WO2013043933A2 - Cd27l antigen binding proteins - Google Patents
Cd27l antigen binding proteins Download PDFInfo
- Publication number
- WO2013043933A2 WO2013043933A2 PCT/US2012/056429 US2012056429W WO2013043933A2 WO 2013043933 A2 WO2013043933 A2 WO 2013043933A2 US 2012056429 W US2012056429 W US 2012056429W WO 2013043933 A2 WO2013043933 A2 WO 2013043933A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- set forth
- amino acid
- deletions
- substitutions
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2875—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
- A61K31/5365—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines ortho- or peri-condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/04—Drugs for skeletal disorders for non-specific disorders of the connective tissue
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the field of this invention relates to compositions of antigen binding proteins including antibodies capable of binding CD27L, as well as related methods.
- CD27L (CD70, TNFSF7) is a type II integral membrane protein whose expression on normal tissues is highly restricted to a subset of activated T and B cells, dendritic cells and to a small subset of cells in the thymic epithelium.
- the biological functions of CD27L which include augmentation or regulation of the immune response, are mediated via binding to its receptor, CD27, which is expressed predominately on lymphoid cells.
- CD27L/CD27 interactions regulate B-cell proliferation and differentiation and T-cell costimulation/activation. Disruption of the CD27L/CD27 interaction in mice deficient for CD27 does not result in any phenotype in the absence of an immune challenge.
- CD27L is expressed at relatively high levels in some B cell non-Hodgkin's lymphoma (B-NHL) tumor subtypes, in pre-B cell acute lymphocytic leukemia (ALL) and in B cell type-chronic lymphocytic leukemia (B-CLL).
- B-NHL B cell non-Hodgkin's lymphoma
- ALL pre-B cell acute lymphocytic leukemia
- B-CLL B cell type-chronic lymphocytic leukemia
- CD27L comes close to exhibiting properties consistent with those of a "tumor specific antigen" (Grewal, Expert Opin. Ther. Targets. 12, 341-351 (2008)).
- the B-NHL subsets of diffuse large cell B-cell lymphoma (DLBCL) and follicular lymphoma (FL) show the highest incidence of expression ranging from 33% for FL to 71% for DLBCL as assessed by IHC on frozen sections using a validated antibody (Lens et al., Brit. J.
- B-CLL tumors also express CD27L as assessed by IHC on frozen tumor sections or by flow cytometry on circulating tumor cells (Ranheim et al, Blood 85, 3556-3565 (1965); Trentin et al, Cancer Res. 57, 4940-4947 (1997)).
- the invention provides anti-CD27L antigen binding proteins, e.g., antibodies and functional fragments thereof.
- the anti-CD27L antigen binding proteins are particularly useful in methods of treating diseases and disorders associated with aberrant cell proliferation, e.g., cancer, and/or with inflammation.
- the CD27L antigen binding protein comprises a) a light chain variable domain having at least 90% identity, at least 95% identity, or is identical to the amino acid sequence set forth in SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, or SEQ ID NO:70; b) a heavy chain variable domain having at least 90% identity, at least 95% identity, or is identical to the amino acid sequence set forth in SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:21 , SEQ ID NO:22, SEQ ID NO:23, or SEQ ID NO:24; or c) the light chain variable domain of a) and the heavy chain variable domain of b).
- Preferred antigen binding proteins of the first aspect include those comprising a light chain variable domain having at least 90%, at least 95%, or is identical to the amino acid sequence set forth in SEQ ID NO: 63 and a heavy chain variable domain having at least 90%, at least 95%, or is identical to the amino acid sequence set forth in SEQ ID NO: 17; those comprising a light chain variable domain having at least 90%, at least 95%, or is identical to the amino acid sequence set forth in SEQ ID NO: 64 and a heavy chain variable domain having at least 90%, at least 95%, or is identical to the amino acid sequence set forth in SEQ ID NO: 18; those comprising a light chain variable domain having at least 90%, at least 95%, or is identical to the amino acid sequence set forth in SEQ ID NO:65 and a heavy chain variable domain having at least 90%, at least 95%, or is identical to the amino acid sequence set forth in SEQ ID NO: 19; those comprising a light chain variable domain having at least 90%, at least 95%, or is identical to the amino acid sequence set forth
- the CD27L antigen binding protein comprises a) a light chain variable domain having no more than ten or no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO: 63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, or SEQ ID NO:70; b) a heavy chain variable domain having no more than ten or no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:21 , SEQ ID NO:22, SEQ ID NO:23, or SEQ ID NO:24; or c) the light chain variable domain of a) and the heavy chain variable domain of b).
- Preferred antigen binding proteins of the second aspect include those comprising a light chain variable domain having no more than ten or no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO:63 and a heavy chain variable domain having no more than ten or no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO: 17; those comprising a light chain variable domain having no more than ten or no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO: 64 and a heavy chain variable domain having no more than ten or no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO: 18; those comprising a light chain variable domain having no more than ten or no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO:65 and a heavy chain variable domain having no more than ten or no more than five amino acid additions, deletions
- the CD27L antigen binding protein contains a light chain variable domain comprising a) an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:71; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO:79; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO: 87; b) an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:72; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO:80; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO:88; c) an LCDR1 having no more than three
- Preferred CD27L antigen binding proteins of third aspect include those comprising the light chain variable domain of a) and the heavy chain variable domain of i); those comprising the light chain variable domain of b) and the heavy chain variable domain of j); those comprising the light chain variable domain of c) and the heavy chain variable domain of k); those comprising the light chain variable domain of d) and the heavy chain variable domain of 1); those comprising the light chain variable domain of e) and the heavy chain variable domain of m); those comprising the light chain variable domain of f) and the heavy chain variable domain of n); those comprising the light chain variable domain of g) and the heavy chain variable domain of o); and those comprising the light chain variable domain of h) and the heavy chain variable domain of p).
- the CD27L antigen binding protein of the first, second, or third aspect binds to human CD27L with an affinity of less than or equal to 2 x 10 "11 M.
- the CD27L antigen binding protein of the first, second, third, or fourth aspect inhibits binding of CD27L to CD27.
- the CD27L antigen binding protein of the first, second, third, fourth, or fifth aspect is an antibody, such as a human antibody.
- Preferred antibodies include those antibodies that comprise a light chain having the amino acid sequence set forth in SEQ ID:56 and a heavy chain having the amino acid sequence set forth in SEQ ID NO: 10; those that comprise a light chain having the amino acid sequence set forth in SEQ ID:57 and a heavy chain having the amino acid sequence set forth in SEQ ID NO: l 1; those that comprise a light chain having the amino acid sequence set forth in SEQ ID:58 and a heavy chain having the amino acid sequence set forth in SEQ ID NO: 12; those that comprise a light chain having the amino acid sequence set forth in SEQ ID:59 and a heavy chain having the amino acid sequence set forth in SEQ ID NO: 13; those that comprise a light chain having the amino acid sequence set forth in SEQ ID:60 and a heavy chain having the amino acid sequence set forth in SEQ ID NO: 14; those that comprise a light chain having the amino acid sequence set
- a CD27L antigen binding protein of the first, second, third, fourth, fifth, or sixth aspect is conjugated to a drug or chemotherapeutic agent.
- the drug or chemotherapeutic agent is conjugated to the antigen binding protein, e.g. antibody, using a linker.
- Preferred linkers include non-cleavable linkers such as MCC.
- a preferred chemotherapeutic agent is DM1.
- the seventh aspect provides a CD27L antigen binding protein of the first, second, third, fourth, fifth, or sixth aspect conjugated to DM1 by a MCC linker attached to one or more lysine residues.
- the average number of DM1 molecules per CD27L antigen binding protein, e.g. antibody is between 1 and 10, between 3 and 7, or between 4 and 6.
- the composition of CD27L antigen binding proteins of the first, second, third, fourth, fifth, sixth, or seventh aspect of this invention has an average number of DM1 molecules per CD27L antigen binding protein of about 4.0, about 4.1 , about 4.2, about 4.3, about 4.4, about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5.0, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9, or about 6.0.
- Such a composition may contain a therapeutically effective amount of the CD27L antigen binding protein and may be lyophilized.
- the invention provides isolated nucleic acids encoding one or more polypeptide components of a CD27L antigen binding protein, e.g., an antibody light chain or antibody heavy chain.
- a CD27L antigen binding protein e.g., an antibody light chain or antibody heavy chain.
- the nucleic acid encodes a polypeptide comprising:
- a heavy chain variable domain having at least 95% identity to the amino acid sequence set forth in SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:21 , SEQ ID NO:22, SEQ ID NO:23, or SEQ ID NO:24;
- a light chain variable domain having no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO: 63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, or SEQ ID NO:70;
- a heavy chain variable domain having no more than five amino acid additions, deletions or substitutions from the amino acid sequence set forth in SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:21 , SEQ ID NO:22, SEQ ID NO:23, or SEQ ID NO:24;
- an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:71; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO:79; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO:87;
- an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:72; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO: 80; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO:88;
- an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:73; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO:81; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO:89;
- an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:74; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO: 82; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO:90;
- an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:75; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO: 83; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO:91;
- an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:77; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO: 85; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO:93; or
- an LCDR1 having no more than three amino acid additions, deletions, or substitutions from the LCDR1 sequence set forth in SEQ ID NO:78; an LCDR2 having no more than three amino acid additions, deletions, or substitutions from the LCDR2 sequence set forth in SEQ ID NO: 86; and an LCDR3 having no more than three amino acid additions, deletions, or substitutions from the LCDR3 sequence set forth in SEQ ID NO:94; or
- a heavy chain variable domain comprising:
- an HCDR1 having no more than three amino acid additions, deletions, or substitutions from the HCDR1 sequence set forth in SEQ ID NO:25; an HCDR2 having no more than three amino acid additions, deletions, or substitutions from the HCDR2 sequence set forth in SEQ ID NO:33; and an HCDR3 having no more than three amino acid additions, deletions, or substitutions from the HCDR3 sequence set forth in SEQ ID NO:41;
- an HCDR1 having no more than three amino acid additions, deletions, or substitutions from the HCDR1 sequence set forth in SEQ ID NO:26; an HCDR2 having no more than three amino acid additions, deletions, or substitutions from the HCDR2 sequence set forth in SEQ ID NO: 34; and an HCDR3 having no more than three amino acid additions, deletions, or substitutions from the HCDR3 sequence set forth in SEQ ID NO:42;
- an HCDR1 having no more than three amino acid additions, deletions, or substitutions from the HCDR1 sequence set forth in SEQ ID NO:27; an HCDR2 having no more than three amino acid additions, deletions, or substitutions from the HCDR2 sequence set forth in SEQ ID NO:35; and an HCDR3 having no more than three amino acid additions, deletions, or substitutions from the HCDR3 sequence set forth in SEQ ID NO:43;
- an HCDR1 having no more than three amino acid additions, deletions, or substitutions from the HCDR1 sequence set forth in SEQ ID NO:28; an HCDR2 having no more than three amino acid additions, deletions, or substitutions from the HCDR2 sequence set forth in SEQ ID NO:36; and an HCDR3 having no more than three amino acid additions, deletions, or substitutions from the HCDR3 sequence set forth in SEQ ID NO:44;
- an HCDR1 having no more than three amino acid additions, deletions, or substitutions from the HCDR1 sequence set forth in SEQ ID NO:29; an HCDR2 having no more than three amino acid additions, deletions, or substitutions from the HCDR2 sequence set forth in SEQ ID NO:37; and an HCDR3 having no more than three amino acid additions, deletions, or substitutions from the HCDR3 sequence set forth in SEQ ID NO:45;
- the polypeptide encodes an antibody light chain and is at least 80%, at least 90%, at least 95%, or is 100% identical to the nucleotide sequence set forth in SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51 , SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, or SEQ ID NO:55.
- the polypeptide encodes an antibody heavy chain and is at least 80%, at least 90%), at least 95%, or is 100% identical to the nucleotide sequence set forth in SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, or SEQ ID NO:9.
- the invention provides an expression vector comprising one or more isolated nucleic acids of the eighth aspect.
- the expression vector encodes an antibody light chain, an antibody heavy chain, or both an antibody light chain and a heavy chain.
- the invention provides a recombinant host cell comprising one or more isolated nucleic acids of the eighth aspect operably linked to a promoter, including recombinant host cells comprising one or more expression vectors of the ninth aspect of the invention.
- the recombinant host cell secretes an antibody that binds CD27L.
- Preferred host cells are mammalian host cells, including CHO cell lines.
- the invention provides methods of making a CD27L antibody drug conjugate of the seventh aspect by conjugating a linker and drug, e.g., chemotherapeutic agent, to any of the CD27L antigen binding proteins of the first, second, third, fourth, fifth, or sixth aspects.
- the linker and drug may be connect first and then conjugated to the CD27L antigen binding protein or the linker may be first conjugated to the CD27L antigen binding protein then connected to the drug.
- the linker is MCC and the drug is DM1.
- the CD27L antigen binding protein is an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO:63 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 17 (e.g., Abl), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 64 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 18 (e.g., Ab2), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 65 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 19 (e.g., Ab3), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 66 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO:20 (e.g., Ab4), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO:67 and a heavy chain variable domain amino acid sequence amino acid sequence
- the invention provides methods of treating cancer comprising administering to a patient a therapeutically effective amount of a composition comprising a therapeutically effective amount of a CD27L antigen binding protein of the first, second, third, fourth, fifth, or sixth aspect.
- the CD27L antigen binding protein is an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO:63 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 17 (e.g., Abl), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 64 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 18 (e.g., Ab2), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO:65 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 19 (e.g., Ab3), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 66 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO:20 (e.g., Ab4), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 67 and a heavy chain variable domain amino acid sequence as set
- the CD27L antigen binding protein is conjugated to a chemotherapeutic agent (e.g., DM1) by a linker (MCC).
- a chemotherapeutic agent e.g., DM1
- MCC linker
- the antibody comprises enhanced effector function.
- the CD27L antigen binding protein is administered to a patient having renal cell carcinomas (RCC), clear cell RCC, head and neck cancer, glioblastoma, breast cancer, brain tumor, nasopharangeal carcinoma, non-Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), Burkitt's lymphoma, anaplastic large-cell lymphomas (ALCL), multiple myeloma, cutaneous T-cell lymphomas, nodular small cleaved-cell lymphomas, lymphocytic lymphomas, peripheral T-cell lymphomas, Lennert's lymphomas, immunoblastic lymphoma, T-cell leukemia/lymphomas (ATLL), adult T-cell leukemia (T-ALL), entroblastic/centrocytic (cb/cc) follicular lymphoma cancer, diffuse large cell lymphoma of
- a sample from a patient is tested for CD27L expression prior to administering the CD27L antigen binding protein.
- CD27L expression may be determined by testing for the presence of CD27L-encoding RNA or for the presence of CD27L protein in the sample.
- the sample may be a blood sample or biopsy.
- the invention provides methods of treating an autoimmune or inflammatory disorder said method comprising administering a therapeutically effective amount of a CD27L antigen binding protein of any one of the first, second, third, fourth, fifth, or sixth aspects to a patient in need thereof.
- a CD27L antigen binding protein of any one of the first, second, third, fourth, fifth, or sixth aspects
- the CD27L antigen binding protein is an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO:63 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 17 (e.g., Abl), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 64 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 18 (e.g., Ab2), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 65 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO: 19 (e.g., Ab3), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO: 66 and a heavy chain variable domain amino acid sequence as set forth in SEQ ID NO:20 (e.g., Ab4), an antibody comprising a light chain variable domain amino acid sequence as set forth in SEQ ID NO:67 and a heavy chain variable domain amino acid sequence as set forth
- the CD27L antigen binding protein inhibits binding of CD27 to CD27L.
- the autoimmune or inflammatory disorder is systemic lupus erythematosus (SLE), insulin dependent diabetes mellitus (IDDM), inflammatory bowel disease (IBD), multiple sclerosis (MS), psoriasis, autoimmune thyroiditis, rheumatoid arthritis (RA), or glomerulonephritis.
- treatment inhibits or prevents transplant rejection or graft versus host disease in the patient.
- FIG. 1 Summary of functional and physical characteristics of exemplary embodiments of CD27L antigen binding proteins.
- FIG. 2 Measurement of the level and the rate of internalization of Ab4 (A4) and Ab8 (A8) and their conjugated counterparts into 786-0 cells over time (A).
- FIG. 3. 786-0 cells were cultured for 4 days in the presence of increasing concentrations of anti streptavidin-MCC-DMl , Ab4-MCC-DMl and Ab8-MCC-DMl . Effect on cell growth was measured using the CELL-TITER-GLO reagent that measures cell number using a luminescent read-out.
- FIG. 4 Dose response of Ab4-MCC-DMl and Ab8-MCC-DMl in the 786-0 xenograft model. Intravenous dose on day 24 is denoted by arrow at the indicated doses.
- FIG. 5. Dose response of Ab4-MCC-DMl and Ab8-MCC-DMl in the Caki-1 xenograft model. Intravenous dosing schedule is denoted by the arrows.
- FIG. 6 Dose response of Ab4-MCC-DMl in the Raji xenograft model.
- the intravenous dosing schedule is denoted by the arrows.
- FIG. 7. Variable dose response of Ab4-MCC-DMl in the 786-0 xenograft model.
- FIG. 8. Ab4-MCC-DMl Antibody Dependent Cell Cytotoxicity (ADCC) Assay against Raji tumor cells.
- ADCC Antibody Dependent Cell Cytotoxicity
- FIG. 9 Ab4-MCC-DMl Antibody Dependent Cellular Phagocytosis (ADCP) Assay against both Raji and 786-0 tumor cells.
- ADCP Antibody Dependent Cellular Phagocytosis
- FIG. 10 Comparison of CD27L expression for primary frozen tumor samples that scored "positive” by masked IHC. The results indicate that overall CD27L protein expression is highest in ccRCC patient samples, followed by DLBCL (Diffuse Large B- Cell Lymphoma); B-CLL and FL samples.
- FIG. 11 Results of CD27L mRNA and Protein Expression Analysis. The results indicate that there is a high prevalence of CD27L expression in RCC, B-NHL and CLL cells.
- FIG. 12 Sets forth the structure of the Ab-MCC-DMl ADCs described in Example 2 herein.
- Standard techniques may be used for recombinant DNA, oligonucleotide synthesis, tissue culture and transformation, protein purification, etc.
- Enzymatic reactions and purification techniques may be performed according to the manufacturer's specifications or as commonly accomplished in the art or as described herein.
- the following procedures and techniques may be generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the specification. See, e.g., Sambrook et ah, 2001 , Molecular Cloning: A Laboratory Manuel, 3 rd ed., Cold Spring Harbor Laboratory Press, cold Spring Harbor, N.Y., which is incorporated herein by reference for any purpose.
- the antigen binding proteins bind to CD27L, which is also known as CD70 and TNFSF7.
- CD27L was first described in US Pat. No. 5,573,924.
- An exemplary human CD27L amino acid sequence is provided herein as SEQ ID NO : 1 , which corresponds to NCBI Reference Sequence NP 001423.1 (GL4507605).
- the antigen binding protein blocks the interaction of CD27L with its receptor CD27.
- An exemplary CD27 amino acid sequence is provided as SEQ ID NO:2, which corresponds to Swiss-Prot: P26842.2 (GL269849546).
- a mature CD27 amino acid sequence corresponds to amino acids 20-260 of SEQ ID NO:2.
- the present invention provides antigen binding proteins that specifically bind CD27L.
- Embodiments of antigen binding proteins comprise peptides and/or
- polypeptides that specifically bind CD27L Such peptides or polypeptides may optionally include one or more port-translational modification.
- Embodiments of antigen binding proteins comprise antibodies and fragments thereof, as variously defined herein, that specifically bind CD27L. These include antibodies that specifically bind human CD27L, including those that inhibit CD27L from binding and/or activating CD27.
- the antigen binding proteins of the invention specifically bind to CD27L.
- Specifically binds as used herein means that the antigen binding protein preferentially binds CD27L over other proteins. In some embodiments "specifically binds” means the CD27L antigen binding protein has a higher affinity for CD27L than for other proteins.
- CD27L antigen binding proteins that specifically bind CD27L may have a binding affinity for human CD27L of less than or equal to 1 x 10 ⁇ 7 M, less than or equal to 2 x 10 " 7 M, less than or equal to 3 x 10 "7 M, less than or equal to 4 x 10 "7 M, less than or equal to 5 x 10 "7 M, less than or equal to 6 x 10 "7 M, less than or equal to 7 x 10 "7 M, less than or equal to 8 x 10 "7 M, less than or equal to 9 x 10 "7 M, less than or equal to 1 x 10 "8 M, less than or equal to 1 x 10 "8 M, less
- CD27L-binding fragment comprises any of the antibody fragments or domains described herein that retains the ability to specifically bind to CD27L.
- the CD27L-binding fragment may be in any of the scaffolds described herein.
- a CD27L antigen binding protein inhibits binding of CD27L to CD27 and/or inhibits one or more biological activities associated with the binding of CD27L to CD27, e.g., CD27-mediated signaling.
- Such antigen binding proteins are said to be "neutralizing.”
- the neutralizing CD27L antigen binding protein specifically binds CD27L and inhibits binding of CD27L to CD27 from anywhere between 10% to 100%, such as by at least about 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61 , 62, 63, 64, 65, 66, 67, 68, 69, 70, 71 , 72, 73, 74, 75, 76, 77, 78, 79, 80,
- CD27L antigen binding proteins may be tested for neutralizing ability by determining the ability of the antigen binding protein to block binding of CD27-Fc to MP-1 cells (Slack et al, Int. Immunol. (1995) 7(7): 1087-1092)).
- Embodiments of antigen binding proteins comprise a scaffold structure, as variously defined herein, with one or more complementarity determining regions (CDRs). Embodiments further include antigen binding proteins comprising a scaffold structure with one or more antibody variable domains, either heavy or light.
