백색지방의 갈색지방으로의 전환 효과를 갖는 것을 특징으로 하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  5. 청구항 1의 Grim19 단백질 또는 상기 단백질을 암호화하는 폴리뉴클레오티드를 유효성분으로 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  6. 청구항 5에 있어서,
    상기 질환은 당뇨, 고지혈증, 동맥경화, 고혈압, 심혈관 질환, 지방간, 비만 유래 염증질환, 비만 유래 자가면역질환, 비만 유래 암 질환으로 이루어진 군으로부터 선택되는 것을 특징으로 하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  7. 청구항 5에 있어서,
    상기 폴리뉴클레오티드는 서열번호 2 또는 서열번호 3으로 표시되는 염기서열을 갖는 것을 특징으로 하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  8. 청구항 5에 있어서,
    상기 폴리뉴클레오티드는 발현 벡터 내에 포함되어 있는 것을 포함하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  9. 청구항 8에 있어서,
    상기 발현 벡터가 플라스미드 또는 바이러스성 벡터인 것을 특징으로 하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 약학적 조성물.
  10. (a) Grim19 단백질 또는 상기 단백질을 발현하는 재조합 세포와 후보물질을 배양하는 단계; 및
    (b) Grim19 단백질의 활성 또는 세포 내 수준 증가에 미치는 효과를 측정하는 단계를 포함하는, 비만 또는 지질 관련 대사성 질환 치료제 스크리닝 방법.
  11. 청구항 10에 있어서,
    상기 Grim19 단백질의 활성 또는 세포 내 수준은 면역침전법(coimmunoprecipitation), 방사능면역분석법(RIA), 효소면역분석법(ELISA), 면역조직화학, 웨스턴 블롯(Western Blotting) 또는 유세포 분석법(FACS)으로 측정하는 것을 특징으로 비만 또는 지질 관련 대사성 질환 치료제 스크리닝 방법.
PCT/KR2013/007908 2012-09-05 2013-09-02 Grim19를 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물 WO2014038823A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/426,324 US20150297676A1 (en) 2012-09-05 2013-09-02 Composition comprising grim-19 as active ingredient for preventing or treating obesity or lipid-related metabolic diseases

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020120098140A KR101724169B1 (ko) 2012-09-05 2012-09-05 Grim19를 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물
KR10-2012-0098140 2012-09-05

Publications (1)

Publication Number Publication Date
WO2014038823A1 true WO2014038823A1 (ko) 2014-03-13

Family

ID=50237385

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2013/007908 WO2014038823A1 (ko) 2012-09-05 2013-09-02 Grim19를 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물

Country Status (3)

Country Link
US (1) US20150297676A1 (ko)
KR (1) KR101724169B1 (ko)
WO (1) WO2014038823A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101656931B1 (ko) 2014-07-07 2016-09-12 계명대학교 산학협력단 Idh2를 유효성분으로 함유하는 비만 또는 비만 매개 대사성 질환의 예방 또는 치료용 조성물

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005118860A2 (en) * 2004-04-09 2005-12-15 General Hospital Corporation Compositions and methods related to an intestinal inflammation and uses therefor
US20060115836A1 (en) * 2003-04-16 2006-06-01 Galderma Research & Development, S.N.C. Utilization of FANCC, DAD1, GRIM19 and HADHII genes for the ultimate treatment of psoriasis
WO2013003595A1 (en) * 2011-06-29 2013-01-03 Biorestorative Therapies, Inc. Brown fat cell compositions and methods

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20040062832A (ko) 2003-01-03 2004-07-09 학교법인 경희대학교 비만 치료 또는 예방용 및, 비만과 관련된 유전자,단백질, 세포 발현 조절용 한약 추출물을 포함하는약제학적 조성물
KR20060057337A (ko) 2004-11-23 2006-05-26 주식회사 두산 포스포리피드를 함유하는 단백질 티로신 포스파타제 1비억제제 및 이를 이용한 당뇨병, 비만 예방 및 치료용 조성물
KR101215670B1 (ko) * 2010-02-08 2012-12-26 가톨릭대학교 산학협력단 Grim19을 유효성분으로 함유하는 면역질환의 예방 또는 치료용 조성물
KR101948934B1 (ko) * 2012-02-03 2019-02-18 가톨릭대학교 산학협력단 세포투과성을 갖는 R12 - Grim19 융합 펩타이드 및 이를 유효성분으로 함유하는 면역질환의 예방 또는 치료용 조성물

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060115836A1 (en) * 2003-04-16 2006-06-01 Galderma Research & Development, S.N.C. Utilization of FANCC, DAD1, GRIM19 and HADHII genes for the ultimate treatment of psoriasis
WO2005118860A2 (en) * 2004-04-09 2005-12-15 General Hospital Corporation Compositions and methods related to an intestinal inflammation and uses therefor
WO2013003595A1 (en) * 2011-06-29 2013-01-03 Biorestorative Therapies, Inc. Brown fat cell compositions and methods