- CDRs complementarity determining regions
- Embodiments include antibodies that comprise a light chain variable domain selected from the group consisting of Abl Light Chain Variable Domain (LCv), Ab2 LCv, Ab3 LCv, Ab4 LCv, Ab5 LCv, Ab6 LCv, Ab7 LCv, and Ab8 LCv (SEQ ID NO:63-70, respectively) and/or a heavy chain variable domain selected from the group consisting of Abl Heavy Chain Variable Domain (HCv), Ab2 HCv, Ab3 HCv, Ab4 HCv, Ab5 HCv, Ab6 HCv, Ab7 HCv, and Ab8 HCv (SEQ ID NO: 17-24, respectively), and fragments, derivatives, muteins, and variants thereof.
- LCv Abl Light Chain Variable Domain
- HCv Ab2 HCv
- Ab3 HCv Ab4 HCv
- Ab5 HCv Ab6 HCv
- Ab7 HCv Ab7 HCv
- Ab8 HCv Ab8 HCv
- An exemplary light chain comprising Abl LCv is a light chain comprising the amino acid sequence set forth in SEQ ID NO:56.
- An exemplary light chain comprising Ab2 LCv is a light chain comprising the amino acid sequence set forth in SEQ ID NO:57.
- An exemplary light chain comprising Ab4 LCv is a light chain comprising the amino acid sequence set forth in SEQ ID NO: 58.
- An exemplary light chain comprising Ab5 LCv is a light chain comprising the amino acid sequence set forth in SEQ ID NO:59.
- An exemplary light chain comprising Ab6 LCv is a light chain comprising the amino acid sequence set forth in SEQ ID NO:60.
- An exemplary light chain comprising Ab7 LCv is a light chain comprising the amino acid sequence set forth in SEQ ID NO: 61.
- An exemplary light chain comprising Ab8 LCv is a light chain comprising the amino acid sequence set forth in SEQ ID NO: 62.
- An exemplary heavy chain comprising Ab 1 HCv is a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 10.
- An exemplary heavy chain comprising Ab2 HCv is a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 11.
- An exemplary heavy chain comprising Ab4 HCv is a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 12.
- An exemplary heavy chain comprising Ab5 HCv is a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 13.
- An exemplary heavy chain comprising Ab6 HCv is a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 14.
- An exemplary heavy chain comprising Ab7 HCv is a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 15.
- An exemplary heavy chain comprising Ab8 HCv is a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 16.
- scaffolds that are envisioned include: fibronectin, neocarzinostatin CBM4-2, lipocalins, T-cell receptor, protein -A domain (protein Z), Im9, TPR proteins, zinc finger domains, pVIII, avian pancreatic polypeptide, GCN4, WW domain Src homology domain 3, PDZ domains, TEM-1 beta- lactamase, thioredoxin, staphylococcal nuclease, PHD-fmger domains, CL-2, BPTI, APPI, HPSTI, ecotin, LACI-D1, LDTI, MTI-II, scorpion toxins, insect defensin-A peptide, EETI-II, Min-23, CBD, PBP, cytochrome b-562, Ldl receptor domains, gamma-crystallin, ubiquitin, transferrin, and or C-type lectin-like domains.
- Non-antibody scaffolds and their use as therapeutics are reviewed in Gebauer and Skerra, Curr. Opin. Chem. Biol, 13:245-255 (2009) and Binz et al, Nat. Biotech., 23(10): 1257-1268 (2005), which are incorporated herein by reference in its entirety.
- aspects of the invention include antibodies comprising the following variable domains: Abl LCv/Abl HCv (SEQ ID NO:63/SEQ ID NO: 17), Ab2 LCv/Ab2 HCv (SEQ ID NO:64/SEQ ID NO: 18), Ab3 LCv/Ab3 HCv (SEQ ID NO:65/SEQ ID NO: 19), Ab4 LCv/Ab4 HCv (SEQ ID NO:66/SEQ ID NO:20), Ab5 LCv/Ab5 HCv (SEQ ID NO:67/SEQ ID NO:21), Ab6 LCv/Ab6 HCv (SEQ ID NO:68/SEQ ID NO:22), Ab7 LCv/Ab7 HCv (SEQ ID NO:69/SEQ ID NO:23), Ab8 LCv/Ab8 HCv (SEQ ID NO:70/SEQ ID NO:24), and combinations thereof, as well as fragments, derivatives, muteins and variants thereof.
- Exemplary antibodies of the invention include Abl (SEQ ID NO:56/SEQ ID NO: 10), Ab2 (SEQ ID NO:57/SEQ ID NO: 11), Ab4 (SEQ ID NO:58/SEQ ID NO: 12), Ab5 (SEQ ID NO:59/SEQ ID NO: 13), Ab6 (SEQ ID NO:60/SEQ ID NO: 14), Ab7 (SEQ ID NO:61/SEQ ID NO: 15), Ab8 (SEQ ID NO:62/SEQ ID NO: 16).
- each variable domain of an antibody light or heavy chain comprises three CDRs.
- the heavy chain variable domain comprises a heavy chain CDRl
- the light chain variable domain comprises a light chain CDRl (LCDRl), a light chain CDR2 (LCDR2), and a light chain CDR3 (LCDR3).
- an antigen binding protein comprises one or more CDRs contained within the preferred variable domains described herein.
- CDRs examples include, but are not limited to:
- LCDR3 (SEQ ID NO:90);
- HCDR1 SEQ ID NO:26
- HCDR2 SEQ ID NO:34
- HCDR3 SEQ ID NO:42
- HCDR1 SEQ ID NO:27
- HCDR2 SEQ ID NO:35
- HCDR3 SEQ ID NO:43
- HCDR1 SEQ ID NO:28
- HCDR2 SEQ ID NO:36
- HCDR3 SEQ ID NO:44
- HCDR1 SEQ ID NO:29
- HCDR2 SEQ ID NO:37
- HCDR3 SEQ ID NO:45
- HCDR1 SEQ ID NO:31
- HCDR2 SEQ ID NO:39
- HCDR3 SEQ ID NO:47
- HCDR1 SEQ ID NO:32
- HCDR2 SEQ ID NO:40
- HCDR3 SEQ ID NO:48
- the antigen binding protein comprises: A) a polypeptide, e.g., a light chain, that comprises an LCDRl having an amino acid sequence selected from the group consisting of SEQ ID NOS:71, 72, 73, 74, 75, 76, 77, and 78; an LCDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 79, 80, 81, 82, 83, 84, 85, and 86; and/or an LCDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS:87, 88, 89, 90, 91 , 92, 93, and 94; and/or B) a polypeptide, e.g., a heavy chain, that comprises an HCDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOS:25, 26, 27, 28, 29, 30, 31, and 32; an HCDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOS:33, 34
- the antigen binding protein comprise A) a light chain amino acid sequence that comprises a LCDRl, LCDR2, and LCDR3 of any of Abl LCv, Ab2 LCv, Ab3 LCv, Ab4 LCv, Ab5 LCv, Ab6 LCv, Ab7 LCv, and Ab8 LCv, and B) a heavy chain amino acid sequence that comprises a HCDR1 , HCDR2, and HCDR3 of any of Abl HCv, Ab2 HCv, Ab3 HCv, Ab4 HCv, Ab5 HCv, Ab6 HCv, Ab7 HCv, and Ab8 HCv.
- the CDRs include no more than one, no more than two, no more than three, no more than four, no more than five, or no more than six amino acid additions, deletions, or substitutions from an exemplary CDR set forth herein.
- aspects of the invention include antibodies comprising a light chain variable domain selected from the group consisting of SEQ ID NOS:63, 64, 65, 66, 67, 68, 69, and 70.
- aspects of the invention include antibodies comprising a heavy chain variable domain selected from the group consisting of SEQ ID NOS: 17, 18, 19, 20, 21, 22, 23, and 24.
- Further aspects of the invention include antibodies comprising A) a light chain variable domain selected from the group consisting of SEQ ID NOS:63, 64, 65, 66, 67, 68, 69, and 70, and B) a heavy chain variable domain selected from the group consisting of SEQ ID NOS: 17, 18, 19, 20, 21, 22, 23, and 24.
- Antibodies of the invention can comprise any constant region known in the art.
- the light chain constant region can be, for example, a kappa- or lambda-type light chain constant region, e.g., a human kappa- or lambda-type light chain constant region.
- the heavy chain constant region can be, for example, an alpha-, delta-, epsilon-, gamma-, or mu-type heavy chain constant region, e.g., a human alpha-, delta-, epsilon-, gamma-, or mu-type heavy chain constant region.
- the light or heavy chain constant region is a fragment, derivative, variant, or mutein of a naturally occurring constant region.
- aspects of the invention include antibodies comprising a light chain variable region selected from the group consisting of SEQ ID NOS:63, 64, 65, 66, 67, 68, 69, and 70 having no more than one, no more than two, no more than three, no more than four, no more than five, no more than six, no more than seven, no more than eight, no more than nine, or no more than ten amino acid additions, deletions, or substitutions.
- aspects of the invention include antibodies comprising a heavy chain variable region selected from the group consisting of SEQ ID NOS: 17, 18, 19, 20, 21 , 22, 23, and 24 having no more than one, no more than two, no more than three, no more than four, no more than five, no more than six, no more than seven, no more than eight, no more than nine, or no more than ten amino acid additions, deletions, or substitutions.
- antibodies comprising A) comprising a light chain variable region selected from the group consisting of SEQ ID NOS:63, 64, 65, 66, 67, 68, 69, and 70 having no more than one, no more than two, no more than three, no more than four, no more than five, no more than six, no more than seven, no more than eight, no more than nine, or no more than ten amino acid additions, deletions, or substitutions, and B)a heavy chain variable region selected from the group consisting of SEQ ID NOS: 17, 18, 19, 20, 21 , 22, 23, and 24 having no more than one, no more than two, no more than three, no more than four, no more than five, no more than six, no more than seven, no more than eight, no more than nine, or no more than ten amino acid additions, deletions, or substitutions.
- an antibody comprises 1) a variant of the light chain variable domain set forth in SEQ ID NO:66, wherein the phenylalanine at position 51 is mutated to a leucine and/or the proline at position 105 is mutated to a glycine or a glutamine; 2) a variant of the heavy chain variable domain set forth in SEQ ID NO:20, wherein the glutamine at position 1 is mutated to glutamic acid and/or the arginine at position 16 is mutated to a glycine; or a variant of the light chain variable domain set forth in SEQ ID NO:66, wherein the phenylalanine at position 51 is mutated to a leucine and/or the proline at position 105 is mutated to a glycine or a glutamine and a variant of the heavy chain variable domain set forth in SEQ ID NO:20, wherein the glutamine at position 1 is mutated to glutamic acid and/or the arginine
- the antigen binding protein comprises an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a light chain amino acid sequence selected from the group consisting of SEQ ID NOS:63, 64, 65, 66, 67, 68, 69, and 70.
- the antigen binding protein comprises an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a heavy chain amino acid sequence selected from the group consisting of SEQ ID NOS: 17, 18, 19, 20, 21, 22, 23, and 24.
- the antigen binding protein comprises A) an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a light chain amino acid sequence selected from the group consisting of SEQ ID NOS:63, 64, 65, 66, 67, 68, 69, and 70, and B) an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%
- the antigen binding protein comprises a light chain and/or heavy chain CDR3.
- the antigen binding protein comprises an amino acid sequence selected from the group of sequences set forth in SEQ ID NOS:87, 88, 89, 90, 91 ,92, 93,94, 41, 42, 43, 44, 45, 46, 47, and 48.
- the amino acid sequence includes no more than one, no more than two, no more than three, no more than four, no more than five, or no more than six amino acid additions, deletions, or substitutions from the exemplary sequence set forth in SEQ ID NOS:87, 88, 89, 90, 91,92, 93,94, 41 , 42, 43, 44, 45, 46, 47, and 48..
- embodiments of the invention include antigen binding protein comprising an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence selected from the group of sequences set forth in SEQ ID NOS:87, 88, 89, 90, 91 ,92, 93,94, 41, 42, 43, 44, 45, 46, 47, and 48.
- the antigen binding protein comprises a light chain and/or heavy chain CDR2.
- the antigen binding protein comprises an amino acid sequence selected from the group of sequences set forth in SEQ ID NOS:79, 80, 81, 82, 83, 84, 85, 86, 33, 34, 35, 36, 37, 38, 39, and 40.
- the amino acid sequence includes no more than one, no more than two, no more than three, no more than four, no more than five, or no more than six amino acid additions, deletions, or substitutions from the exemplary sequence set forth in SEQ ID NOS: 79, 80, 81, 82, 83, 84, 85, 86, 33, 34, 35, 36, 37, 38, 39, and 40.
- embodiments of the invention include antigen binding protein comprising an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence selected from the group of sequences set forth in SEQ ID NOS: 79, 80, 81, 82, 83, 84, 85, 86, 33, 34, 35, 36, 37, 38, 39, and 40.
- the antigen binding protein comprises a light chain and/or heavy chain CDR1. In some embodiments, the antigen binding protein comprises an amino acid sequence selected from the group of sequences set forth in SEQ ID NO: 1
- the amino acid sequence includes no more than one, no more than two, no more than three, no more than four, no more than five, or no more than six amino acid additions, deletions, or substitutions from the exemplary sequence set forth in SEQ ID NOS: 71, 72, 73, 74, 75, 76, 77, 78, 25, 26, 27, 28, 29, 30, 31, and 32.
- embodiments of the invention include antigen binding protein comprising an amino acid sequence that is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence selected from the group of sequences set forth in SEQ ID NOS: 71 , 72, 73, 74, 75, 76, 77, 78, 25, 26, 27, 28, 29, 30, 31 , and 32.
- the antigen binding proteins of the invention comprise the scaffolds of traditional antibodies, including human and monoclonal antibodies, bispecific antibodies, diabodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, antibody fusions (sometimes referred to as “antibody conjugates”), and fragments of each, respectively.
- the above described CDRs, including various combinations of the CDRs, may be grafted into any of the following scaffolds.
- antibody refers to the various forms of monomeric or multimeric proteins comprising one or more polypeptide chains that specifically binds to an antigen, as variously described herein.
- antibodies are produced by recombinant DNA techniques.
- antibodies are produced by enzymatic or chemical cleavage of naturally occurring antibodies.
- the antibody is selected from the group consisting of: a) a human antibody; b) a humanized antibody; c) a chimeric antibody; d) a monoclonal antibody; e) a polyclonal antibody; f) a recombinant antibody; g) an antigen-binding fragment; h) a single chain antibody; i) a diabody; j) a triabody, k) a tetrabody, 1) a Fab fragment; m) a F(ab') 2 fragment, n) an IgA antibody, o) an IgD antibody, p) an IgE antibody, q) an IgGl antibody, r) an IgG2 antibody, s) an IgG3 antibody, t) an IgG4 antibody, and u) an IgM antibody.
- a variable region comprises at least three heavy or light chain CDRs embedded within a framework region (designated framework regions FR1, FR2, FR3, and FR4). Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, Public Health Service N.I.H., Bethesda, MD.
- Traditional antibody structural units typically comprise a tetramer. Each tetramer is typically composed of two identical pairs of polypeptide chains, each pair having one "light” and one "heavy” chain.
- the amino -terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
- Human light chains are classified as kappa or lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- IgG has several subclasses, including, but not limited to IgGl ,
- IgM has subclasses, including, but not limited to IgMl and IgM2.
- Embodiments of the invention include all such classes and subclasses of antibodies that incorporate a variable domain or CDR of the antigen binding proteins, as described herein.
- Some naturally occurring antibodies, such as those found in camels and llamas, are dimers consisting of two heavy chains and include no light chains.
- the invention encompasses dimeric antibodies of two heavy chains, or fragments thereof, that can bind to CD27L.
- variable regions of the heavy and light chains typically exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, i.e., the complementarity determining regions or CDRs.
- the CDRs are primarily responsible for antigen recognition and binding.
- the CDRs fromt eh two chains of each pair are aligned by the framework regions, enabling binding to a specific epitope.
- both light and heavy chains comprise the domains FR1 , CDR1 , FR2, CDR2, FR3, CDR3, and FR4.
- the assignment of amino acids to each domain is in accordance with the definitions of Kabat.
- CDRs constitute the major surface contact points for antigen binding.
- the CDR3 or the light chain and, particularly, CDR3 of the heavy chain may constitute the most important determinants in antigen binding within the light and heavy chain variable regions.
- the heavy chain CDR3 appears to constitute the major area of contact between the antigen and the antibody.
- In vitro selection schemes in which CDR3 alone is varied can be used to vary the binding properties of an antibody or determine which residues contribute to the binding of an antigen.
- Naturally occurring antibodies typically include a signal sequence, which directs the antibody into the cellular pathway for protein secretion and which is typically not present in the mature antibody.
- a polynucleotide encoding an antibody of the invention may encode a naturally occurring a signal sequence or a heterologous signal sequence as described below.
- the antigen binding protein is a antibody comprising from one to six of the exemplary CDRs described herein.
- the antibodies of the invention may be of any type including IgM, IgG (including IgGl, IgG2, IgG3, IgG4), IgD, IgA, or IgE antibody.
- the antigen biding protein is an IgG type antibody, e.g., a IgGl antibody.
- the CDRs are all from the same species, e.g., human.
- additional CDRs may be either from other species or may be different human CDRs than those depicted in the exemplary sequences.
- HCDR3 and LCDR3 regions from the appropriate sequences identified herein may be used with HCDRl, HCDR2, LCDRl, and LCDR2 being optionally selected from alternate species or different human antibody sequences, or combinations thereof.
- the CDRs of the invention can replace the CDR regions of commercially relevant chimeric or humanized antibodies.
- scaffold components of the antigen binding proteins that are human components.
- the scaffold components can be a mixture from different species.
- the antigen binding protein is an antibody
- such antibody may be a chimeric antibody and/or humanized antibody.
- both “chimeric antibodies” and humanized antibodies” refer to antibodies that combine regions from more than one species.
- “chimeric antibodies” traditionally comprise variable region(s) from a mouse (or rat, in some casaes) and the constant region(s) from a human.
- Humanized antibodies generally refer to non-human antibodies that have had the variable domain framework regions swapped for sequences found in human antibodies.
- the entire antibody, except one or more CDRs is encoded by a polynucleotide of human origin or is identical to such an antibody except within one or more CDRs.
- the CDRs, some or all of which are encoded by nucleic acids originating in a non-human organism, are grafted into the beta-sheet framework of a human antibody variable region to create an antibody, the specificity of which is determined by the engrafted CDRs.
- humanized antibodies can also be generated using mice with a genetically engineered immune system. Roque et al., 2004, Biotechnol. Prog. 20:639- 654.
- the identified CDRs are human, and thus both humanized and chimeric antibodies in this context include some non- human CDRs; for example, humanized antibodies may be generated that comprise the HCDR3 and LCDR3 regions, with one or more of the other CDR regions being of a different species origin.
- theCD27L antigen binding protein is a mutlispecific antibody, and notably a bispecfic antibody, also sometimes referred to as "diabodies.” These are antibodies that bind to two or more different antigens or different epitopes on a single antigen.
- a bispecific antibody binds CD27L and an antigen on a human effector cell (e.g., T cell). Such antibodies are useful in targeting an effector cell response against a CD27L expressing cells, such as a tumor cell.
- the human effector cell antigen is CD3.
- U.S. Pat. No. 7,235,641. Methods of making bispecific antibodies are known in the art.
- One such method involves engineering the Fc portion of the heavy chains such as to create “knobs” and “holes” which facilitate heterodimer formation of the heavy chains when co-expressed in a cell.
- Another method also involves engineering the Fc portion of the heavy chain but uses electrostatic steering to encourage heterodimer formation while discouraging homodimer formation of the heavy chains when co-expressed in a cell.
- WO 09/089,004 which is incorporated herein by reference in its entirety.
- the CD27L antigen binding protein is a minibody.
- Minibodies are minimized antibody-like proteins comprising a scFv joined to a CH3 domain. Hu e/ /., 1996, Cancer Res. 56:3055-3061.
- the CD27L antigen binding protein is a domain antibody; see, for example U.S. Patent No. 6,248,516.
- Domain antibodies are functional binding domains of antibodies, corresponding to the variable regions of either the heavy (VH) or light (VL) chains of human antibodies.
- dABs have a molecular weight of approximately 13 kDa, or less than one -tenth the size of a full antibody.
- dABs are well expressed in a variety of hosts including bacterial, yeast, and mammalian cell systems.
- dAbs are highly stable and retain activity even after being subjected to harsh conditions, such as freeze-drying or heat denaturation. See, for example, US Patent 6,291 ,158;
- the CD27L antigen binding protein is an antibody fragment, that is a fragment of any of the antibodies outlined herein that retain binding specificity to CD27L.
- the antibody binding proteins comprise, but are not limited to, a F(ab), F(ab'), F(ab')2, Fv, or a single chain Fv fragments.
- an antibody as meant herein, comprises a polypeptide that can bind specifically to CD27L comprising all or part of a light or heavy chain variable region, such as one or more CDRs.
- CD27L-binding antibody fragments include, but are not limited to, (i) the Fab fragment consisting of VL, VH, CL and CHI domains, (ii) the Fd fragment consisting of the VH and CHI domains, (iii) the Fv fragment consisting of the VL and VH domains of a single antibody; (iv) the dAb fragment (Ward et al, 1989, Nature 341 :544-546) which consists of a single variable, (v) isolated CDR regions, (vi) F(ab') 2 fragments, a bivalent fragment comprising two linked Fab fragments (vii) single chain Fv molecules (scFv), wherein a VH domain and a VL domain are linked by a peptide linker which allows the two domains to associate to form an antigen binding site (Bird et al, 1988, Science 242:423-426, Huston et al, 1988, Proc.
- scFv single chain Fv molecules
- the molecules may be stabilized by the incorporation of disulphide bridges linking the VH and VL domains (Reiter et al, 1996, Nature Biotech. 14: 1239- 1245).
- disulphide bridges linking the VH and VL domains Reiter et al, 1996, Nature Biotech. 14: 1239- 1245.
- aspects of the invention include embodiments wherein the non-CDR components of these fragments are human sequences.
- the CD27L antigen binding protein is a fully human antibody.
- specific structures comprise complete heavy and light chains depicted comprising the CDR regions.
- Additional embodiments utilize one or more of the CDRs of the invention, with the other CDRs, framework regions, J and D regions, constant regions, etc., coming from other human antibodies.
- the CDRs of the invention can replace the CDRs of any number of human antibodies, particularly commercially relevant antibodies
- Single chain antibodies may be formed by linking heavy and light chain variable domain (Fv region) fragments via an amino acid bridge (short peptide linker), resulting in a single polypeptide chain.
- Fv region heavy and light chain variable domain
- short peptide linker short peptide linker
- Such single-chain Fvs have been prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (V L and V H ).
- the resulting polypeptides can fold back on themselves to form antigen-binding monomers, or they can form multimers (e.g., dimers, trimers, or tetramers), depending on the length of a flexible linker between the two variable domains (Kortt a/., 1997, Prot. Eng.
- Single chain antibodies derived from antibodies provided herein comprising the variable domain combinations of Abl LCv/Abl HCv (SEQ ID NO:63/SEQ ID NO: 17), Ab2 LCv/Ab2 HCv (SEQ ID NO:64/SEQ ID NO: 18), Ab3 LCv/Ab3 HCv (SEQ ID NO:65/SEQ ID NO: 19), Ab4 LCv/Ab4 HCv (SEQ ID NO:66/SEQ ID NO:20), Ab5 LCv/Ab5 HCv (SEQ ID NO:67/SEQ ID NO:21), Ab6 LCv/Ab6 HCv (SEQ ID NO:68/SEQ ID NO:22), Ab7 LCv/Ab7 HCv (SEQ ID NO:69/SEQ ID NO:23), Ab8 LCv/Ab8 HCv (SEQ ID NO:63/SEQ ID NO: 17), Ab2 LCv/Ab2 HCv (SEQ ID NO:64/SEQ ID NO: 18), Ab3
- the CD27L antigen binding protein is an antibody fusion protein (sometimes referred to herein as an "antibody conjugate").
- the conjugate partner can be proteinaceous or non-proteinaceous; the latter generally being generated using functional groups on the antigen binding protein and on the conjugate partner.
- the antibody is conjugated to a non-proteinaceous chemical (drug) to form an antibody drug conjugate. Exemplary antibody drug conjugates and methods of making such conjugates are discussed below.
- the CD27L antigen binding protein is an antibody analog, sometimes referred to as "synthetic antibodies.”
- synthetic antibodies include, but are not limited to, mutations introduced to stabilize the three- dimensional structure of the binding protein as well as wholly synthetic scaffolds consisting for example of biocompatible polymers. See, for example, Korndorfer et al., 2003, Proteins: Structure, Function, and Bioinformatics , Volume 53, Issue 1 : 121-129. Roque et ah, 2004, Biotechnol. Prog. 20:639-654.
- PAMs peptide antibody mimetics
- protein is meant at least two covalently attached amino acids, which includes proteins, polypeptides, oligopeptides and peptides. In some embodiments, the two or more covalently attached amino acids are attached by a peptide bond.
- the protein may be made up of naturally occurring amino acids and peptide bonds, for example when the protein is made recombinantly using expression systems and host cells, as outlined below.
- the protein may include synthetic amino acids ⁇ e.g., homophenylalanine, citrulline, ornithine, and norleucine), or peptidomimetic structures, i.e., "peptide or protein analogs", such as peptoids (see, Simon et al., 1992, Proc. Natl. Acad. Sci. U.S.A. 89:9367, incorporated by reference herein), which can be resistant to proteases or other physiological and/or storage conditions.
- synthetic amino acids may be incorporated in particular when the antigen binding protein is synthesized in vitro by conventional methods well known in the art.
- any combination of peptidomimetic, synthetic and naturally occurring residues/structures can be used.
- amino acid also includes imino acid residues such as proline and hydroxyproline.
- the amino acid “R group” or “side chain” may be in either the (L)- or the (S)-configuration. In a specific embodiment, the amino acids are in the (L)- or (S)- configuration.
- the invention provides recombinant antigen binding proteins that bind a CD27L and, in some embodiments, a recombinant human CD27L or portion thereof.
- a "recombinant protein” is a protein made using recombinant techniques using any techniques and methods known in the art, i.e., through the expression of a recombinant nucleic acid as described herein. Methods and techniques for the production of recombinant proteins are well known in the art.
- Embodiments of the invention include recombinant antigen binding proteins that bind wild-type CD27L and variants thereof. "Consisting essentially of means that the amino acid sequence can vary by about
- the antigen binding proteins of the invention are isolated proteins or substantially pure proteins.
- An "isolated" protein is unaccompanied by at least some of the material with which it is normally associated in its natural state, for example constituting at least about 5%, or at least about 50% by weight of the total protein in a given sample. It is understood that the isolated protein may constitute from 5 to 99.9% by weight of the total protein content depending on the circumstances. For example, the protein may be made at a significantly higher concentration through the use of an inducible promoter or high expression promoter, such that the protein is made at increased concentration levels.
- the definition includes the production of an antigen binding protein in a wide variety of organisms and/or host cells that are known in the art.
- sequence identity and/or similarity is determined by using standard techniques known in the art, including, but not limited to, the local sequence identity algorithm of Smith and Waterman, 1981, Adv. Appl. Math. 2:482, the sequence identity alignment algorithm of Needleman and Wunsch, 1970, J. Mol. Biol. 48:443, the search for similarity method of Pearson and Lipman, 1988, Proc. Nat. Acad. Sci. U.S.A. 85:2444, computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Drive, Madison, Wis.), the Best Fit sequence program described by Devereux et ah, 1984, Nucl. Acid Res.
- percent identity is calculated by FastDB based upon the following parameters: mismatch penalty of 1; gap penalty of 1 ; gap size penalty of 0.33; and joining penalty of 30, "Current Methods in Sequence Comparison and Analysis,” Macromolecule Sequencing and Synthesis, Selected Methods and Applications, pp 127- 149 (1988), Alan R. Liss, Inc.
- PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, 1987, J. Mol. Evol. 35:351-360; the method is similar to that described by Higgins and Sharp, 1989, CABIOS 5: 151-153.
- Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps.
- BLAST algorithm Another example of a useful algorithm is the BLAST algorithm, described in: Altschul et al, 1990, J. Mol. Biol. 215:403-410; Altschul et al, 1997, Nucleic Acids Res. 25:3389-3402; and Karin et al, 1993, Proc. Natl. Acad. Sci. U.S.A. 90:5873-5787.
- a particularly useful BLAST program is the WU-BLAST-2 program which was obtained from Altschul et al, 1996, Methods in Enzymology 266:460-480. WU-BLAST-2 uses several search parameters, most of which are set to the default values.
- the HSP S and HSP S2 parameters are dynamic values and are established by the program itself depending upon the composition of the particular sequence and composition of the particular database against which the sequence of interest is being searched; however, the values may be adjusted to increase sensitivity.
- Gapped BLAST uses BLOSUM-62 substitution scores; threshold T parameter set to 9; the two-hit method to trigger ungapped extensions, charges gap lengths of k a cost of 10+k; X u set to 16, and X g set to 40 for database search stage and to 67 for the output stage of the algorithms. Gapped alignments are triggered by a score corresponding to about 22 bits.
- amino acid homology, similarity, or identity between individual variant CDRs are at least 80% to the sequences depicted herein, and more typically with preferably increasing homologies or identities of at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and almost 100%.
- percent (%) nucleic acid sequence identity with respect to the nucleic acid sequence of the binding proteins identified herein is defined as the percentage of nucleotide residues in a candidate sequence that are identical with the nucleotide residues in the coding sequence of the antigen binding protein.
- a specific method utilizes the BLASTN module of WU- BLAST-2 set to the default parameters, with overlap span and overlap fraction set to 1 and 0.125, respectively.
- the nucleic acid sequence homology, similarity, or identity between the nucleotide sequences encoding individual variant CDRs and the nucleotide sequences depicted herein are at least 80%, and more typically with preferably increasing homologies or identities of at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, and almost 100%.
- a "variant CDR" is one with the specified homology, similarity, or identity to the parent CDR of the invention, and shares biological function, including, but not limited to, at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% of the specificity and/or activity of the parent CDR.
- the mutation per se need not be predetermined.
- random mutagenesis may be conducted at the target codon or region and the expressed antigen binding protein CDR variants screened for the optimal combination of desired activity.
- Techniques for making substitution mutations at predetermined sites in DNA having a known sequence are well known, for example, M13 primer mutagenesis and PCR mutagenesis. Screening of the mutants is done using assays of antigen binding protein activities, such as CD27L binding.
- Amino acid substitutions are typically of single residues; insertions usually will be on the order of from about one (1) to about twenty (20) amino acid residues, although considerably larger insertions may be tolerated. Deletions range from about one (1) to about twenty (20) amino acid residues, although in some cases deletions may be much larger.
- substitutions, deletions, insertions or any combination thereof may be used to arrive at a final derivative or variant. Generally these changes are done on a few amino acids to minimize the alteration of the molecule, particularly the immunogenicity and specificity of the antigen binding protein. However, larger changes may be tolerated in certain circumstances. Conservative substitutions are generally made in accordance with the following chart depicted as TABLE 1. TABLE 1
- substitutions that are less conservative than those shown in TABLE 1.
- substitutions may be made which more significantly affect: the structure of the polypeptide backbone in the area of the alteration, for example the alpha-helical or beta- sheet structure; the charge or hydrophobicity of the molecule at the target site; or the bulk of the side chain.
- substitutions which in general are expected to produce the greatest changes in the polypeptide's properties are those in which (a) a hydrophilic residue, e.g., seryl or threonyl, is substituted for (or by) a hydrophobic residue, e.g., leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g., lysyl, arginyl, or histidyl, is substituted for (or by) an electronegative residue, e.g., glutamyl or aspartyl; or (d) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having a side chain, e.g., glycine.
- a hydrophilic residue
- variants typically exhibit the same qualitative biological activity and will elicit the same immune response as the naturally-occurring analogue, although variants also are selected to modify the characteristics of the antigen binding protein proteins as needed.
- the variant may be designed such that the biological activity of the antigen binding protein is altered. For example, glycosylation sites may be altered or removed as discussed herein.
- CD27L antibodies within the scope of this invention include covalent or aggregative conjugates of CD27L antibodies, or fragments thereof, with other proteins or polypeptides, such as by expression of recombinant fusion proteins comprising heterologous polypeptides fused to the N-terminus or C-terminus of a CD27L antibody polypeptide.
- the conjugated peptide may be a heterologous signal (or leader) polypeptide, e.g., the yeast alpha- factor leader, or a peptide such as an epitope tag.
- CD27L antibody-containing fusion proteins can comprise peptides added to facilitate purification or identification of the CD27L antibody (e.g., poly-His).
- a CD27L antibody polypeptide also can be linked to the FLAG peptide as described in Hopp et ah, Bio/Technology 6: 1204, 1988, and U.S. Patent 5,01 1,912.
- the FLAG peptide is highly antigenic and provides an epitope reversibly bound by a specific monoclonal antibody (mAb), enabling rapid assay and facile purification of expressed recombinant protein.
- mAb monoclonal antibody
- Reagents useful for preparing fusion proteins in which the FLAG peptide is fused to a given polypeptide are commercially available (Sigma, St. Louis, MO).
- Oligomers that contain one or more CD27L antibody polypeptides may be employed as CD27L antagonists. Oligomers may be in the form of covalently-linked or non-covalently-linked dimers, trimers, or higher oligomers. Oligomers comprising two or more CD27L antibody polypeptides are contemplated for use, with one example being a homodimer. Other oligomers include heterodimers, homotrimers, hetero trimers, homotetramers, heterotetramers, etc.
- One embodiment is directed to oligomers comprising multiple CD27L antibody polypeptides joined via covalent or non-covalent interactions between peptide moieties fused to the CD27L antibody polypeptides.
- Such peptides may be peptide linkers (spacers), or peptides that have the property of promoting oligomerization.
- Leucine zippers and certain polypeptides derived from antibodies are among the peptides that can promote oligomerization of CD27L antibody polypeptides attached thereto, as described in more detail below.
- the oligomers comprise from two to four CD27L antibody polypeptides.
- the CD27L antibody moieties of the oligomer may be in any of the forms described above, e.g., variants or fragments.
- the oligomers comprise CD27L antibody polypeptides that have CD27L binding activity.
- an oligomer is prepared using polypeptides derived from immunoglobulins.
- Preparation of fusion proteins comprising certain heterologous polypeptides fused to various portions of antibody-derived polypeptides (including the Fc domain) has been described, e.g., by Ashkenazi et al, 1991, PNAS USA 88: 10535; Byrn et al, 1990, Nature 344:677; and Hollenbaugh et al, 1992 "Construction of
- One embodiment of the present invention is directed to a dimer comprising two fusion proteins created by fusing a CD27L binding fragment of a CD27L antibody to the Fc region of an antibody.
- the dimer can be made by, for example, inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein to assemble much like antibody molecules, whereupon interchain disulfide bonds form between the Fc moieties to yield the dimer.
- Fc polypeptide as used herein includes native and mutein forms of polypeptides derived from the Fc region of an antibody. Truncated forms of such polypeptides containing the hinge region that promotes dimerization also are included. Fusion proteins comprising Fc moieties (and oligomers formed therefrom) offer the advantage of facile purification by affinity chromatography over Protein A or Protein G columns.
- Fc polypeptide is a single chain polypeptide extending from the N- terminal hinge region to the native C-terminus of the Fc region of a human IgG antibody.
- Another useful Fc polypeptide is the Fc mutein described in U.S. Patent 5,457,035 and in Baum et al, 1994, EMBO J. 13:3992-4001.
- the amino acid sequence of this mutein is identical to that of the native Fc sequence presented in WO 93/10151, except that amino acid 19 has been changed from Leu to Ala, amino acid 20 has been changed from Leu to Glu, and amino acid 22 has been changed from Gly to Ala.
- the mutein exhibits reduced affinity for Fc receptors.
- variable portion of the heavy and/or light chains of a CD27L antibody may be substituted for the variable portion of an antibody heavy and/or light chain.
- the oligomer is a fusion protein comprising multiple CD27L antibody polypeptides, with or without peptide linkers (spacer peptides).
- suitable peptide linkers are those described in U.S. Patents 4,751 ,180 and 4,935,233.
- Leucine zipper domains are peptides that promote
- Leucine zippers were originally identified in several DNA-binding proteins (Landschulz et ah, 1988, Science 240: 1759), and have since been found in a variety of different proteins. Among the known leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize. Examples of leucine zipper domains suitable for producing soluble oligomeric proteins are described in PCT application WO 94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et al, 1994, FEBS Letters 344: 191, hereby incorporated by reference.
- SPD lung surfactant protein D
- a modified leucine zipper that allows for stable trimerization of a heterologous protein fused thereto is described in Fanslow et ah, 1994, Semin. Immunol. 6:267-78.
- recombinant fusion proteins comprising CD27L antibody fragment or derivative fused to a leucine zipper peptide are expressed in suitable host cells, and the soluble oligomeric CD27L antibody fragments or derivatives that form are recovered from the culture supernatant.
- Covalent modifications of antigen binding proteins are included within the scope of this invention, and are generally, but not always, done post-translationally.
- several types of covalent modifications of the antigen binding protein are introduced into the molecule by reacting specific amino acid residues of the antigen binding protein with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C-terminal residues.
- Cysteinyl residues most commonly are reacted with a-haloacetates (and corresponding amines), such as chloroacetic acid or chloroacetamide, to give
- Cysteinyl residues also are derivatized by reaction with bromotrifluoroacetone, a-bromo- -(5-imidozoyl)propionic acid, chloroacetyl phosphate, N-alkylmaleimides, 3-nitro-2-pyridyl disulfide, methyl 2- pyridyl disulfide, p-chloromercuribenzoate, 2-chloromercuri-4-nitrophenol, or chloro-7- nitrobenzo-2-oxa-l,3-diazole.
- Histidyl residues are derivatized by reaction with diethylpyrocarbonate at pH 5.5- 7.0 because this agent is relatively specific for the histidyl side chain.
- Para- bromophenacyl bromide also is useful; the reaction is preferably performed in 0.1 M sodium cacodylate at pH 6.0.
- Lysinyl and amino terminal residues are reacted with succinic or other carboxylic acid anhydrides. Derivatization with these agents has the effect of reversing the charge of the lysinyl residues.
- Other suitable reagents for derivatizing alpha-amino-containing residues include imidoesters such as methyl picolinimidate; pyridoxal phosphate;
- Arginyl residues are modified by reaction with one or several conventional reagents, among them phenylglyoxal, 2,3-butanedione, 1,2-cyclohexanedione, and ninhydrin. Derivatization of arginine residues requires that the reaction be performed in alkaline conditions because of the high pK a of the guanidine functional group.
- these reagents may react with the groups of lysine as well as the arginine epsilon-amino group.
- tyrosyl residues may be made, with particular interest in introducing spectral labels into tyrosyl residues by reaction with aromatic diazonium compounds or tetranitromethane.
- aromatic diazonium compounds or tetranitromethane Most commonly, N-acetylimidizole and tetranitromethane are used to form O-acetyl tyrosyl species and 3-nitro derivatives, respectively.
- Tyrosyl residues are iodinated using 125 I or 131 I to prepare labeled proteins for use in radioimmunoassay, the chloramine T method described above being suitable.
- aspartyl and glutamyl residues are converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.
- Derivatization with bifunctional agents is useful for crosslinking antigen binding proteins to a water-insoluble support matrix or surface for use in a variety of methods.
- Commonly used crosslinking agents include, e.g., l ,l -bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3'- dithiobis(succinimidylpropionate), and bifunctional maleimides such as bis-N- maleimido-l ,8-octane.
- Derivatizing agents such as methyl-3-[(p- azidophenyl)dithio]propioimidate yield photoactivatable intermediates that are capable of forming crosslinks in the presence of light.
- reactive water-insoluble matrices such as cyanogen bromide-activated carbohydrates and the reactive substrates described in U.S. Pat. Nos. 3,969,287; 3,691 ,016; 4,195,128; 4,247,642; 4,229,537; and 4,330,440 are employed for protein immobilization.
- glycosylation pattern can depend on both the sequence of the protein (e.g., the presence or absence of particular glycosylation amino acid residues, discussed below), or the host cell or organism in which the protein is produced. Particular expression systems are discussed below.
- Glycosylation of polypeptides is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tri-peptide sequences asparagine -X-serine and asparagine -X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- O-linked glycosylation refers to the attachment of one of the sugars N- acetylgalactosamine, galactose, or xylose, to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5 -hydroxy lysine may also be used.
- Addition of glycosylation sites to the antigen binding protein is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tri-peptide sequences (for N-linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the starting sequence (for O-linked glycosylation sites).
- the antigen binding protein amino acid sequence is preferably altered through changes at the DNA level, particularly by mutating the DNA encoding the target polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.
- Another means of increasing the number of carbohydrate moieties on the antigen binding protein is by chemical or enzymatic coupling of glycosides to the protein. These procedures are advantageous in that they do not require production of the protein in a host cell that has glycosylation capabilities for N- and O-linked glycosylation.
- the sugar(s) may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine.
- Removal of carbohydrate moieties present on the starting antigen binding protein may be accomplished chemically or enzymatically.
- Chemical deglycosylation requires exposure of the protein to the compound trifiuoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar ( -acetylglucosamine or N-acetylgalactosamine), while leaving the polypeptide intact.
- Chemical deglycosylation is described by Hakimuddin et ah, 1987, Arch.
- Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et ah, 1987, Meth. Enzymol. 138:350. Glycosylation at potential glycosylation sites may be prevented by the use of the compound tunicamycin as described by Duskin et ah, 1982, J. Biol. Chem. 257:3105. Tunicamycin blocks the formation of protein-N-glycoside linkages.
- Another type of covalent modification of the antigen binding protein comprises linking the antigen binding protein to various nonproteinaceous polymers, including, but not limited to, various polyols such as polyethylene glycol, polypropylene glycol or polyoxyalkylenes, in the manner set forth in U.S. Pat. Nos. 4,640,835; 4,496,689;
- amino acid substitutions may be made in various positions within the antigen binding protein to facilitate the addition of polymers such as PEG.
- the covalent modification of the antigen binding proteins of the invention comprises the addition of one or more labels.
- labelling group means any detectable label.
- suitable labelling groups include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, m In, 125 I, 131 I), fluorescent groups (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic groups (e.g., horseradish peroxidase, ⁇ -galactosidase, luciferase, alkaline phosphatase), chemiluminescent groups, biotinyl groups, or predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags).
- the labelling group is coupled to the antigen binding protein via spacer arms of various lengths to reduce potential steric hindrance.
- labels fall into a variety of classes, depending on the assay in which they are to be detected: a) isotopic labels, which may be radioactive or heavy isotopes; b) magnetic labels (e.g., magnetic particles); c) redox active moieties; d) optical dyes; enzymatic groups (e.g. horseradish peroxidase, ⁇ -galactosidase, luciferase, alkaline phosphatase); e) biotinylated groups; and f) predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags, etc.).
- the labelling group is coupled to the antigen binding protein via spacer arms of various lengths to reduce potential steric hindrance.
- spacer arms of various lengths to reduce potential steric hindrance.
- optical dyes including, but not limited to, chromophores, phosphors and fluorophores, with the latter being specific in many instances.
- Fluorophores can be either "small molecule” fluores, or proteinaceous fluores.
- fluorescent label any molecule that may be detected via its inherent fluorescent properties. Suitable fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl- coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade BlueJ, Texas Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, Oregon green, the Alexa-Fluor dyes (Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 660, Alexa Fluor 680), Cascade Blue, Cascade Yellow and R-phycoerythrin (PE) (Molecular Probes, Eugene, OR), FITC, Rhodamine,
- Suitable proteinaceous fluorescent labels also include, but are not limited to, green fluorescent protein, including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et ah, 1994, Science 263:802-805), EGFP (Clontech Laboratories, Inc., Genbank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc. 1801 de Maisonneuve Blvd. West, 8th Floor, Montreal, Quebec, Canada H3H 1 J9; Stauber, 1998, Biotechniques 24:462-471 ; Heim et al, 1996, Curr. Biol.