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
POLLARD, JR. ET AL.: "A computational model to define the molecular causes of type 2 diabetes mellitus", DIABETES TECHNOLOGY & THERAPEUTICS, vol. 7, no. 2, 2005, pages 323 - 336 *
SHULGA ET AL.: "GRIM-19-mediated translocation of STAT3 to mitochondria is necessary for TNF-induced necroptosis", JOURNAL OF CELL SCIENCE, vol. 125, no. 12, 15 June 2012 (2012-06-15), pages 2995 - 3003 *
SOUZA DE OLIVEIRA ET AL.: "Hepatic gene expression profile associated with non-alcoholic steatohepatitis protection by S-nitroso-N-acetylcysteine in ob/ob mice", JOURNAL OF HEPATOLOGY, vol. 45, no. 5, 2006, pages 725 - 733 *

Also Published As

Publication number Publication date
KR20140031614A (ko) 2014-03-13
KR101724169B1 (ko) 2017-04-06
US20150297676A1 (en) 2015-10-22

Similar Documents

Publication Publication Date Title
AU2020336649B2 (en) Akkermansia muciniphila EB-AMDK19 strainand use thereof
WO2021215627A1 (ko) 락토바실러스 플란타룸 atg-k2 또는 atg-k6를 함유하는 지질관련 대사성 질환의 예방 및 치료용 조성물
AU2020339348B2 (en) Akkermansia muciniphila EB-AMDK27 strain and use thereof
WO2019199094A1 (ko) 비만의 예방 또는 치료 효과를 가지는 신규 비피도박테리움 롱검 균주 또는 락토바실러스 람노서스 균주 및 이의 용도
WO2018030879A1 (ko) 아모디아퀸 및 항당뇨 약물을 유효성분으로 함유하는 당뇨병의 예방 또는 치료용 약학적 조성물
WO2016093599A1 (ko) 박테로이데스 에시디페시언스를 유효성분으로 포함하는, 대사성 질환 예방 또는 치료용 약학적 조성물
WO2021261632A1 (ko) 신규한 피칼리박테리움 프로스니치 균주 eb-fpdk11 및 그의 용도
WO2022131428A1 (ko) 오를리스타트 및 아커만시아 뮤시니필라 eb-amdk19 균주를 포함하는 조성물
WO2019088379A1 (ko) 신규 유산균 및 이의 용도
Kou et al. LIGHT/TNFSF14 signaling attenuates beige fat biogenesis
WO2022131791A1 (ko) 다중구리 산화효소 펩타이드를 포함하는 구리대사 관련 신경계 질환의 예방 또는 치료용 조성물
WO2009093864A2 (ko) 뇌질환의 예방 또는 치료용 조성물
WO2016048005A2 (ko) 신규한 펜타디에노일 피페리딘 유도체 및 그의 용도
WO2014038823A1 (ko) Grim19를 유효성분으로 함유하는 비만 또는 지질 관련 대사성 질환의 예방 또는 치료용 조성물
JP6890798B2 (ja) 炎症性腸疾患の予防又は治療用組成物
WO2020116810A1 (ko) Fas 신호전달 억제용 펩티드를 포함하는 비만, 지방간 또는 지방간염의 예방 또는 치료용 약학적 조성물
WO2016133352A1 (ko) 아모디아퀸을 유효성분으로 함유하는 대사성 질환의 예방, 개선, 또는 치료용 조성물
WO2021033995A1 (ko) 초과 추출물을 함유하는 근육 감소 관련 질병의 예방, 개선, 또는 치료용 조성물
WO2021020923A1 (ko) 간 손상 예방, 개선, 또는 치료용 조성물 및 간 손상 예방, 개선, 또는 치료방법
WO2021246755A1 (ko) 포스포리파아제 d2 억제제를 포함하는 대사성 질환의 예방, 개선 또는 치료용 조성물
WO2015111971A1 (ko) Gpr119 리간드를 유효성분으로 포함하는 비알콜성 지방간 질환의 예방 또는 치료용 약학적 조성물
WO2023219460A1 (ko) 락토바실러스 퍼멘텀 균주 및 대사조절제를 포함하는 병용 요법을 이용한 대사질환 예방 또는 치료용 조성물
WO2023229282A1 (ko) 락토바실러스 쿤케이 nchbl-003 균주 또는 이의 배양액을 포함하는 대사성 질환 예방, 치료 또는 개선용 조성물
WO2022102988A1 (ko) 남극 지의류 아만디네아 추출물의 제조방법 및 아만디네아 추출물을 포함하는 조성물
WO2019035644A1 (ko) 모노아세틸디아실글리세롤 화합물을 함유하는 슈도모나스 속 미생물 감염증의 예방 또는 치료용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13835592

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 14426324

Country of ref document: US

122 Ep: pct application non-entry in european phase

Ref document number: 13835592

Country of ref document: EP

Kind code of ref document: A1