- green fluorescent protein including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et ah, 1994, Science 263:802-805), EGFP (Clontech Laboratories, Inc., Genbank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc. 1801 de Maison
- EYFP enhanced yellow fluorescent protein
- luciferase Rhoplasminogen activatories, Inc.
- ⁇ galactosidase Nolan et al, 1988, Proc. Natl. Acad. Sci. U.S.A. 85:2603-2607
- Renilla W092/15673, WO95/07463, WO98/14605, W098/26277, WO99/49019, U.S. Patent Nos. 5292658, 5418155,
- nucleic acids encoding CD27L antigen binding proteins including antibodies, as defined herein.
- Preferred nucleic acids include those that encode the exemplary light and heavy chains described herein.
- An exemplary nucleic acid encoding Abl LC is a nucleic acid comprising the sequence set forth in SEQ ID NO:49.
- An exemplary nucleic acid encoding Ab2 LC is a nucleic acid comprising the sequence set forth in SEQ ID NO:50.
- An exemplary nucleic acid encoding Ab4 LC is a nucleic acid comprising the sequence set forth in SEQ ID NO:51.
- An exemplary nucleic acid encoding Ab5 LC is a nucleic acid comprising the sequence set forth in SEQ ID NO:52.
- An exemplary nucleic acid encoding Ab6 LC is a nucleic acid comprising the sequence set forth in SEQ ID NO:53.
- An exemplary nucleic acid encoding Ab7 LC is a nucleic acid comprising the sequence set forth in SEQ ID NO:54.
- An exemplary nucleic acid encoding Ab8 LC is a nucleic acid comprising the sequence set forth in SEQ ID NO:55.
- An exemplary nucleic acid encoding Abl HC is a nucleic acid comprising the sequence set forth in SEQ ID NO:3.
- An exemplary nucleic acid encoding Ab2 HC is a nucleic acid comprising the sequence set forth in SEQ ID NO:4.
- An exemplary nucleic acid encoding Ab4 HC is a nucleic acid comprising the sequence set forth in SEQ ID NO:5.
- An exemplary nucleic acid encoding Ab5 HC is a nucleic acid comprising the sequence set forth in SEQ ID NO:6.
- An exemplary nucleic acid encoding Ab6 HC is a nucleic acid comprising the sequence set forth in SEQ ID NO :7.
- An exemplary nucleic acid encoding Ab7 HC is a nucleic acid comprising the sequence set forth in SEQ ID NO:8.
- An exemplary nucleic acid encoding Ab8 HC is a nucleic acid comprising the sequence set forth in SEQ ID NO:9.
- aspects of the invention include polynucleotide variants (e.g., due to degeneracy) that encode the amino acid sequences described herein.
- polynucleotide wherein said polynucleotide encodes one or more polypeptides comprising an amino acid sequence selected from the group consisting of:
- A. a light chain variable domain sequence that is at least 90% identical to a light chain variable domain sequence set forth in SEQ ID NOs:63-70;
- a heavy chain variable domain sequence that is at least 90% identical to a heavy chain variable domain sequence set forth in SEQ ID NOs: 17-24;
- a light chain variable domain comprising a CDR1 , CDR2, CDR3 and/or a heavy chain variable domain comprising a CDR1 , CDR2, CDR3 that differ by no more than a total of three amino acid additions, substitutions, and/or deletions in each CDR from the following sequences:
- a light chain CDR1 (SEQ ID NO:73), CDR2 (SEQ ID NO:81), CDR3 (SEQ ID NO: 89) or a heavy chain CDR1 (SEQ ID NO:27), CDR2 (SEQ ID NO:35), CDR3 (SEQ ID NO:43) of Ab3; 4. a light chain CDR1 (SEQ ID NO:74), CDR2 (SEQ ID NO:82), CDR3
- the polypeptide encoded by the isolated nucleic acid is a component of an antigen binding protein that binds CD27L.
- Nucleotide sequences corresponding to the amino acid sequences described herein, to be used as probes or primers for the isolation of nucleic acids or as query sequences for database searches, can be obtained by "back-translation" from the amino acid sequences, or by identification of regions of amino acid identity with polypeptides for which the coding DNA sequence has been identified.
- the well-known polymerase chain reaction (PCR) procedure can be employed to isolate and amplify a DNA sequence encoding a CD27L antigen binding proteins or a desired combination of CD27L antigen binding protein polypeptide fragments. Oligonucleotides that define the desired termini of the combination of DNA fragments are employed as 5' and 3' primers.
- the oligonucleotides can additionally contain recognition sites for restriction endonucleases, to facilitate insertion of the amplified combination of DNA fragments into an expression vector.
- PCR techniques are described in Saiki et al., Science 239:487 (1988);
- Nucleic acid molecules of the invention include DNA and RNA in both single- stranded and double- stranded form, as well as the corresponding complementary sequences.
- DNA includes, for example, cDNA, genomic DNA, chemically synthesized DNA, DNA amplified by PCR, and combinations thereof.
- the nucleic acid molecules of the invention include full-length genes or cDNA molecules as well as a combination of fragments thereof.
- the nucleic acids of the invention are preferentially derived from human sources, but the invention includes those derived from non-human species, as well.
- an "isolated nucleic acid” is a nucleic acid that has been separated from adjacent genetic sequences present in the genome of the organism from which the nucleic acid was isolated, in the case of nucleic acids isolated from naturally-occurring sources.
- nucleic acids synthesized enzymatically from a template or chemically, such as PCR products, cDNA molecules, or oligonucleotides for example it is understood that the nucleic acids resulting from such processes are isolated nucleic acids.
- An isolated nucleic acid molecule refers to a nucleic acid molecule in the form of a separate fragment or as a component of a larger nucleic acid construct.
- the nucleic acids are substantially free from contaminating endogenous material.
- the nucleic acid molecule has preferably been derived from DNA or RNA isolated at least once in substantially pure form and in a quantity or concentration enabling identification, manipulation, and recovery of its component nucleotide sequences by standard biochemical methods (such as those outlined in Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989)). Such sequences are preferably provided and/or constructed in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, that are typically present in eukaryotic genes. Sequences of non-translated DNA can be present 5' or 3' from an open reading frame, where the same do not interfere with manipulation or expression of the coding region.
- the present invention also includes nucleic acids that hybridize under moderately stringent conditions, and more preferably highly stringent conditions, to nucleic acids encoding CD27L antigen binding proteins as described herein.
- the basic parameters affecting the choice of hybridization conditions and guidance for devising suitable conditions are set forth by Sambrook,, Fritsch, and Maniatis (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., chapters 9 and 11 ; and Current Protocols in Molecular Biology, 1995, Ausubel et al, eds., John Wiley & Sons, Inc., sections 2.10 and 6.3-6.4), and can be readily determined by those having ordinary skill in the art based on, for example, the length and/or base composition of the DNA.
- One way of achieving moderately stringent conditions involves the use of a prewashing solution containing 5 x SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide, 6 x SSC, and a hybridization temperature of about 55 degrees C (or other similar hybridization solutions, such as one containing about 50% formamide, with a hybridization temperature of about 42 degrees C), and washing conditions of about 60 degrees C, in 0.5 x SSC, 0.1% SDS.
- highly stringent conditions are defined as hybridization conditions as above, but with washing at approximately 68 degrees C, 0.2 x SSC, 0.1% SDS.
- SSPE lxSSPE is 0.15M NaCl, 10 mM NaH.sub.2 PO.sub.4, and 1.25 mM EDTA, pH 7.4
- SSC 0.15M NaCl and 15 mM sodium citrate
- wash temperature and wash salt concentration can be adjusted as necessary to achieve a desired degree of stringency by applying the basic principles that govern hybridization reactions and duplex stability, as known to those skilled in the art and described further below (see, e.g., Sambrook et al., 1989).
- the hybrid length is assumed to be that of the hybridizing nucleic acid.
- the hybrid length can be determined by aligning the sequences of the nucleic acids and identifying the region or regions of optimal sequence complementarity.
- each such hybridizing nucleic acid has a length that is at least 15 nucleotides (or more preferably at least 18 nucleotides, or at least 20 nucleotides, or at least 25 nucleotides, or at least 30 nucleotides, or at least 40 nucleotides, or most preferably at least 50 nucleotides), or at least 25% (more preferably at least 50%, or at least 60%, or at least 70%, and most preferably at least 80%) of the length of the nucleic acid of the present invention to which it hybridizes, and has at least 60% sequence identity (more preferably at least 70%, at least 75%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%), at least 9
- the variants according to the invention are ordinarily prepared by site specific mutagenesis of nucleotides in the DNA encoding the antigen binding protein, using cassette or PCR mutagenesis or other techniques well known in the art, to produce DNA encoding the variant, and thereafter expressing the recombinant DNA in cell culture as outlined herein.
- antigen binding protein fragments comprising variant CDRs having up to about 100-150 residues may be prepared by in vitro synthesis using established techniques.
- the variants typically exhibit the same qualitative biological activity as the naturally occurring analogue, e.g. , binding to CD27L, although variants can also be selected which have modified characteristics as will be more fully outlined below.
- nucleic acids may be made, all of which encode the CDRs (and heavy and light chains or other components of the antigen binding protein) of the present invention.
- those skilled in the art could make any number of different nucleic acids, by simply modifying the sequence of one or more codons in a way which does not change the amino acid sequence of the encoded protein.
- the present invention also provides expression systems and constructs in the form of plasmids, expression vectors, transcription or expression cassettes which comprise at least one polynucleotide as above.
- the invention provides host cells comprising such expression systems or constructs.
- expression vectors used in any of the host cells will contain sequences for plasmid maintenance and for cloning and expression of exogenous nucleotide sequences.
- sequences collectively referred to as “flanking sequences” in certain embodiments will typically include one or more of the following nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
- a promoter one or more enhancer sequences
- an origin of replication a transcriptional termination sequence
- a complete intron sequence containing a donor and acceptor splice site a sequence encoding a leader sequence for polypeptide secreti
- the vector may contain a "tag"-encoding sequence, i.e., an
- the oligonucleotide molecule located at the 5' or 3' end of the CD27L antigen binding protein coding sequence; the oligonucleotide sequence encodes polyHis (such as hexaHis), or another "tag” such as FLAG, HA (hemaglutinin influenza virus), or myc, for which commercially available antibodies exist.
- This tag is typically fused to the polypeptide upon expression of the polypeptide, and can serve as a means for affinity purification or detection of the CD27L antigen binding protein from the host cell. Affinity purification can be accomplished, for example, by column chromatography using antibodies against the tag as an affinity matrix.
- the tag can subsequently be removed from the purified CD27L antigen binding protein by various means such as using certain peptidases for cleavage.
- Flanking sequences may be homologous (i.e., from the same species and/or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of flanking sequences from more than one source), synthetic or native.
- the source of a flanking sequence may be any prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the flanking sequence is functional in, and can be activated by, the host cell machinery.
- Flanking sequences useful in the vectors of this invention may be obtained by any of several methods well known in the art. Typically, flanking sequences useful herein will have been previously identified by mapping and/or by restriction endonuclease digestion and can thus be isolated from the proper tissue source using the appropriate restriction endonucleases. In some cases, the full nucleotide sequence of a flanking sequence may be known. Here, the flanking sequence may be synthesized using the methods described herein for nucleic acid synthesis or cloning.
- flanking sequence may be obtained using polymerase chain reaction (PCR) and/or by screening a genomic library with a suitable probe such as an oligonucleotide and/or flanking sequence fragment from the same or another species.
- PCR polymerase chain reaction
- a fragment of DNA containing a flanking sequence may be isolated from a larger piece of DNA that may contain, for example, a coding sequence or even another gene or genes. Isolation may be accomplished by restriction endonuclease digestion to produce the proper DNA fragment followed by isolation using agarose gel purification, Qiagen ® column chromatography (Chatsworth, CA), or other methods known to the skilled artisan.
- the selection of suitable enzymes to accomplish this purpose will be readily apparent to one of ordinary skill in the art.
- An origin of replication is typically a part of those prokaryotic expression vectors purchased commercially, and the origin aids in the amplification of the vector in a host cell. If the vector of choice does not contain an origin of replication site, one may be chemically synthesized based on a known sequence, and ligated into the vector.
- the origin of replication from the plasmid pBR322 (New England Biolabs, Beverly, MA) is suitable for most gram-negative bacteria, and various viral origins (e.g., SV40, polyoma, adenovirus, vesicular stomatitus virus (VSV), or papillomaviruses such as HPV or BPV) are useful for cloning vectors in mammalian cells.
- the origin of replication component is not needed for mammalian expression vectors (for example, the SV40 origin is often used only because it also contains the virus early promoter).
- a transcription termination sequence is typically located 3' to the end of a polypeptide coding region and serves to terminate transcription.
- a transcription termination sequence in prokaryotic cells is a G-C rich fragment followed by a poly-T sequence. While the sequence is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using methods for nucleic acid synthesis such as those described herein.
- a selectable marker gene encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium.
- Typical selection marker genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, or kanamycin for prokaryotic host cells; (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex or defined media.
- Specific selectable markers are the kanamycin resistance gene, the ampicillin resistance gene, and the tetracycline resistance gene.
- a neomycin resistance gene may also be used for selection in both prokaryotic and eukaryotic host cells.
- selectable genes may be used to amplify the gene that will be expressed.
- Amplification is the process wherein genes that are required for production of a protein critical for growth or cell survival are reiterated in tandem within the chromosomes of successive generations of recombinant cells.
- suitable selectable markers for mammalian cells include dihydro folate reductase (DHFR) and promoterless thymidine kinase genes.
- DHFR dihydro folate reductase
- Mammalian cell trans formants are placed under selection pressure wherein only the transformants are uniquely adapted to survive by virtue of the selectable gene present in the vector.
- Selection pressure is imposed by culturing the transformed cells under conditions in which the concentration of selection agent in the medium is successively increased, thereby leading to the amplification of both the selectable gene and the DNA that encodes another gene, such as an antigen binding protein antibody that binds to CD27L polypeptide.
- an antigen binding protein antibody that binds to CD27L polypeptide.
- a ribosome -binding site is usually necessary for translation initiation of rnRNA and is characterized by a Shine-Dalgarno sequence (prokaryotes) or a Kozak sequence (eukaryotes).
- the element is typically located 3' to the promoter and 5' to the coding sequence of the polypeptide to be expressed.
- one or more coding regions may be operably linked to an internal ribosome binding site (IRES), allowing translation of two open reading frames from a single R A transcript.
- IRS internal ribosome binding site
- the final protein product may have, in the -1 position (relative to the first amino acid of the mature protein) one or more additional amino acids incident to expression, which may not have been totally removed.
- the final protein product may have one or two amino acid residues found in the peptidase cleavage site, attached to the amino- terminus.
- use of some enzyme cleavage sites may result in a slightly truncated form of the desired polypeptide, if the enzyme cuts at such area within the mature polypeptide.
- Expression and cloning vectors of the invention will typically contain a promoter that is recognized by the host organism and operably linked to the molecule encoding the CD27L antigen binding protein. Promoters are untranscribed sequences located upstream (i.e., 5') to the start codon of a structural gene (generally within about 100 to 1000 bp) that control transcription of the structural gene. Promoters are conventionally grouped into one of two classes: inducible promoters and constitutive promoters. Inducible promoters initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, such as the presence or absence of a nutrient or a change in temperature.
- Constitutive promoters on the other hand, uniformly transcribe gene to which they are operably linked, that is, with little or no control over gene expression.
- a large number of promoters, recognized by a variety of potential host cells, are well known.
- a suitable promoter is operably linked to the DNA encoding heavy chain or light chain comprising an CD27L antigen binding protein of the invention by removing the promoter from the source DNA by restriction enzyme digestion and inserting the desired promoter sequence into the vector.
- Suitable promoters for use with yeast hosts are also well known in the art.
- Yeast enhancers are advantageously used with yeast promoters.
- Suitable promoters for use with mammalian host cells are well known and include, but are not limited to, those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis-B virus and most preferably Simian Virus 40 (SV40).
- viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis-B virus and most preferably Simian Virus 40 (SV40).
- Other suitable mammalian promoters
- Additional promoters which may be of interest include, but are not limited to: SV40 early promoter (Benoist and Chambon, 1981, Nature 290:304-310); CMV promoter (Thornsen et al., 1984, Proc. Natl. Acad. U.S.A. 81 :659-663); the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al, 1980, Cell 22:787-797); herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A.
- elastase I gene control region that is active in pancreatic acinar cells (Swift et al., 1984, Cell 38:639-646; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant. Biol.
- mice mammary tumor virus control region that is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485-495); the albumin gene control region that is active in liver (Pinkert et al., 1987, Genes and Devel. 1 :268-276); the alpha- feto-protein gene control region that is active in liver (Krumlauf et al., 1985, Mol. Cell. Biol. 5: 1639-1648; Hammer et al., 1987, Science 253:53-58); the alpha 1- antitrypsin gene control region that is active in liver (Kelsey et al., 1987, Genes and Devel.
- An enhancer sequence may be inserted into the vector to increase transcription of
- Enhancers are cis-acting elements of DNA, usually about 10-300 bp in length, that act on the promoter to increase transcription. Enhancers are relatively orientation and position independent, having been found at positions both 5' and 3' to the transcription unit.
- enhancer sequences available from mammalian genes are known ⁇ e.g., globin, elastase, albumin, alpha- feto-protein and insulin). Typically, however, an enhancer from a virus is used.
- the SV40 enhancer, the cytomegalovirus early promoter enhancer, the polyoma enhancer, and adenovirus enhancers known in the art are exemplary enhancing elements for the activation of eukaryotic promoters. While an enhancer may be positioned in the vector either 5' or 3' to a coding sequence, it is typically located at a site 5' from the promoter.
- a sequence encoding an appropriate native or heterologous signal sequence (leader sequence or signal peptide) can be incorporated into an expression vector, to promote extracellular secretion of the antibody. The choice of signal peptide or leader depends on the type of host cells in which the antibody is to be produced, and a heterologous signal sequence can replace the native signal sequence.
- IL-7 interleukin-7
- US Patent No. 4,965,195 the signal sequence for interleukin-2 receptor described in Cosman et ah, 1984, Nature 312:768
- the interleukin-4 receptor signal peptide described in EP Patent No. 0367 566
- type I interleukin-1 receptor signal peptide described in U.S. Patent No. 4,968,607
- the vector may contain one or more elements that facilitate expression when the vector is integrated into the host cell genome. Examples include an EASE element (Aldrich et al. 2003 Biotechnol Prog. 19: 1433-38) and a matrix attachment region (MAR). MARs mediate structural organization of the chromatin and may insulate the integrated vactor from "position" effect. Thus, MARs are particularly useful when the vector is used to create stable transfectants.
- a number of natural and synthetic MAR- containing nucleic acids are known in the art, e.g., U.S. Pat. Nos. 6,239,328; 7,326,567; 6,177,612; 6,388,066; 6,245,974; 7,259,010; 6,037,525; 7,422,874; 7,129,062.
- Expression vectors of the invention may be constructed from a starting vector such as a commercially available vector. Such vectors may or may not contain all of the desired flanking sequences. Where one or more of the flanking sequences described herein are not already present in the vector, they may be individually obtained and ligated into the vector. Methods used for obtaining each of the flanking sequences are well known to one skilled in the art.
- the completed vector may be inserted into a suitable host cell for amplification and/or polypeptide expression.
- the transformation of an expression vector for an CD27L antigen binding protein into a selected host cell may be accomplished by well known methods including transfection, infection, calcium phosphate co-precipitation, electroporation,
- a host cell when cultured under appropriate conditions, synthesizes an CD27L antigen binding protein that can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted).
- the selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity (such as glycosylation or phosphorylation) and ease of folding into a biologically active molecule.
- a host cell may be eukaryotic or prokaryotic.
- Mammalian cell lines available as hosts for expression are well known in the art and include, but are not limited to, immortalized cell lines available from the American Type Culture Collection (ATCC) and any cell lines used in an expression system known in the art can be used to make the recombinant polypeptides of the invention.
- ATCC American Type Culture Collection
- host cells are transformed with a recombinant expression vector that comprises DNA encoding a desired anti- CD27L antibody polypeptide.
- the host cells that may be employed are prokaryotes, yeast or higher eukaryotic cells.
- Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
- Higher eukaryotic cells include insect cells and established cell lines of mammalian origin.
- suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al, 1981 , Cell 23: 175), L cells, 293 cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, or their derivatives such as Veggie CHO and related cell lines which grow in serum- free media (Rasmussen et al, 1998, Cytotechnology 28: 31), HeLa cells, BHK (ATCC CRL 10) cell lines, and the CVI/EBNA cell line derived from the African green monkey kidney cell line CVI (ATCC CCL 70) as described by McMahan et al, 1991 , EMBO J.
- human embryonic kidney cells such as 293, 293 EBNA or MSR 293, human epidermal A431 cells, human Colo205 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL-60, U937, HaK or Jurkat cells.
- mammalian cell lines such as HepG2/3B, KB, NIH 3T3 or S49, for example, can be used for expression of the polypeptide when it is desirable to use the polypeptide in various signal transduction or reporter assays.
- yeasts include Saccharomyces cerevisiae, Schizosaccharomyces pombe, Kluyveromyces strains, Candida, or any yeast strain capable of expressing heterologous polypeptides.
- Suitable bacterial strains include Escherichia coli, Bacillus subtilis, Salmonella typhimurium, or any bacterial strain capable of expressing heterologous polypeptides. If the polypeptide is made in yeast or bacteria, it may be desirable to modify the polypeptide produced therein, for example by phosphorylation or glycosylation of the appropriate sites, in order to obtain the functional polypeptide.
- polypeptide can also be produced by operably linking the isolated nucleic acid of the invention to suitable control sequences in one or more insect expression vectors, and employing an insect expression system.
- suitable control sequences in one or more insect expression vectors, and employing an insect expression system.
- Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, e.g., Invitrogen, San Diego, Calif, U.S.A. (the MaxBac® kit), and such methods are well known in the art, as described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987), and Luckow and Summers,
- a host cell that comprises an isolated nucleic acid of the invention, preferably operably linked to at least one expression control sequence, is a "recombinant host cell”.
- cell lines may be selected through determining which cell lines have high expression levels and constitutively produce antigen binding proteins with CD27L binding properties.
- a cell line from the B cell lineage that does not make its own antibody but has a capacity to make and secrete a heterologous antibody can be selected.
- Embodiments of the invention include antibody drug conjugates (ADCs).
- ADCs antibody drug conjugates
- the ADC comprises an antibody conjugated to a chemotherapeutic agent, e.g., a cytotoxic agent, a cytostatic agent, a toxin, or a radioactive agent.
- a chemotherapeutic agent e.g., a cytotoxic agent, a cytostatic agent, a toxin, or a radioactive agent.
- a linker molecule can be used to conjugate the drug to the antibody.
- linkers and drugs useful in ADC technology are known in the art and may be used in embodiments of the present invention. (See US20090028856; US2009/0274713; US2007/0031402;
- the antibody drug conjugates may be prepared by in vitro methods.
- a linking group is used.
- Suitable linking groups are well known in the art and include disulfide groups, acid labile groups, photolabile groups, peptidase labile groups, and esterase labile groups.
- Preferred linking groups are disulfide groups.
- conjugates can be constructed using a disulfide exchange reaction between the antibody and the drug or prodrug.
- the drug molecules also can be linked to a cell binding agent through an intermediary carrier molecule such as serum albumin.
- the cell binding agent is modified by reacting a bifunctional crosslinking reagent with the cell binding agent, thereby resulting in the covalent attachment of a linker molecule to the cell binding agent.
- a bifunctional crosslinking reagent or “linker” is any chemical moiety that covalently links a cell binding agent to a drug, such as the drugs described herein.
- a portion of the linking moiety is provided by the drug.
- the drug comprises a linking moiety that is part of a larger linker molecule that is used to join the cell binding agent to the drug.
- the side chain at the C-3 hydroxyl group of maytansine is modified to have a free sulfhydryl group (SH).
- This thiolated form of maytansine can react with a modified cell-binding agent to form a conjugate. Therefore, the final linker is assembled from two components, one of which is provided by the crosslinking reagent, while the other is provided by the side chain from DM1.
- any suitable bifunctional crosslinking reagent can be used in connection with the invention, so long as the linker reagent provides for retention of the therapeutic, e.g., cytotoxicity, and targeting characteristics of the drug and the cell binding agent, respectively.
- the linker molecule joins the drug to the cell binding agent through chemical bonds (as described above), such that the drug and the cell binding agent are chemically coupled (e.g., covalently bonded) to each other.
- the ADC comprises a linker made up of one or more linker components.
- the drug is linked to a cell binding agent through a disulfide bond.
- the linker molecule comprises a reactive chemical group that can react with the cell binding agent.
- Preferred reactive chemical groups for reaction with the cell binding agent are N-succinimidyl esters and N-sulfosuccinimidyl esters.
- the linker molecule comprises a reactive chemical group, preferably a dithiopyridyl group, that can react with the drug to form a disulfide bond.
- linker molecules include, for example, N-succinimidyl 3-(2-pyridyldithio)propionate (SPDP) (see, e.g., Carlsson et al, Biochem. J., 173, 723-737 (1978)), N-succinimidyl 4-(2- pyridyldithio)butanoate (SPDB) (see, e.g., U.S. Pat. No.
- SPDP N-succinimidyl 3-(2-pyridyldithio)propionate
- SPDB N-succinimidyl 4-(2- pyridyldithio)butanoate
- maleimidopropanoyl, valine- citrulline, alanine-phenylalanine, p- aminobenzyloxycarbonyl, and those resulting from conjugation with linker reagents including, but not limited to, N-succinimidyl 4-(2-pyridylthio) pentanoate (“SPP”), N- succinimidyl 4-(N-maleimi do methyl) cyclohexane-1 carboxylate (“SMCC,” also referred to herein also as "MCC”), and N-succinimidyl (4-iodo-acetyl) aminobenzoate (“SIAB”).
- SPP N-succinimidyl 4-(2-pyridylthio) pentanoate
- MCC N- succinimidyl 4-(N-maleimi do methyl) cyclohexane-1 carboxylate
- SIAB N-succinimidyl (4-iodo-acetyl) amino
- Linkers may be a "cleavable” linker or a “non-cleavable” linker (Ducry and
- Cleavable linkers are designed to release the drug when subjected to certain environment factors, e.g., when internalized into the target cell.
- Cleavable linkers include acid labile linkers, protease sensitive linkers, photolabile linkers, dimethyl linker or disulfi de-containing linkers.
- Non-cleavable linkers tend to remain covalently associated with at least one amino acid of the antibody and the drug upon internalization by and degradation within the target cell.
- a non-cleavable linker is any chemical moiety that is capable of linking a drug, such as a maytansinoid (e.g., DM1, and the like), a taxane, or a CC-1065 analog, to a cell binding agent in a stable, covalent manner.
- a drug such as a maytansinoid (e.g., DM1, and the like), a taxane, or a CC-1065 analog
- non-cleavable linkers are substantially resistant to acid-induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the drug or the cell binding agent remains active.
- non-cleavable linkers Suitable crosslinking reagents that form non-cleavable linkers between a drug and the cell-binding agent are well known in the art.
- non-cleavable linkers include linkers having an N-succinimidyl ester or N-sulfosuccinimidyl ester moiety for reaction with the cell binding agent, as well as a maleimido- or haloacetyl-based moiety for reaction with the drug.
- Crosslinking linker reagents comprising a maleimido-based moiety include N-succinimidyl 4-(maleimidomethyl)cyclohexanecarboxylate (SMCC), N-succinimidyl-4-(N-maleimidomethyl)-cyclohexane- 1 -carboxy-(6-amidocaproa- te), which is a "long chain" analog of SMCC (LC--SMCC), x-maleimidoundecanoic acid N- succinimidyl ester (KMUA), .gamma.-maleimidobutyric acid N-succinimidyl ester (GMBS), .epsilon.-maleimidocaproic acid N-hydroxysuccinimide ester (EMCS), m- maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), N-(.alpha.-maleimidoacetoxy)- succinimide
- Cross-linking reagents comprising a haloacetyl- based moiety include N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB), N- succinimidyl iodoacetate (SIA), N-succinimidyl bromoacetate (SBA), and N- succinimidyl 3-(bromoacetamido)propionate (SBAP).
- An exemplary preferred non- cleavable linker is MCC.
- crosslinking reagent linkers lacking a sulfur atom that form non-cleavable linkers can also be used in the inventive method.
- Such linkers can be derived from dicarboxylic acid based moieties.
- Suitable dicarboxylic acid based moieties include, but are not limited to, alpha,omega-dicarboxylic acids of the general formula (IX): HOOC-Xi-Y n -Z m --COOH (IX), wherein X is a linear or branched alkyl, alkenyl, or alkynyl group having 2 to 20 carbon atoms, Y is a cycloalkyl or cycloalkenyl group bearing 3 to 10 carbon atoms, Z is a substituted or unsubstituted aromatic group bearing 6 to 10 carbon atoms, or a substituted or unsubstituted heterocyclic group wherein the hetero atom is selected from N, O or S, and wherein 1, m, and n are
- cleavable linkers examples include disulfide linkers, acid labile linkers, photolabile linkers, peptidase labile linkers, and esterase labile linkers.
- Disulfide containing linkers are linkers cleavable through disulfide exchange, which can occur under physiological conditions.
- Acid labile linkers are linkers cleavable at acid pH. For example, certain intracellular compartments, such as endosomes and lysosomes, have an acidic pH (pH 4-5), and provide conditions suitable to cleave acid labile linkers.
- Photo labile linkers are useful at the body surface and in many body cavities that are accessible to light. Furthermore, infrared light can penetrate tissue.
- Peptidase labile linkers can be used to cleave certain peptides inside or outside cells (see e.g., Trouet et al., Proc. Natl. Acad. Sci. USA, 79, 626-629 (1982), and Umemoto et al, Int. J. Cancer, 43, 677-684 (1989)).
- Drugs e.g., Trouet et al., Proc. Natl. Acad. Sci. USA, 79, 626-629 (1982), and Umemoto et al, Int. J. Cancer, 43, 677-684 (1989)).
- the antibody is conjugated to a chemotherapeutic agent.
- chemotherapeutic agents include alkylating agents, such as thiotepa and cyclophosphamide (CYTOXAN.TM.); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines, such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastat
- calicheamicin especially calicheamicin .gammal and calicheamicin theta I, see, e.g., Angew Chem. Intl. Ed. Engl. 33: 183-186 (1994); dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromomophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin; chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including morpholino- doxorubicin, cyanomorpholino-doxorubic
- deoxydoxorubicin epirubicin
- esorubicin idarubicin, marcellomycin, nitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin
- anti-metabolites such as methotrexate and 5-fiuorouracil (5-FU)
- folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate
- purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine
- pyrimidine analogs such as, ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifiuridine,
- trichothecenes especially T-2 toxin, verracurin A, roridin A and anguidine
- urethan vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman;
- paclitaxel TAXOL.TM., Bristol-Myers Squibb Oncology, Princeton, N.J.
- doxetaxel a taxoids e.g. paclitaxel (TAXOL.TM., Bristol-Myers Squibb Oncology, Princeton, N.J.) and doxetaxel
- gemcitabine 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP- 16); ifosfamide;
- mitomycin C mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT-1 1; topoisomerase inhibitor RFS 2000; difluoromethylomithine (DMFO); retinoic acid; capecitabine; and
- anti-hormonal agents that act to regulate or inhibit hormone action on tumors
- anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and toremifene (Fareston); and anti-androgens, such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; siRNA and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- Other chemotherapeutic agents that can be used with the present invention are disclosed in US Publication No.
- an antibody may be conjugated to two or more different chemotherapeutic agents or a pharmaceutical composition may comprise a mixture of antibodies wherein the antibody component is identical except for being conjugated to a different chemotherapeutic agent.
- a pharmaceutical composition may comprise a mixture of antibodies wherein the antibody component is identical except for being conjugated to a different chemotherapeutic agent.
- Such embodiments may be useful for targeting multiple biological pathways with a target cell.
- the ADC comprises an antibody conjugated to one or more maytansinoid molecules, which are mitotic inhibitors that act by inhibiting tubulin polymerization.
- Maytansinoids including various modifications, are described in US
- Maytansinoid drug moieties may be isolated from natural sources, produced using recombinant technology, or prepared synthetically.
- Exemplary maytansinoids include C- 19-dechloro (US Pat No. 4256746), C-20-hydroxy (or C-20-demethyl) +/- C-19-dechloro (US Pat. Nos. 4307016 and 4361650), C-20-demethoxy (or C-20-acyloxy (-OCOR), +/- dechrolo (US Pat. No. 4294757), C-9-SH (US Pat. No. 4,424,219), C-14-alkoxymethyl (demethoxy/CH20R) (U.S. Pat. No.
- Various positions on maytansinoid compounds may be used as the linkage position, depending upon the type of link desired.
- the C-3 position having a hydro xyl group, the C-14 position modified with hydrozymethyl, the C-15 position modified with a hydroxyl a group, and the C-20 position having a hydroxyl group are all suitable (US Pat. Nos. 5208020, RE39151, and 6913748; US Patent Appl. Pub. Nos. 20060167245 and 20070037972, and WO
- Preferred maytansinoids include those known in the art as DM1, DM3, and DM4
- ADCs containing maytansinoids, methods of making such ADCs, and their therapeutic use are disclosed in US Patent Nos. 5208020 and 5416064, US Pat. Appl. Pub. No. 20050276812, and WO 2009099728 (all incorporated by reference herein).
- Linkers that are useful for making maytansinoid ADCs are know in the art (US Pat. No. 5208020 and US Pat. Appl. Pub. Nos. 2005016993 and 20090274713; all incorporated herein by reference).
- Maytansinoid ADCs comprising an SMCC linker may be prepared as disclosed in US Pat. Publ. No. 2005/0276812.
- the ADC comprises an antibody conjugated to DM1 with an SMCC linker.
- Preferred embodiments include Abl-SMCC-DMl, Ab2-SMCC-DM1, Ab3-SMCC-DM1 , AM-SMCC-DM1, Ab5-SMCC-DM1, Ab6-SMCC-DM1, Ab7- SMCC-DM1, and Ab8-SMCC-DM1.
- An ADC may have 1 to 20 chemotherapeutic agents per antibody.
- Compositions of ADCs may be characterized by the average number of drug moieties per antibody molecule in the composition. The average number of drug moieties may be determined by conventional means such as mass spectrometry, immunoassay, and HPLC. In some instances, a homogeneous ADC population may be separated and purified by means of reverse phase HPLC or electrophoresis.
- pharmaceutical ADC compositions may contain a heterogeneous or homogeneous population of antibodies linked to 1, 2, 3, 4, 5, 6, 7 or more drug moieties.
- the ADC comprises as antibody conjugated to one or more DM1 molecules.
- Embodiments of the invention include compositions comprising an average of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 1 1, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, or about 20 DM1 molecules per antibody.
- Preferred ADC compositions are those comprising an Abl , Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, or Ab8 having on average between 1 and 10 DM1 molecules per antibody, those comprising antibodies having on average between 3 and 7 DM1 molecules per antibody, and those comprising antibodies having on average between 4 and 6 DM1 molecules, including an average of about 4.0, about 4.1 , about 4.2, about 4.3, about 4.4, about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5.0, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9 and about 6.0 DM1 molecules per antibody. Effector Function-Enhanced Antibodies
- ADCC antibody-dependent cellular cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- CDC complement dependent cytotoxicity
- IgG subclasses vary in their ability to mediate effector functions. For example IgGl is much superior to IgG2 and IgG4 at mediating ADCC and CDC. Thus, in embodiments wherein a cell expressing CD27L is targeted for destruction, an anti- CD27L IgGl antibody would be preferred.
- the effector function of an antibody can be increased, or decreased, by introducing one or more mutations into the Fc.
- Embodiments of the invention include antigen binding proteins, e.g., antibodies, having an Fc engineered to increase effector function (U.S. 7,317,091 and Strohl, Curr. Opin. Biotech., 20:685-691 , 2009; both incorporated herein by reference in its entirety).
- Exemplary IgGl Fc molecules having increased effector function include (based on the Kabat numbering scheme) those have the following substitutions: S239D/I332E
- antigen binding proteins e.g., antibodies
- Fc engineered to decrease effector function e.g., antibodies
- Exemplary Fc molecules having decreased effector function include (based on the Kabat numbering scheme) those have the following substitutions:
- Another method of increasing effector function of IgG Fc-containing proteins is by reducing the fucosylation of the Fc.
- Removal of the core fucose from the biantennary complex-type oligosachharides attached to the Fc greatly increased ADCC effector function without altering antigen binding or CDC effector function.
- Several ways are known for reducing or abolishing fucosylation of Fc-containing molecules, e.g., antibodies.
- compositions comprise an antibody, e.g., Abl, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, or Ab8, having reduced fucosylation or lacking fucosylation altogether.
- the invention provides a pharmaceutical composition comprising a therapeutically effective amount of one or a plurality of the antigen binding proteins of the invention together with a pharmaceutically effective diluents, carrier, solubilizer, emulsifier, preservative, and/or adjuvant.
- the antigen binding protein is an antibody, including a drug-conjugated antibody or a bispecific antibody.
- Pharmaceutical compositions of the invention include, but are not limited to, liquid, frozen, and lyophilized compositions.
- formulation materials are nontoxic to recipients at the dosages and concentrations employed.
- pharmaceutical compositions comprising a therapeutically effective amount of a CD27L antigen binding protein, e.g, a CD27L-binding ADC, are provided.
- the pharmaceutical composition may contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- formulation materials for modifying, maintaining or preserving for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine, proline, or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emuls, g
- polypeptides comprising polypeptides; salt-forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide);
- salt-forming counterions such as sodium
- preservatives such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide
- solvents such as glycerin, propylene glycol or polyethylene glycol
- sugar alcohols such as mannitol or sorbitol
- suspending agents such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate, triton, tromethamine, lecithin, cholesterol, tyloxapal
- stability enhancing agents such as sucrose or sorbitol
- tonicity enhancing agents such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol
- delivery vehicles diluents; excipients and/or pharmaceutical adjuvants. See, REMINGTON'S PHARMACEUTICAL
- the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, REMINGTON'S PHARMACEUTICAL SCIENCES, supra. In certain embodiments, such compositions may influence the physical state, stability, rate of in vivo release and rate of in vivo clearance of the antigen binding proteins of the invention.
- the primary vehicle or carrier in a pharmaceutical composition may be either aqueous or nonaqueous in nature.
- a suitable vehicle or carrier may be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
- Neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, and may further include sorbitol or a suitable substitute therefor.
- CD27L antigen binding protein compositions may be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (REMINGTON'S PHARMACEUTICAL SCIENCES, supra) in the form of a lyophilized cake or an aqueous solution.
- the CD27L antigen binding protein product may be formulated as a lyophilizate using appropriate excipients such as sucrose.
- compositions of the invention can be selected for parenteral delivery. Alternatively, the compositions may be selected for inhalation or for delivery through the digestive tract, such as orally. Preparation of such pharmaceutically acceptable compositions is within the skill of the art.
- the formulation components are present preferably in concentrations that are acceptable to the site of administration. In certain embodiments, buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
- the therapeutic compositions for use in this invention may be provided in the form of a pyrogen- free, parenterally acceptable aqueous solution comprising the desired CD27L antigen binding protein in a pharmaceutically acceptable vehicle.
- a particularly suitable vehicle for parenteral injection is sterile distilled water in which the CD27L antigen binding protein is formulated as a sterile, isotonic solution, properly preserved.
- the preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that may provide controlled or sustained release of the product which can be delivered via depot injection.
- an agent such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that may provide controlled or sustained release of the product which can be delivered via depot injection.
- hyaluronic acid may also be used, having the effect of promoting sustained duration in the circulation.
- implantable drug delivery devices may be used to introduce the desired antigen binding protein.
- compositions of the invention can be formulated for inhalation.
- CD27L antigen binding proteins are advantageously formulated as a dry, inhalable powder.
- CD27L antigen binding protein inhalation solutions may also be formulated with a propellant for aerosol delivery.
- solutions may be nebulized. Pulmonary administration and formulation methods therefore are further described in International Patent Application No. PCT/US94/001875, which is incorporated by reference and describes pulmonary delivery of chemically modified proteins.
- formulations can be administered orally.
- CD27L antigen binding proteins that are administered in this fashion can be formulated with or without carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- a capsule may be designed to release the active portion of the formulation at the point in the gastrointestinal tract when
- bioavailability is maximized and pre-systemic degradation is minimized.
- Additional agents can be included to facilitate absorption of the CD27L antigen binding protein. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders may also be employed.
- sustained- or controlled-delivery formulations include formulations involving CD27L antigen binding proteins in sustained- or controlled-delivery formulations.
- Techniques for formulating a variety of other sustained- or controlled-delivery means such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art. See, for example, International Patent Application No. PCT/US93/00829, which is incorporated by reference and describes controlled release of porous polymeric microparticles for delivery of pharmaceutical compositions.
- Sustained-release preparations may include semipermeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules.
- Sustained release matrices may include polyesters, hydrogels, polylactides (as disclosed in U.S. Pat. No. 3,773,919 and European Patent Application Publication No. EP 058481 , each of which is incorporated by reference), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., 1983, Biopolymers 2:547-556), poly (2-hydroxyethyl-methacrylate) (Langer et al., 1981, J. Biomed. Mater. Res. 15: 167-277 and Langer, 1982, Chem. Tech.
- Sustained release compositions may also include liposomes that can be prepared by any of several methods known in the art. See, e.g., Eppstein et al, 1985, Proc. Natl. Acad. Sci. U.S.A. 82:3688-3692; European Patent Application Publication Nos. EP 036,676; EP 088,046 and EP 143,949, incorporated by reference.
- compositions used for in vivo administration are typically provided as sterile preparations. Sterilization can be accomplished by filtration through sterile filtration membranes. When the composition is lyophilized, sterilization using this method may be conducted either prior to or following lyophilization and reconstitution.
- Compositions for parenteral administration can be stored in lyophilized form or in a solution. Parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- aspects of the invention includes self-buffering CD27L antigen binding protein formulations, which can be used as pharmaceutical compositions, as described in international patent application WO 06138181A2 (PCT/US2006/022599), which is incorporated by reference in its entirety herein.
- CD27L antigen binding proteins protein compositions particularly pharmaceutical CD27L antigen binding protein compositions, that comprise, in addition to the CD27L antigen binding protein, one or more excipients such as those illustratively described in this section and elsewhere herein.
- Excipients can be used in the invention in this regard for a wide variety of purposes, such as adjusting physical, chemical, or biological properties of formulations, such as adjustment of viscosity, and or processes of the invention to improve
- Salts may be used in accordance with certain embodiments of the invention to, for example, adjust the ionic strength and/or the isotonicity of a formulation and/or to improve the solubility and/or physical stability of a protein or other ingredient of a composition in accordance with the invention.
- ions can stabilize the native state of proteins by binding to charged residues on the protein's surface and by shielding charged and polar groups in the protein and reducing the strength of their electrostatic interactions, attractive, and repulsive interactions. Ions also can stabilize the denatured state of a protein by binding to, in particular, the denatured peptide linkages (--CONH) of the protein. Furthermore, ionic interaction with charged and polar groups in a protein also can reduce
- Ionic species differ significantly in their effects on proteins.
- a number of categorical rankings of ions and their effects on proteins have been developed that can be used in formulating pharmaceutical compositions in accordance with the invention.
- One example is the Hofmeister series, which ranks ionic and polar non-ionic solutes by their effect on the conformational stability of proteins in solution.
- Stabilizing solutes are referred to as “kosmotropic.”
- Destabilizing solutes are referred to as "chaotropic.”
- Kosmotropes commonly are used at high concentrations (e.g., >1 molar ammonium sulfate) to precipitate proteins from solution (“salting-out”).
- Chaotropes commonly are used to denture and/or to solubilize proteins ("salting-in”).
- the relative effectiveness of ions to "salt-in” and "salt-out” defines their position in the Hofmeister series.
- Free amino acids can be used in CD27L antigen binding protein formulations in accordance with various embodiments of the invention as bulking agents, stabilizers, and antioxidants, as well as other standard uses. Lysine, proline, serine, and alanine can be used for stabilizing proteins in a formulation. Glycine is useful in lyophilization to ensure correct cake structure and properties. Arginine may be useful to inhibit protein aggregation, in both liquid and lyophilized formulations. Methionine is useful as an antioxidant.
- Polyols include sugars, e.g., mannitol, sucrose, and sorbitol and polyhydric alcohols such as, for instance, glycerol and propylene glycol, and, for purposes of discussion herein, polyethylene glycol (PEG) and related substances.
- Sugars e.g., mannitol, sucrose, and sorbitol and polyhydric alcohols such as, for instance, glycerol and propylene glycol, and, for purposes of discussion herein, polyethylene glycol (PEG) and related substances.
- Polyols are kosmotropic. They are useful stabilizing agents in both liquid and lyophilized formulations to protect proteins from physical and chemical degradation processes. Polyols also are useful for adjusting the tonicity of formulations.
- polyols useful in select embodiments of the invention is mannitol, commonly used to ensure structural stability of the cake in lyophilized formulations. It ensures structural stability to the cake. It is generally used with a lyoprotectant, e.g., sucrose. Sorbitol and sucrose are among preferred agents for adjusting tonicity and as stabilizers to protect against freeze -thaw stresses during transport or the preparation of bulks during the manufacturing process. Reducing sugars (which contain free aldehyde or ketone groups), such as glucose and lactose, can glycate surface lysine and arginine residues. Therefore, they generally are not among preferred polyols for use in accordance with the invention.
- sugars that form such reactive species such as sucrose, which is hydrolyzed to fructose and glucose under acidic conditions, and consequently engenders glycation, also is not among preferred polyols of the invention in this regard.
- PEG is useful to stabilize proteins and as a cryoprotectant and can be used in the invention in this regard.
- Embodiments of the CD27L antigen binding protein formulations further comprise surfactants.
- Protein molecules may be susceptible to adsorption on surfaces and to denaturation and consequent aggregation at air-liquid, solid-liquid, and liquid- liquid interfaces. These effects generally scale inversely with protein concentration. These deleterious interactions generally scale inversely with protein concentration and typically are exacerbated by physical agitation, such as that generated during the shipping and handling of a product.
- Surfactants routinely are used to prevent, minimize, or reduce surface adsorption.
- Useful surfactants in the invention in this regard include polysorbate 20, polysorbate 80, other fatty acid esters of sorbitan polyethoxylates, and poloxamer 188.
- Surfactants also are commonly used to control protein conformational stability.
- surfactants in this regard is protein-specific since, any given surfactant typically will stabilize some proteins and destabilize others.
- Polysorbates are susceptible to oxidative degradation and often, as supplied, contain sufficient quantities of peroxides to cause oxidation of protein residue side- chains, especially methionine. Consequently, polysorbates should be used carefully, and when used, should be employed at their lowest effective concentration. In this regard, polysorbates exemplify the general rule that excipients should be used in their lowest effective concentrations.
- Embodiments of CD27L antigen binding protein formulations further comprise one or more antioxidants.
- antioxidants To some extent deleterious oxidation of proteins can be prevented in pharmaceutical formulations by maintaining proper levels of ambient oxygen and temperature and by avoiding exposure to light.
- Antioxidant excipients can be used as well to prevent oxidative degradation of proteins.
- useful antioxidants in this regard are reducing agents, oxygen/free-radical scavengers, and chelating agents.
- Antioxidants for use in therapeutic protein formulations in accordance with the invention preferably are water-soluble and maintain their activity throughout the shelf life of a product.
- EDTA is a preferred antioxidant in accordance with the invention in this regard.
- Antioxidants can damage proteins.
- reducing agents such as glutathione in particular, can disrupt intramolecular disulfide linkages.
- antioxidants for use in the invention are selected to, among other things, eliminate or sufficiently reduce the possibility of themselves damaging proteins in the formulation.
- Formulations in accordance with the invention may include metal ions that are protein co-factors and that are necessary to form protein coordination complexes, such as zinc necessary to form certain insulin suspensions. Metal ions also can inhibit some processes that degrade proteins. However, metal ions also catalyze physical and chemical processes that degrade proteins.
- Magnesium ions (10-120 mM) can be used to inhibit isomerization of aspartic acid to isoaspartic acid.
- Ca +2 ions (up to 100 mM) can increase the stability of human deoxyribonuclease. Mg +2 , Mn +2 , and Zn +2 , however, can destabilize rhDNase.
- Ca +2 and Sr +2 can stabilize Factor VIII, it can be destabilized by Mg +2 , Mn +2 and Zn +2 , Cu +2 and Fe +2 , and its aggregation can be increased by Al +3 ions.
- Embodiments of the CD27L antigen binding protein formulations further comprise one or more preservatives.
- Preservatives are necessary when developing multi- dose parenteral formulations that involve more than one extraction from the same container. Their primary function is to inhibit microbial growth and ensure product sterility throughout the shelf-life or term of use of the drug product. Commonly used preservatives include benzyl alcohol, phenol and m-cresol. Although preservatives have a long history of use with small-molecule parenterals, the development of protein formulations that includes preservatives can be challenging. Preservatives almost always have a destabilizing effect (aggregation) on proteins, and this has become a major factor in limiting their use in multi-dose protein formulations.
- hGH human growth hormone
- the effective preservative concentration in the drug product must be optimized. This requires testing a given preservative in the dosage form with concentration ranges that confer anti-microbial effectiveness without compromising protein stability.
- preservatives are more challenging than lyophilized formulations. Freeze-dried products can be lyophilized without the preservative and reconstituted with a preservative containing diluent at the time of use. This shortens the time for which a preservative is in contact with the protein, significantly minimizing the associated stability risks. With liquid formulations, preservative effectiveness and stability should be maintained over the entire product shelf-life (.about.18 to 24 months). An important point to note is that preservative effectiveness should be demonstrated in the final formulation containing the active drug and all excipient components.
- CD27L antigen binding protein formulations generally will be designed for specific routes and methods of administration, for specific administration dosages and frequencies of administration, for specific treatments of specific diseases, with ranges of bio-availability and persistence, among other things.
- Formulations thus may be designed in accordance with the invention for delivery by any suitable route, including but not limited to orally, aurally, opthalmically, rectally, and vaginally, and by parenteral routes, including intravenous and intraarterial injection, intramuscular injection, and
- kits for producing a single-dose administration unit may each contain both a first container having a dried protein and a second container having an aqueous formulation.
- kits containing single and multi-chambered pre-filled syringes e.g., liquid syringes and lyosyringes are provided.
- the therapeutically effective amount of a CD27L antigen binding protein- containing pharmaceutical composition to be employed will depend, for example, upon the therapeutic context and objectives.
- One skilled in the art will appreciate that the appropriate dosage levels for treatment will vary depending, in part, upon the molecule delivered, the indication for which the CD27L antigen binding protein is being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient.
- the clinician may titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
- a typical dosage may range from about 0.1 ⁇ g/kg to up to about 30 mg/kg or more, depending on the factors mentioned above.
- the dosage may range from 1.0 ⁇ g/kg up to about 20 mg/kg, optionally from 10 ⁇ g/kg up to about 10 mg/kg or from 100 ⁇ g/kg up to about 5 mg/kg.
- a therapeutic effective amount of a CD27L antigen binding protein preferably results in a decrease in severity of disease symptoms, in increase in frequency or duration of disease symptom-free periods or a prevention of impairment or disability due to the disease affliction.
- a therapeutically effective amount of CD27L antigen binding protein e.g. an anti-CD27L ADC, preferably inhibits cell growth or tumor growth by at least about 20%, at least about 40%, at least about 50%), at least about 60%>, at least about 70%, at least about 80%>, or at least about 90%> relative to untreated patients.
- the ability of a compound to inhibit tumor growth may be evaluated in an animal model predictive of efficacy in human tumors.
- compositions may be administered using a medical device.
- the CD27L antigen binding proteins of the invention are particularly useful for detecting CD27L in a biological sample.
- a biological sample obtained from a patient is contacted with a CD27L antigen binding protein. Binding of the CD27L antigen binding protein to CD27L is then detected to determine the presence or relative amount of CD27L in the sample.
- Such methods may be useful in diagnosing or determining patients that are amenable to treatment with a CD27L antigen binding protein, e.g., an anti-CD27L ADC.
- a CD27L antigen binding protein of the invention is used to diagnose, detect, or treat an autoimmune or inflammatory disorder.
- the CD27L antigen binding protein may target CD27L-expressing cells of the immune system for destruction and/or may block the interaction of CD27L with the receptor CD27.
- CD27L interaction with CD27 is thought to play a role in cell-mediated autoimmune diseases, such as experimental autoimmune encephalomyelitis (EAE) ( akajima et al. (2000) J. Neuroimmunol. 109: 188-96). This effect is thought to be mediated in part by an inhibition of TNF-a production.
- EAE experimental autoimmune encephalomyelitis
- CD27L antigen binding proteins can be used to treat a subject with an autoimmune disorder, e.g., a disorder characterized by the presence of B-cells expressing CD27L including, for example, experimental autoimmune encephalomyelitis.
- autoimmune disorders include, but are not limited to systemic lupus erythematosus (SLE), insulin dependent diabetes mellitus (IDDM), inflammatory bowel disease (IBD) (including Crohn's Disease, ulcerative colitis and Celiac disease), multiple sclerosis (MS), psoriasis, autoimmune thyroiditis, rheumatoid arthritis (RA) and glomerulonephritis.
- SLE systemic lupus erythematosus
- IBD inflammatory bowel disease
- MS multiple sclerosis
- psoriasis autoimmune thyroiditis
- RA rheumatoid arthritis
- glomerulonephritis glomerulonephritis.
- the cd27L antigen binding protein compositions of this disclosure can be used for inhibiting or preventing transplant rejection or in the treatment of graft versus host disease (GVHD).
- GVHD graft versus host disease
- CD27L has also been proposed to play a role in signaling on CD4+ T cells.
- Some viruses have been shown to signal the CD27 pathway, leading to destruction of neutralizing antibody responses (Matter et al. (2006) J Exp Med 203:2145-55).
- the CD27L antigen binding protein compositions and methods of the present disclosure can be used to treat a subject with a viral infection including, for example, infections from human immunodeficiency virus (HIV), Hepatitis (A, B, & C), Herpesvirus, (e.g., VZV, HSV-1 , HAV-6, HSV-II and CMV, Epstein Ban- virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, cornovirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus and arboviral encephalitis virus and lymphocytic choriomeningitis virus (LCMV) or in the treatment of HIV infection/ AIDS.
- HIV human immunodeficiency
- a CD27L antigen binding protein of the invention is used to diagnose, detect, or treat a cancer or tumorigenic disorder.
- Tumors and cancers amenable for treatment herein, wherein the cells of the tumor or cancer may express CD27L include, but are not limited to: renal cell carcinomas (RCC), such as clear cell RCC, papillary RCC, chromophobe RCC,and the like, glioblastoma, Head and Neck Cancers (e.g., squamous cell carcinomas(HNSCC), and the like), breast cancer, brain tumors, nasopharangeal carcinomas, non-Hodgkin's lymphoma (NHL), such as low grade NHL, diffuse large cell NHL, and the like, acute lymphocytic leukemia (ALL), such as pre-B-ALL, and the like, chronic lymphocytic leukemia (CLL or B-
- RCC renal cell carcinomas
- NHL non-Hodgkin's lymphoma
- NHL non-
- Additional tumor types amenable for treatment herein include tumors of the: kidney, pancreas, larynx or pharynx, melanoma, ovary, lung adenocarcinoma, colon breast, brain, and the like.
- IgGl , IgG2, and IgG4 XENOMOUSE® mice were immunized/boosted with soluble human CD27L or human CD27L recombinantly expressed on the surface of Chinese Hamster Ovary (CHO) cells. Hybridomas were produced from the immunized mice. Hybridoma supernatants were screened for binding to recombinant human CD27L- expressing 293 cells. Over 260 supernatants were positive for binding.
- the positive supernatants were then screened for binding to native CD27L on the surface of Raji and/or 786-0 cells.
- the native CD27L binding assay revealed 161 positive supernatants.
- FIG. 1 A summary of the characteristics of the eight antibodies along with those of a chimeric version of a commercially available mouse anti-human CD27L antibody are provided in FIG. 1.
- Affinity for recombinant soluble human CD27L was determined using a CM5 chip on a BIACORE 3000. Goat anti-human IgG antibody was used to capture the test antibody. Binding and dissociation of Histidine-tagged human soluble CD27L was measured to determine Ka, 3 ⁇ 4, and K D . The conditions were as follows:
- the ADCC assay was performed in a sterile 96 well round bottom tissue culture plate (Corning). Antibodies were titrated from 20 ⁇ g/mL to 0.0002 ⁇ g/mL by carrying 10 nL in 1 ⁇ , of complete RPMI containing 10% FCS (a 1 : 10 dilution). Calcein- labeled targets were added, 50 ⁇ , to contain 10,000 cells. Target cells and various concentrations of antibody were incubated for 40 minutes at 4° C, then NK cell effectors added, 50 ⁇ , to contain 200,000 cells.
- Percent (%) specific lysis was defined as (sample fluorescence) - (spontaneous lysis fluorescence)/(100% lysis - spontaneous lysis fluorescence).
- Raw data was entered in an Excel spreadsheet with the embedded formulae to calculate % specific lysis and resultant values transferred to graphic program (GraphPad Prism) where the data was transformed in a sigmoidal curve fit graph. Subsequent analyses (linear regression calculations) were done in GraphPad to generate EC50 values.
- Monocytes were negative selected from human peripheral blood and stored in 4°C cold room over night with medium RPMI 1640 containing 10% FBS. Then monocytes were seeded to a 48-well tissue culture plate at 200,000 cells per well with 200 ⁇ , of growth medium (RPMI 1640 containing 10% FBS and 40 ng/ml Hu M-CSF) and incubated at 37°C, 5% C0 2 for 6 days to let monocytes differentiate to macrophages.
- medium RPMI 1640 containing 10% FBS a 48-well tissue culture plate at 200,000 cells per well with 200 ⁇ , of growth medium (RPMI 1640 containing 10% FBS and 40 ng/ml Hu M-CSF)
- Tumor cells were collected and washed once with PBS by centrifuging the cells (400 ' g) for 5 minutes. After centrifuging cells, the supernatant was carefully aspirated, but leaving no more than 25 mL of supernatant.
- the mixture was incubated at room temperature for 4 minutes with mixing periodically.
- ADCP antibody dependent cellular phagocytosis
- Antibody dilutions were prepared in macrophage growth medium. These dilutions were concentrated at four times higher than final concentrations.
- the mixture of green labeled tumor cells with anti-tumor antibodies was added to macrophage cells in 48-well plate at 200 ⁇ for each well as indicated in the Experiment Design table below.
- the final volume is 0.4 ml per well.
- the ratio of target cells to effect cells (macrophages) is 1 :2.
- Macrophages were stained with their marker, CD1 lb-Biotin at 1 :200 dilution in block solution with 100 ⁇ per well for 10 min on ice.
- Statistical analysis was performed using Prism 4.01 (GraphPad, San Diego, CA).
- a plot shows % tumor cell phagocytosis vs. the log of antibody concentration in ng/ml.
- the percentage of tumor cell phagocytosis is represented with percentage of tumor cells that were overlapped with macrophages vs. total macrophages in the selected fields and obtained from output feature of ArrayScan reader "%ObjectCounts".
- the EC50 was determined by using nonlinear regression (curve fit) followed by using Sigmoidal dose-response equation. Data were normalized to the maximum and minimum signal and fit to a sigmoidal dose-response curve.
- Raji cells were washed once with assay medium and resuspended in assay medium (RPMI 1640 plus 1% FBS). Cells were seeded in a 96- well tissue culture plate at 50 per well with two cell densities for both rabbit and human complement complements. For rabbit complement, the cell density was
- 5x10 cells per well 5x10 cells per well.
- the cell density was 2x10 cells per well.
- Test antibodies at 10 ⁇ g/mL were added to cells at 50 ⁇ , per well. The total volume in each well at the start of culture was 150 ⁇ L. Cells were continuously incubated at 37°C, 5% C0 2 for one hour for cells treated with rabbit complement and 6 hours for cells treated with human complement.
- Seeding cells 786-0 cells were seeded on a 96-well plate at 10,000 cells per well with 100 ⁇ , of growth medium (RPMI containing 10% FBS) and incubated at 37°C, 5% C0 2 for 2 days to reach to 100% cell confluency on assay day. Plated cells were evaluated for
- Staining cells for internalization time-course Plate was washed lx with assay medium (PBS containing 2% FBS). Antibodies were added to wells at 2 ⁇ g/mL per well (100 ⁇ L per well) in assay medium. Human antibodies were allowed to bind to cells at
- Detector employing a 40x objective.
- the filter setting for internalization was indicated in Table 5. At least 400 cells were counted in each well.
- Count-staining cells for co-localizing internalized spots to the early endosomal compartment After internalization analysis, 786-0 cells were washed lx with BD buffer. Cells were explored to Fix/perm solution at RT for 20 minutes. Following 2x wash steps, cells were incubated with EEA-1 in BD buffer at 0.5 ⁇ g/mL (100 ⁇ /well) at RT for 20 minutes. Cells were washed lx with BD buffer and added with anti-mouse Alexa 568 at 1 : 1000 dilution. Cells were incubated at RT for 20 minutes followed by two wash steps of BD buffer solution.
- Photographing images Cell images for internalization and co-localization were taken with a Leica florescent microscope connected to Hamamutsu digital camera with Openlab Image Analysis software (Improvision Inc, Lexington, MA) or ArrayScan V TI HCS reader.
- SEM standard error of the mean
- spot count per unit time was fit to a one phase exponential association equation.
- Example 2 Assessment of MCC-DM1 -conjugated antibodies Abl , Ab2, Ab4, Ab7, and Ab8 were conjugated to MCC-DM1 (see Figure 12).
- the targeted load level was 4.5-5 drugs per antibody.
- the lysines of the antibody were conjugated to the NHS-ester of the hetero-bifunctional cross-linker Succinimidyl 4- [N-maleimidomethyl] cyclohexane- 1 -carboxylate (SMCC) which contains an NHS-ester and a maleimide.
- SMCC Succinimidyl 4- [N-maleimidomethyl] cyclohexane- 1 -carboxylate
- the linker-modified antibody was purified from excess linker and then conjugated to the warhead DM1 via a sulfhydryl present on DM1. Excess DM1 was then removed by a second purification step to generate the final conjugate Ab-MCC- DM1.
- CD27L antibody transiently expressed in mammalian cell culture 2936-E cells, was loaded onto a MabSelect SuRe column (GE Healthcare) that had been equilibrated in 25mM Tris, 150mM Sodium Chloride, pH 7.4. The column with bound CD27L antibody was then washed with 3 wash steps: first an equilibration buffer wash, followed by a 25mM Tris, 500mM L-Arginine, pH 7.5 wash and a final wash with equilibration buffer. CD27L antibody was eluted with lOOmM Sodium Acetate, pH 3.5. Fractions containing the antibody were pooled and adjusted to a final pH of 5.0 with 1M Tris, pH 8.0.
- the antibody was subsequently purified on a Fractogel® EMD 803 ⁇ (M) column (EMD Chemicals Inc) equilibrated in 30mM Sodium Acetate, pH 5.0. Bound antibody was eluted with an 8CV gradient between 0 to 0.8M Sodium Chloride in 30mM Sodium Acetate, pH 5.0. Antibody containing fractions were pooled and dialyzed into Conjugation Buffer (2mM EDTA, 50mM Sodium Chloride, 50mM Potassium Phosphate, pH 6.5).
- the purified CD27L antibody was modified with the amine reactive linker Succinimidyl-4-(N-maleimidomethyl)cyclohexane- 1 -carboxylate (SMCC) (Thermo Scientific) to introduce thiol reactive maleimide groups.
- SMCC Succinimidyl-4-(N-maleimidomethyl)cyclohexane- 1 -carboxylate
- the antibody at a concentration of 55 ⁇ was treated with 20 molar equivalents of SMCC in Conjugation Buffer adjusted to 10% dimethylacetamide (v/v) in the final reaction mixture.
- reaction mixture was desalted with a HiPrep 26/10 Desalting Column containing Sephadex G-25 fine resin (GE Healthcare) equilibrated in 2mM EDTA, 150mM Sodium Chloride, 35mM Sodium Citrate, pH 5.0.
- Antibody containing fractions were pooled and assayed for degree of modification with linker using Ellman's reagent (5,5'-dithio-bis-[2-nitrobenzoic acid]) as described below. The antibody was found to be modified with an average of 7.5 maleimide groups per antibody.
- Ellman's reagent is cleaved by thiols, yielding a yellow product with an absorbance at 412nm.
- a subtractive Ellman's assay was used to determine the number of maleimide groups on the CD27L antibody after reaction with SMCC.
- CD27L antibody modified with SMCC or a control sample of buffer without antibody was incubated with an equivalent concentration of thiols, 0.4mM DTT (dithiothreitol). Any maleimides present in the antibody sample would react with the thiols in DTT, making it unavailable for further reaction with Ellman's reagent.
- the SMCC modified CD27L antibody (7.5 maleimide groups per antibody) at a concentration between 17 ⁇ - 27 ⁇ was treated with 1.7 molar equivalents of DM1 (Immunogen) per maleimide group buffered with 2mM EDTA, 150mM NaCl, 35mM Sodium Citrate, pH 5.0 adjusted to 3% DMA (v/v) in the final reaction mixture. Reaction mixtures were incubated at room temperature overnight for up to 20 hours. The reaction mixture was loaded on a Superdex 200 gel filtration column (GE Healthcare) equilibrated with 20mM Sodium Phosphate, 150 mM Sodium Chloride, pH 6.5. Fractions were collected and and monomeric antibody containing fractions pooled and assayed. The molar ratio of DM1 molecules linked per antibody was determined by measuring the absorbance at 252 nm and 280 nm, and found to be 4.5 - 5.0 DM1 molecules per antibody.
- the antibody drug conjugates (ADC) Ab4- and Ab8-MCC-DMl demonstrated comparable native CD27L binding to their un-conjugated counterparts as assessed by flow cytometry.
- the observed binding EC50 for Ab4 and Ab4-MCC-DMl were the same while it was a modest 4-fold lower for Ab8-MCC-DMl as compared to Ab8 (Table 6).
- a more precise measure of binding affinity was determined for Ab4, Ab8 and their conjugate counterparts by measuring their ability to bind native human CD27L expressed on Raji cells using Gyros technology.
- the results showed that both conjugates exhibited sub-nM affinities for CD27L within two-fold of those observed for the un-conjugated Ab4 and Ab8 (Table 6).
- Both unconjugated and conjugated Ab4 and Ab8 also exhibited binding affinities to soluble human CD27L-his within 2-fold of each other as determined by BIACORE.
- the internalization of Ab4-MCC-DMl, Ab8-MCC-DMl, Ab4, and Ab8 was evaluated in the CD27L-expressing human ccRCC line 786-0.
- CD27L expressing 786-0 cells were exposed to un-conjugated Ab4 and Ab8 human anti-CD27L antibody, Ab4- MCC-DM1 , Ab8-MCC-DMl , control HulgGI, or control aSA-MCC-DMl and allowed to bind at 4°C.
- ArrayScan VTI HCS reader Co-localization of internalized test articles to endosomes was determined using anti-EEA-1 antibody, an endosomal marker.
- Ab4-MCC-DMl co-localized with the endosomal marker EEA-1 after a 5-hour incubation at 37°C, demonstrating that Ab4-MCC-DMl is internalized into the endosomal subcellular compartment of 786-0 cells.
- the level and rate of internalization was within a similar range for Ab4, Ab8 and their conjugated counter-parts (Figure 2).
- Ab4-MCC-DMl and Ab8-MCC-DMl demonstrated potent and specific in vitro growth inhibition of CD27L-expressing tumor cells.
- Ab4-MCC-DMl , Ab8-MCC-DMl or un-conjugated anti- CD27L Ab4 or Ab8 were incubated with CD27L expressing 786-0 luciferase or CD27L negative H1650 target cells in the presence/absence of naked Ab4 or Ab8, respectively, or control HulgGI for 4 days.
- Both cell lines, 786-0 luciferase and H1650 were seeded in 96-well tissue culture plates with growth medium at 100 ⁇ , of well with 500 cells per well for 786-0 luciferase and 1000 cells per well for H1650. All plates were incubated at 37oC, 5% C02 for 4 hours. After a 4 hour incubation, naked Ab and conjugates were added to cells at 100 ⁇ _, per well at various dose titrations. The total volume in each well at the start of culture was 200 ⁇ ,. Cells were continuously incubated at 37oC, 5% C02 for 4 days prior to measurement of cellular ATP levels. To assess cell growth inhibition, ATP levels (as a measure of cell number) were measured via luminescence using the CellTiter-Glo assay kit.
- ADCC Antibody Dependent Cell Cytotoxicity
- NK Natural Killer
- Percent (%) specific cytotoxicity was determined by measuring calcein release from CD27L expressing target cells lysed in the presence of Ab4-MCC-DMl as compared to control wells. The results are shown in Figure 8 which indicate that Ab4- MCC-DM1 mediated a similar level of ADCC to that of the Ab4 antibody (EC 50 values of 0.006 and 0.01 ⁇ g/mL respectively). The hulgGI control did not mediate any measurable lysis of CD27L expressing targets. Both the Ab4-MCC-DMl and the unconjugated Ab4 antibody are capable of inducing NK cell mediated ADCC of CD27L specific targets at similar levels. Similar results were observed for Ab8-MCC-DMl and the unconjugated Ab8 antibody.
- ADCP Antibody Dependent Cellular Phagocytosis
- DM1 or unconjugated parental antibody Ab4 was measured against both Raji and 786-0 tumor cells.
- Ab4-MCC-DMl mediated a similar level of complement-mediated lysis to that observed for unconjugated parental antibody Ab4.
- macrophages were differentiated from monocytes isolated from the human peripheral blood obtained from normal human blood donors. Macrophages were incubated with PHK67 green labeled CD27L expressing cell lines, 786-0 and Raji as target cells in the presence of
- both the conjugated Ab4- MCC-DM1 and the unconjugated WT Ab4 antibodies are capable of inducing human macrophage to mediate ADCP of CD27Lexpressing cells at similar levels. Similar results were observed for Ab8-MCC-DMl and the unconjugated Ab8 antibody.
- CDC Complement Dependent Cytotoxicity activity of Ab4-MCC-DMl was assessed employing both human and rabbit complement and CD27L-expressing Raji tumor cells.
- Ab4-MCC-DMl mediated a similar level of complement- mediated lysis to that observed for unconjugated parental antibody Ab4 (rabbit complement 72% lysis and human 17% lysis).
- activated rabbit or human complements were incubated with CD27L expressing Raji target cells in the presence of anti CD27L antibodies or control antibodies, as described above.
- CDC mediated killing was measured from output feature of ArrayScan reader "% selected objects" to detect % of PI positive vs.
- 786-0 ccRCC cells (786-0 S4) were implanted into female CB- 17/ SCID mice using growth-factor reduced MATRIGEL to generate tumor xenografts for efficacy studies.
- 786-0 S4 cells express an average of approximately 180,000 CD27L sites/cell.
- Treatment with Ab4-MCC-DMl or Ab8-MCC-DMl was initiated when the tumor size reached an average of approximately 250 mm 3 .
- Tumor-bearing animals were randomized by tumor size into groups of ten animals each and dosed intravenously once.
- Caki-1 ccRCC cells that express an average of 59,000 CD27L sites per cell (3-fold less that 786-0 cells) were implanted into CB-17/SCID mice as described above.
- Caki-1 xenografts reached an average size of 250 mm 3
- tumor-bearing animals were randomized by tumor size into groups of ten animals each and dosed intravenously once per week for 3 weeks (to more closely mimic a weekly clinical dosing regimen).
- a blinded dose response study of Ab4-MCC- DM1 and Ab8-MCC-DMl employing doses ranging from 60-270 ug DMl/kg (2.4-11 mg Ab/kg) was performed in this established tumor model.
- Tumor regression was initially observed at the mid 120 ug DMl/kg and the high 270 ug DMl/kg doses while tumor growth inhibition was observed at the low 60ug DMl/kg dose compared to the control conjugate or vehicle. As time progressed, tumor regression in the two higher dose groups began to diminish within 7 days of receiving the last dose (Figure 5).
- Raji B-lymphoma cells express CD27L (about 200,000 sites / cell) and internalize the anti-CD27L drug conjugate which results in mitotic arrest and cell death in vitro.
- Ab4-MCC-DMl was evaluated for efficacy in the subcutaneous Raji Xenograft model. When the Raji xenografts reached an average size of 250 mm 3 , tumor- bearing animals were randomized by tumor size into groups of ten animals each and dosed intravenously q4 days x 2 and then once per week for one additional week for a total of 3 doses (to more closely mimic a weekly clinical dosing regimen).
- Ab4 and Ab8 antibody drug conjugates were assessed after intravenous administration to female CB-17/SCID mice containing CD27L-expressing 786-0 xenografts in the context of efficacy studies and a follow-on terminal PK study.
- the cumulative exposures and clearance values were within 1.33 and 1.4-fold between the Ab4-MCC-DMl and Ab8-MCC-DMl molecules, and the half-life of both ADCs was approximately 12 days in mice.
- the stability and PK parameters of the Ab4-MCC-DMl and Ab8-MCC-DMl antibody drug conjugates were characterized in vivo following a single intravenous (IV) dose into CB-17/SCID mice bearing 786-0 xenografts.
- the exposures of the two antibody drug conjugates were highly comparable, but Ab4-MCC-DMl demonstrated a more stable drug-to-antibody conjugation ratio over the 96 hour time-course of the study as determined by affinity-MS than did Ab8-MCC-DMl molecule.
- Ab4-MCC-DMl showed no detectable loss of conjugate integrity at the 30 min or 24 hour time point post injection while Ab8-MCC-DMl exhibited changes at the 30 minute time point and significant decreases in all conjugate species by 24 hours post injection.
- a horseradish peroxidase conjugated ahuFc detection antibody (Jackson) diluted 1 :7000 was applied to the plates after another PBST wash, and incubated for 1 hour. A final wash was performed and TMB substrate was incubated for 10 minutes and stopped with phosphoric acid. An OD reading at 450nm was taken and plotted vs. concentration. These curves were then analyzed with a 3 parameter non linear curve fit and the EC50 and Max calculated signal were compared to the purified control. Binding was determined to be similar to parental if the EC50 was within 2 fold and the Max signal was greater than 50%. The binding was reduced if the EC50 increased greater than 2 fold and/or the max signal was less than 50%. The binding was abolished if no curve could be generated or the max signal was less than 5%.
- CAGATGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCCTCACAGACCCTGTCCCTC ACCTGCACTGTCTCTGATGGCTCCATCATCAGTGGTGTTTACTACTGGAGCTGGATCCGC CAGCACCCAGGGAAGGGCCTGGAGTGGATTGGATACATCTATTACAGTGGGAGCACCTCC TACAACCCGTCCCTCAAGAGTCGACTTACCATGTCAGTAGACACGTCTAAGAACCAGTTC TCCCTGAAGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGGAGT GGATACAGCTATGCCCTCTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA GCTAGCACCAAGGGCCCATCCGTCTTCCCCCTCCAAGAGCACCTCTGGG GGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCG TGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCG
- EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQRPGQAPRLLIYGASSRATGIP DRFSGSGSGTDFTLTISSLEPEDFAVYYCLQSGSSVPLTFGGGTKVEIKRTVAAPSVFIF PPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Diabetes (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Endocrinology (AREA)
- Oncology (AREA)
- Physical Education & Sports Medicine (AREA)
- Rheumatology (AREA)
- Hematology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Pain & Pain Management (AREA)
- Dermatology (AREA)
- Obesity (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Emergency Medicine (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Transplantation (AREA)
Priority Applications (20)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2014003482A MX353958B (es) | 2011-09-22 | 2012-09-20 | Proteinas de union al antigeno cd27l. |
| UAA201404223A UA118332C2 (uk) | 2011-09-22 | 2012-09-20 | Білок, що зв'язує антиген cd27l |
| BR112014006822-4A BR112014006822B1 (pt) | 2011-09-22 | 2012-09-20 | Proteína de ligação ao antígeno cd27l, composição compreendendo uma proteína de ligação ao antígeno cd27l, ácido nucleico isolado, vetor de expressão, célula hospedeira recombinante procariótica, método de preparação de um conjugado de droga e anticorpo cd27l e uso de uma proteína de ligação ao antígeno cd27l |
| KR1020147010524A KR102007055B1 (ko) | 2011-09-22 | 2012-09-20 | Cd27l 항원 결합 단백질 |
| PH1/2014/500666A PH12014500666B1 (en) | 2011-09-22 | 2012-09-20 | Cd27l antigen binding proteins |
| EP12766835.8A EP2758437B1 (en) | 2011-09-22 | 2012-09-20 | Cd27l antigen binding proteins |
| CA2849318A CA2849318C (en) | 2011-09-22 | 2012-09-20 | Cd27l antigen binding proteins |
| NZ622711A NZ622711B2 (en) | 2011-09-22 | 2012-09-20 | Cd27l antigen binding proteins |
| JP2014531981A JP6251678B2 (ja) | 2011-09-22 | 2012-09-20 | Cd27l抗原結合タンパク質 |
| HK14112499.5A HK1199042B (en) | 2011-09-22 | 2012-09-20 | Cd27l antigen binding proteins |
| EA201490677A EA027900B1 (ru) | 2011-09-22 | 2012-09-20 | Связывающие антиген cd27l белки |
| ES12766835T ES2806146T3 (es) | 2011-09-22 | 2012-09-20 | Proteínas de unión al antígeno CD27L |
| SG11201400859SA SG11201400859SA (en) | 2011-09-22 | 2012-09-20 | Cd27l antigen binding proteins |
| CN201280057377.XA CN104136461B (zh) | 2011-09-22 | 2012-09-20 | Cd27l抗原结合蛋白 |
| AP2014007588A AP2014007588A0 (en) | 2011-09-22 | 2012-09-20 | CD27L antigen binding proteins |
| AU2012312274A AU2012312274B2 (en) | 2011-09-22 | 2012-09-20 | CD27L antigen binding proteins |
| IL231603A IL231603B (en) | 2011-09-22 | 2014-03-19 | Antigen binding proteins l27cd |
| TNP2014000120A TN2014000120A1 (en) | 2011-09-22 | 2014-03-21 | Cd27l antigen binding proteins |
| ZA2014/02258A ZA201402258B (en) | 2011-09-22 | 2014-03-26 | Cd27l antigen binding proteins |
| AU2018200154A AU2018200154B2 (en) | 2011-09-22 | 2018-01-08 | CD27L Antigen Binding Proteins |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161538024P | 2011-09-22 | 2011-09-22 | |
| US61/538,024 | 2011-09-22 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2013043933A2 true WO2013043933A2 (en) | 2013-03-28 |
| WO2013043933A3 WO2013043933A3 (en) | 2013-05-30 |
Family
ID=46964100
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/056429 Ceased WO2013043933A2 (en) | 2011-09-22 | 2012-09-20 | Cd27l antigen binding proteins |
Country Status (28)
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2016519124A (ja) * | 2013-04-29 | 2016-06-30 | サノフイ | 抗il−4/抗il−13二特異的抗体製剤 |
| US10603388B2 (en) | 2014-09-02 | 2020-03-31 | Immunogen, Inc. | Methods for formulating antibody drug conjugate compositions |
| US10889652B2 (en) | 2015-01-16 | 2021-01-12 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ROR1 |
| US10968275B2 (en) | 2016-02-02 | 2021-04-06 | Fred Hutchinson Cancer Research Center | Anti-ROR1 antibodies and uses thereof |
| US11613584B1 (en) | 2021-10-13 | 2023-03-28 | Immuneonco Biopharmaceuticals (Shanghai) Inc. | Antibodies binding CD70, preparation and use thereof |
Families Citing this family (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2686347B1 (en) | 2011-03-16 | 2018-05-02 | argenx BVBA | Antibodies to cd70 |
| AP2014007588A0 (en) * | 2011-09-22 | 2014-04-30 | Amgen Inc | CD27L antigen binding proteins |
| WO2015187521A2 (en) * | 2014-06-03 | 2015-12-10 | Merck Sharp & Dohme Corp. | Anti-blys antibodies |
| US10391168B1 (en) | 2014-08-22 | 2019-08-27 | University Of Bern | Anti-CD70 combination therapy |
| TWI717375B (zh) * | 2015-07-31 | 2021-02-01 | 德商安美基研究(慕尼黑)公司 | Cd70及cd3抗體構築體 |
| JOP20190055A1 (ar) | 2016-09-26 | 2019-03-24 | Merck Sharp & Dohme | أجسام مضادة ضد cd27 |
| PT3583129T (pt) * | 2017-02-14 | 2021-12-14 | Kite Pharma Inc | Moléculas de ligação a cd70 e seus métodos de uso |
| GB201800649D0 (en) | 2018-01-16 | 2018-02-28 | Argenx Bvba | CD70 Combination Therapy |
| WO2019152705A1 (en) | 2018-02-01 | 2019-08-08 | Pfizer Inc. | Antibodies specific for cd70 and their uses |
| JP2020019723A (ja) * | 2018-07-30 | 2020-02-06 | 国立大学法人 鹿児島大学 | 抗CD70抗体とIgG結合ペプチドの複合体 |
| TWI848030B (zh) | 2018-12-18 | 2024-07-11 | 比利時商阿根思公司 | Cd70組合治療 |
| US20220106398A1 (en) * | 2019-02-08 | 2022-04-07 | Igm Biosciences, Inc. | Anti-gitr antigen-binding domains and uses thereof |
| EP4517327A3 (en) * | 2019-06-05 | 2025-05-07 | Amgen Inc. | Methods of identifying attributes of therapeutic proteins |
| JP7425459B2 (ja) * | 2019-10-11 | 2024-01-31 | 株式会社シノテスト | 安定化されたhmgb1含有溶液 |
| WO2022099317A1 (en) * | 2020-11-06 | 2022-05-12 | The Regents Of The University Of Colorado, A Body Corporate | Bacterial biomarker for rheumatoid arthritis and related materials and methods |
| AU2022262644A1 (en) * | 2021-04-23 | 2023-11-09 | Genmab A/S | Anti-cd70 antibodies, conjugates thereof and methods of using the same |
| CN113312790A (zh) * | 2021-06-16 | 2021-08-27 | 中国医学科学院放射医学研究所 | 一种辐射剂量的分析方法、装置、存储介质及电子设备 |
| CA3255801A1 (en) * | 2022-04-07 | 2023-10-12 | Board Of Regents, The University Of Texas System | METHODS FOR ACTIVATING AND EXPANDING MODIFIED NATURAL KILLER CELLS AND COMBINATIONS WITH ANTIBODIES |
| WO2024040194A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| US12311033B2 (en) | 2023-05-31 | 2025-05-27 | Capstan Therapeutics, Inc. | Lipid nanoparticle formulations and compositions |
| US20250127728A1 (en) | 2023-10-05 | 2025-04-24 | Capstan Therapeutics, Inc. | Constrained Ionizable Cationic Lipids and Lipid Nanoparticles |
| WO2025076113A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Ionizable cationic lipids with conserved spacing and lipid nanoparticles |
| WO2025122929A1 (en) * | 2023-12-08 | 2025-06-12 | Janssen Biotech, Inc. | Gprc5d antibodies with enhanced effector function and uses thereof |
| WO2025179294A2 (en) | 2024-02-22 | 2025-08-28 | Capstan Therapeutics, Inc. | Immune engineering amplification |
| WO2025217452A1 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| WO2025217454A2 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles |
| CN119143876B (zh) * | 2024-10-09 | 2025-09-16 | 武汉海沙百得生物技术有限公司 | 一种抗cd27l的全人源抗体或抗体片段及其应用 |
Citations (126)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3691016A (en) | 1970-04-17 | 1972-09-12 | Monsanto Co | Process for the preparation of insoluble enzymes |
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US3969287A (en) | 1972-12-08 | 1976-07-13 | Boehringer Mannheim Gmbh | Carrier-bound protein prepared by reacting the protein with an acylating or alkylating compound having a carrier-bonding group and reacting the product with a carrier |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4195128A (en) | 1976-05-03 | 1980-03-25 | Bayer Aktiengesellschaft | Polymeric carrier bound ligands |
| US4229537A (en) | 1978-02-09 | 1980-10-21 | New York University | Preparation of trichloro-s-triazine activated supports for coupling ligands |
| US4247642A (en) | 1977-02-17 | 1981-01-27 | Sumitomo Chemical Company, Limited | Enzyme immobilization with pullulan gel |
| US4248870A (en) | 1978-10-27 | 1981-02-03 | Takeda Chemical Industries, Ltd. | Maytansinoids and use |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| US4260608A (en) | 1978-11-14 | 1981-04-07 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and methods of use thereof |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| US4308268A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4317821A (en) | 1979-06-08 | 1982-03-02 | Takeda Chemical Industries, Ltd. | Maytansinoids, their use and pharmaceutical compositions thereof |
| US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4330440A (en) | 1977-02-08 | 1982-05-18 | Development Finance Corporation Of New Zealand | Activated matrix and method of activation |
| US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
| US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4563304A (en) | 1981-02-27 | 1986-01-07 | Pharmacia Fine Chemicals Ab | Pyridine compounds modifying proteins, polypeptides or polysaccharides |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| US4751180A (en) | 1985-03-28 | 1988-06-14 | Chiron Corporation | Expression using fused genes providing for protein product |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| EP0367566A1 (en) | 1988-10-31 | 1990-05-09 | Immunex Corporation | Interleukin-4 receptors |
| EP0368684A1 (en) | 1988-11-11 | 1990-05-16 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| US4935233A (en) | 1985-12-02 | 1990-06-19 | G. D. Searle And Company | Covalently linked polypeptide cell modulators |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US4965195A (en) | 1987-10-26 | 1990-10-23 | Immunex Corp. | Interleukin-7 |
| US4968607A (en) | 1987-11-25 | 1990-11-06 | Immunex Corporation | Interleukin-1 receptors |
| US5011912A (en) | 1986-12-19 | 1991-04-30 | Immunex Corporation | Hybridoma and monoclonal antibody for use in an immunoaffinity purification system |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| EP0460846A1 (en) | 1990-06-05 | 1991-12-11 | Immunex Corporation | Type II interleukin-1 receptors |
| WO1992011018A1 (en) | 1990-12-19 | 1992-07-09 | Protein Design Labs, Inc. | Improved humanized immunoglobulins |
| WO1992015673A1 (en) | 1991-03-11 | 1992-09-17 | The University Of Georgia Research Foundation, Inc. | Cloning and expression of renilla luciferase |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1993010151A1 (en) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Receptor for oncostatin m and leukemia inhibitory factor |
| US5292658A (en) | 1989-12-29 | 1994-03-08 | University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center | Cloning and expressions of Renilla luciferase |
| WO1994010308A1 (en) | 1992-10-23 | 1994-05-11 | Immunex Corporation | Methods of preparing soluble, oligomeric proteins |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| WO1994013804A1 (en) | 1992-12-04 | 1994-06-23 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| WO1995007463A1 (en) | 1993-09-10 | 1995-03-16 | The Trustees Of Columbia University In The City Of New York | Uses of green fluorescent protein |
| US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US5573924A (en) | 1992-09-08 | 1996-11-12 | Immunex Corporation | CD27 ligand |
| US5683888A (en) | 1989-07-22 | 1997-11-04 | University Of Wales College Of Medicine | Modified bioluminescent proteins and their use |
| WO1998014605A1 (en) | 1996-10-04 | 1998-04-09 | Loma Linda University | Renilla luciferase and green fluorescent protein fusion genes |
| US5741668A (en) | 1994-02-04 | 1998-04-21 | Rutgers, The State University Of New Jersey | Expression of a gene for a modified green-fluorescent protein |
| WO1998026277A2 (en) | 1996-12-12 | 1998-06-18 | Prolume, Ltd. | Apparatus and method for detecting and identifying infectious agents |
| US5777079A (en) | 1994-11-10 | 1998-07-07 | The Regents Of The University Of California | Modified green fluorescent proteins |
| US5804387A (en) | 1996-02-01 | 1998-09-08 | The Board Of Trustees Of The Leland Stanford Junior University | FACS-optimized mutants of the green fluorescent protein (GFP) |
| US5874304A (en) | 1996-01-18 | 1999-02-23 | University Of Florida Research Foundation, Inc. | Humanized green fluorescent protein genes and methods |
| US5876995A (en) | 1996-02-06 | 1999-03-02 | Bryan; Bruce | Bioluminescent novelty items |
| US5925558A (en) | 1996-07-16 | 1999-07-20 | The Regents Of The University Of California | Assays for protein kinases using fluorescent protein substrates |
| WO1999049019A2 (en) | 1998-03-27 | 1999-09-30 | Prolume, Ltd. | Luciferases, fluorescent proteins, nucleic acids encoding the luciferases and fluorescent proteins and the use thereof in diagnostics |
| US6037525A (en) | 1996-08-01 | 2000-03-14 | North Carolina State University | Method for reducing expression variability of transgenes in plant cells |
| US6114598A (en) | 1990-01-12 | 2000-09-05 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6177612B1 (en) | 1998-07-31 | 2001-01-23 | Her Majesty The Queen In Right Of Canada, As Represented By The Department Of Agriculture And Agri-Food Canada | Matrix attachment regions |
| US6239328B1 (en) | 1992-10-05 | 2001-05-29 | North Carolina State University | Method for reducing expression variability of transgenes in plant cells |
| US6245974B1 (en) | 1997-08-06 | 2001-06-12 | North Carolina State University | Matrix attachment regions |
| US6291158B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for tapping the immunological repertoire |
| US6340701B1 (en) | 1999-11-24 | 2002-01-22 | Immunogen Inc | Cytotoxic agents comprising taxanes and their therapeutic use |
| US6388066B1 (en) | 1998-09-29 | 2002-05-14 | Pioneer Hi-Bred International, Inc. | MAR/SAR elements flanking RSYN7-driven construct |
| WO2003002609A2 (en) | 2001-06-28 | 2003-01-09 | Domantis Limited | Dual-specific ligand and its use |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| WO2004003019A2 (en) | 2002-06-28 | 2004-01-08 | Domantis Limited | Immunoglobin single variant antigen-binding domains and dual-specific constructs |
| US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
| WO2004058821A2 (en) | 2002-12-27 | 2004-07-15 | Domantis Limited | Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand |
| US6833268B1 (en) | 1999-06-10 | 2004-12-21 | Abgenix, Inc. | Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions |
| US20050016993A1 (en) | 2003-04-17 | 2005-01-27 | Koskey James Donald | Heated pet mat |
| US6913748B2 (en) | 2002-08-16 | 2005-07-05 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
| US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
| WO2005084390A2 (en) | 2004-03-02 | 2005-09-15 | Seattle Genetics, Inc. | Partially loaded antibodies and methods of their conjugation |
| US20050276812A1 (en) | 2004-06-01 | 2005-12-15 | Genentech, Inc. | Antibody-drug conjugates and methods |
| US7064244B2 (en) | 1996-12-03 | 2006-06-20 | Abgenix, Inc. | Transgenic mammals having human Ig loci including plural VH and VK regions and antibodies produced therefrom |
| USRE39151E1 (en) | 2000-08-18 | 2006-06-27 | Immunogen, Inc. | Process for the preparation and purification of thiol-containing maytansinoids |
| US20060167245A1 (en) | 2005-01-21 | 2006-07-27 | Immunogen, Inc. | Method for the preparation of maytansinoid esters |
| US7129062B2 (en) | 2001-01-26 | 2006-10-31 | Selexis Sa | Matrix attachment regions and methods for use thereof |
| WO2006138181A2 (en) | 2005-06-14 | 2006-12-28 | Amgen Inc. | Self-buffering protein formulations |
| US20070031402A1 (en) | 2005-08-03 | 2007-02-08 | Immunogen Inc. | Immunoconjugate formulations |
| US20070037972A1 (en) | 2005-08-09 | 2007-02-15 | Millennium Pharmaceuticals, Inc. | Method of acylating maytansinol with chiral amino acids |
| US7235641B2 (en) | 2003-12-22 | 2007-06-26 | Micromet Ag | Bispecific antibodies |
| US7259010B2 (en) | 2000-12-15 | 2007-08-21 | Pangen Biotech Inc. | Expression vector for animal cell containing nuclear matrix attachment region of interferon beta |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| US7326567B2 (en) | 2003-11-12 | 2008-02-05 | Schering Corporation | Plasmid system for multigene expression |
| US7422874B2 (en) | 2000-07-29 | 2008-09-09 | Mogam Biotechnology Research Institute | Expression vector for animal cell |
| US20080305044A1 (en) | 2004-11-29 | 2008-12-11 | Seattle Genetics, Inc. | Engineered Antibodies and Immunoconjugates |
| US20090030924A1 (en) | 2006-03-01 | 2009-01-29 | Ana Belen Benitez | Device and Method for Generating a Media Package |
| US20090028856A1 (en) | 2007-07-16 | 2009-01-29 | Genentech, Inc. | Anti-CD79B Antibodies and Immunoconjugates and Methods of Use |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2009099728A1 (en) | 2008-01-31 | 2009-08-13 | Genentech, Inc. | Anti-cd79b antibodies and immunoconjugates and methods of use |
| US20090274713A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen Inc. | Cross-linkers and their uses |
| US7695963B2 (en) | 2007-09-24 | 2010-04-13 | Cythera, Inc. | Methods for increasing definitive endoderm production |
| US9209965B2 (en) | 2014-01-14 | 2015-12-08 | Microsemi Semiconductor Ulc | Network interface with clock recovery module on line card |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| US9401875B2 (en) | 2012-06-01 | 2016-07-26 | Nippon Telegraph And Telephone Corporation | Packet transfer processing method and packet transfer processing device |
Family Cites Families (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AR039067A1 (es) * | 2001-11-09 | 2005-02-09 | Pfizer Prod Inc | Anticuerpos para cd40 |
| US7261892B2 (en) | 2001-11-27 | 2007-08-28 | Celltech R&D Limited | Methods for diagnosis and treatment of epithelial-derived cancers |
| US20050118656A1 (en) | 2001-11-27 | 2005-06-02 | Terrett Jonathan A. | Methods for diagnosis and treatment of epithelial-derived cancers |
| US20080025989A1 (en) | 2003-02-20 | 2008-01-31 | Seattle Genetics, Inc. | Anti-cd70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
| WO2006113909A2 (en) * | 2005-04-19 | 2006-10-26 | Seattle Genetics, Inc. | Humanized anti-cd70 binding agents and uses thereof |
| EP2100619B1 (en) * | 2003-02-20 | 2014-02-12 | Seattle Genetics, Inc. | Anti-CD70 antibody-drug conjugates and their use for the treatment of immune disorders |
| TW200630106A (en) * | 2004-10-08 | 2006-09-01 | Wyeth Corp | Immunotherapy of autoimmune disorders |
| US7641903B2 (en) | 2004-10-15 | 2010-01-05 | Seattle Genetics, Inc. | Anti-CD70 antibody and its use for the treatment and prevention of cancer and immune disorders |
| US7491390B2 (en) * | 2004-10-15 | 2009-02-17 | Seattle Genetics, Inc. | Anti-CD70 antibody and its use for the treatment and prevention of cancer and immune disorders |
| WO2006068953A2 (en) * | 2004-12-21 | 2006-06-29 | Astrazeneca Ab | Antibodies directed to angiopoietin-2 and uses thereof |
| CA2623236A1 (en) * | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Human monoclonal antibodies to cd70 |
| GB0620894D0 (en) | 2006-10-20 | 2006-11-29 | Univ Southampton | Human immune therapies using a CD27 agonist alone or in combination with other immune modulators |
| EP2609932B1 (en) | 2006-12-01 | 2022-02-02 | Seagen Inc. | Variant target binding agents and uses thereof |
| CN101605906A (zh) * | 2006-12-14 | 2009-12-16 | 梅达雷克斯公司 | 结合cd70的人类抗体及其用途 |
| NZ578354A (en) * | 2006-12-14 | 2012-01-12 | Medarex Inc | Antibody-partner molecule conjugates that bind cd70 and uses thereof |
| JP5752592B2 (ja) * | 2008-04-11 | 2015-07-22 | シアトル ジェネティックス, インコーポレイテッド | 膵臓癌、卵巣癌、および他の癌の検出および処置 |
| AR071891A1 (es) * | 2008-05-30 | 2010-07-21 | Imclone Llc | Anticuerpos humanos anti-flt3 (receptor tirosina cinasa 3 tipo fms humano) |
| CN102264763B (zh) * | 2008-09-19 | 2016-04-27 | 米迪缪尼有限公司 | 定向于dll4的抗体及其用途 |
| JO3246B1 (ar) * | 2009-09-09 | 2018-03-08 | Regeneron Pharma | اجسام مضادة بشرية ذات ألفة تفاعل عالية مع مستقبل 2 المفعل بالبروتين البشري |
| AP2014007588A0 (en) * | 2011-09-22 | 2014-04-30 | Amgen Inc | CD27L antigen binding proteins |
-
2012
- 2012-09-20 AP AP2014007588A patent/AP2014007588A0/xx unknown
- 2012-09-20 MX MX2014003482A patent/MX353958B/es active IP Right Grant
- 2012-09-20 UA UAA201404223A patent/UA118332C2/uk unknown
- 2012-09-20 BR BR112014006822-4A patent/BR112014006822B1/pt active IP Right Grant
- 2012-09-20 MY MYPI2014000852A patent/MY173865A/en unknown
- 2012-09-20 PE PE2014000398A patent/PE20141151A1/es active IP Right Grant
- 2012-09-20 US US13/623,836 patent/US8987422B2/en active Active
- 2012-09-20 CN CN201280057377.XA patent/CN104136461B/zh active Active
- 2012-09-20 EP EP12766835.8A patent/EP2758437B1/en active Active
- 2012-09-20 JP JP2014531981A patent/JP6251678B2/ja active Active
- 2012-09-20 SG SG10201800158XA patent/SG10201800158XA/en unknown
- 2012-09-20 EA EA201790757A patent/EA201790757A1/ru unknown
- 2012-09-20 ES ES12766835T patent/ES2806146T3/es active Active
- 2012-09-20 JO JOP/2012/0273A patent/JO3625B1/ar active
- 2012-09-20 CA CA2849318A patent/CA2849318C/en active Active
- 2012-09-20 PH PH1/2014/500666A patent/PH12014500666B1/en unknown
- 2012-09-20 AU AU2012312274A patent/AU2012312274B2/en active Active
- 2012-09-20 WO PCT/US2012/056429 patent/WO2013043933A2/en not_active Ceased
- 2012-09-20 EA EA201490677A patent/EA027900B1/ru not_active IP Right Cessation
- 2012-09-20 SG SG11201400859SA patent/SG11201400859SA/en unknown
- 2012-09-20 KR KR1020147010524A patent/KR102007055B1/ko active Active
- 2012-09-21 TW TW105138766A patent/TWI646109B/zh active
- 2012-09-21 TW TW101134792A patent/TWI579298B/zh active
- 2012-09-24 UY UY0001034343A patent/UY34343A/es unknown
- 2012-09-25 AR ARP120103531A patent/AR093186A1/es active IP Right Grant
-
2014
- 2014-03-19 IL IL231603A patent/IL231603B/en active IP Right Grant
- 2014-03-21 CL CL2014000699A patent/CL2014000699A1/es unknown
- 2014-03-21 TN TNP2014000120A patent/TN2014000120A1/en unknown
- 2014-03-26 ZA ZA2014/02258A patent/ZA201402258B/en unknown
- 2014-04-08 CO CO14075643A patent/CO7020862A2/es unknown
- 2014-04-09 CR CR20140169A patent/CR20140169A/es unknown
-
2015
- 2015-02-10 US US14/618,945 patent/US9574008B2/en active Active
-
2016
- 2016-09-16 CL CL2016002340A patent/CL2016002340A1/es unknown
-
2017
- 2017-01-10 US US15/402,478 patent/US10266604B2/en active Active
- 2017-07-27 JP JP2017145168A patent/JP2018021031A/ja active Pending
-
2018
- 2018-01-08 AU AU2018200154A patent/AU2018200154B2/en active Active
Patent Citations (138)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3691016A (en) | 1970-04-17 | 1972-09-12 | Monsanto Co | Process for the preparation of insoluble enzymes |
| US3969287A (en) | 1972-12-08 | 1976-07-13 | Boehringer Mannheim Gmbh | Carrier-bound protein prepared by reacting the protein with an acylating or alkylating compound having a carrier-bonding group and reacting the product with a carrier |
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4195128A (en) | 1976-05-03 | 1980-03-25 | Bayer Aktiengesellschaft | Polymeric carrier bound ligands |
| US4330440A (en) | 1977-02-08 | 1982-05-18 | Development Finance Corporation Of New Zealand | Activated matrix and method of activation |
| US4247642A (en) | 1977-02-17 | 1981-01-27 | Sumitomo Chemical Company, Limited | Enzyme immobilization with pullulan gel |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| US4229537A (en) | 1978-02-09 | 1980-10-21 | New York University | Preparation of trichloro-s-triazine activated supports for coupling ligands |
| US4361650A (en) | 1978-03-24 | 1982-11-30 | Takeda Chemical Industries, Ltd. | Fermentation process of preparing demethyl maytansinoids |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| US4248870A (en) | 1978-10-27 | 1981-02-03 | Takeda Chemical Industries, Ltd. | Maytansinoids and use |
| US4260608A (en) | 1978-11-14 | 1981-04-07 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and methods of use thereof |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
| US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4317821A (en) | 1979-06-08 | 1982-03-02 | Takeda Chemical Industries, Ltd. | Maytansinoids, their use and pharmaceutical compositions thereof |
| US4308268A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
| US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| US4563304A (en) | 1981-02-27 | 1986-01-07 | Pharmacia Fine Chemicals Ab | Pyridine compounds modifying proteins, polypeptides or polysaccharides |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4751180A (en) | 1985-03-28 | 1988-06-14 | Chiron Corporation | Expression using fused genes providing for protein product |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US4935233A (en) | 1985-12-02 | 1990-06-19 | G. D. Searle And Company | Covalently linked polypeptide cell modulators |
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US5011912A (en) | 1986-12-19 | 1991-04-30 | Immunex Corporation | Hybridoma and monoclonal antibody for use in an immunoaffinity purification system |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US4965195A (en) | 1987-10-26 | 1990-10-23 | Immunex Corp. | Interleukin-7 |
| US4968607A (en) | 1987-11-25 | 1990-11-06 | Immunex Corporation | Interleukin-1 receptors |
| EP0367566A1 (en) | 1988-10-31 | 1990-05-09 | Immunex Corporation | Interleukin-4 receptors |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| EP0368684A1 (en) | 1988-11-11 | 1990-05-16 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| US20040110941A2 (en) | 1988-11-11 | 2004-06-10 | Medical Research Council | Single domain ligands, receptors comprising said ligands, methods for their production, and use of said ligands and receptors |
| US6291158B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for tapping the immunological repertoire |
| US5683888A (en) | 1989-07-22 | 1997-11-04 | University Of Wales College Of Medicine | Modified bioluminescent proteins and their use |
| US5416064A (en) | 1989-10-25 | 1995-05-16 | Immunogen, Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5292658A (en) | 1989-12-29 | 1994-03-08 | University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center | Cloning and expressions of Renilla luciferase |
| US5418155A (en) | 1989-12-29 | 1995-05-23 | University Of Georgia Research Foundation, Inc. | Isolated Renilla luciferase and method of use thereof |
| US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
| US6114598A (en) | 1990-01-12 | 2000-09-05 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| EP0460846A1 (en) | 1990-06-05 | 1991-12-11 | Immunex Corporation | Type II interleukin-1 receptors |
| WO1992011018A1 (en) | 1990-12-19 | 1992-07-09 | Protein Design Labs, Inc. | Improved humanized immunoglobulins |
| WO1992015673A1 (en) | 1991-03-11 | 1992-09-17 | The University Of Georgia Research Foundation, Inc. | Cloning and expression of renilla luciferase |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1993010151A1 (en) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Receptor for oncostatin m and leukemia inhibitory factor |
| US6593081B1 (en) | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| US5475092A (en) | 1992-03-25 | 1995-12-12 | Immunogen Inc. | Cell binding agent conjugates of analogues and derivatives of CC-1065 |
| US5585499A (en) | 1992-03-25 | 1996-12-17 | Immunogen Inc. | Cyclopropylbenzindole-containing cytotoxic drugs |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5399163A (en) | 1992-07-24 | 1995-03-21 | Bioject Inc. | Needleless hypodermic injection methods and device |
| US5573924A (en) | 1992-09-08 | 1996-11-12 | Immunex Corporation | CD27 ligand |
| US6239328B1 (en) | 1992-10-05 | 2001-05-29 | North Carolina State University | Method for reducing expression variability of transgenes in plant cells |
| WO1994010308A1 (en) | 1992-10-23 | 1994-05-11 | Immunex Corporation | Methods of preparing soluble, oligomeric proteins |
| WO1994013804A1 (en) | 1992-12-04 | 1994-06-23 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| WO1995007463A1 (en) | 1993-09-10 | 1995-03-16 | The Trustees Of Columbia University In The City Of New York | Uses of green fluorescent protein |
| US5741668A (en) | 1994-02-04 | 1998-04-21 | Rutgers, The State University Of New Jersey | Expression of a gene for a modified green-fluorescent protein |
| US5777079A (en) | 1994-11-10 | 1998-07-07 | The Regents Of The University Of California | Modified green fluorescent proteins |
| US5874304A (en) | 1996-01-18 | 1999-02-23 | University Of Florida Research Foundation, Inc. | Humanized green fluorescent protein genes and methods |
| US5804387A (en) | 1996-02-01 | 1998-09-08 | The Board Of Trustees Of The Leland Stanford Junior University | FACS-optimized mutants of the green fluorescent protein (GFP) |
| US5876995A (en) | 1996-02-06 | 1999-03-02 | Bryan; Bruce | Bioluminescent novelty items |
| US5925558A (en) | 1996-07-16 | 1999-07-20 | The Regents Of The University Of California | Assays for protein kinases using fluorescent protein substrates |
| US6037525A (en) | 1996-08-01 | 2000-03-14 | North Carolina State University | Method for reducing expression variability of transgenes in plant cells |
| WO1998014605A1 (en) | 1996-10-04 | 1998-04-09 | Loma Linda University | Renilla luciferase and green fluorescent protein fusion genes |
| US7064244B2 (en) | 1996-12-03 | 2006-06-20 | Abgenix, Inc. | Transgenic mammals having human Ig loci including plural VH and VK regions and antibodies produced therefrom |
| WO1998026277A2 (en) | 1996-12-12 | 1998-06-18 | Prolume, Ltd. | Apparatus and method for detecting and identifying infectious agents |
| US6245974B1 (en) | 1997-08-06 | 2001-06-12 | North Carolina State University | Matrix attachment regions |
| US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
| WO1999049019A2 (en) | 1998-03-27 | 1999-09-30 | Prolume, Ltd. | Luciferases, fluorescent proteins, nucleic acids encoding the luciferases and fluorescent proteins and the use thereof in diagnostics |
| US6177612B1 (en) | 1998-07-31 | 2001-01-23 | Her Majesty The Queen In Right Of Canada, As Represented By The Department Of Agriculture And Agri-Food Canada | Matrix attachment regions |
| US6388066B1 (en) | 1998-09-29 | 2002-05-14 | Pioneer Hi-Bred International, Inc. | MAR/SAR elements flanking RSYN7-driven construct |
| US6833268B1 (en) | 1999-06-10 | 2004-12-21 | Abgenix, Inc. | Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions |
| US7049426B2 (en) | 1999-06-10 | 2006-05-23 | Abgenix, Inc. | Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions |
| US6372738B2 (en) | 1999-11-24 | 2002-04-16 | Immunogen Inc. | Cytotoxic agents comprising taxanes and their therapeutic use |
| US6340701B1 (en) | 1999-11-24 | 2002-01-22 | Immunogen Inc | Cytotoxic agents comprising taxanes and their therapeutic use |
| US6436931B1 (en) | 1999-11-24 | 2002-08-20 | Immunogen Inc. | Cytotoxic agents comprising taxanes and their therapeutic use |
| US7422874B2 (en) | 2000-07-29 | 2008-09-09 | Mogam Biotechnology Research Institute | Expression vector for animal cell |
| USRE39151E1 (en) | 2000-08-18 | 2006-06-27 | Immunogen, Inc. | Process for the preparation and purification of thiol-containing maytansinoids |
| US7259010B2 (en) | 2000-12-15 | 2007-08-21 | Pangen Biotech Inc. | Expression vector for animal cell containing nuclear matrix attachment region of interferon beta |
| US7129062B2 (en) | 2001-01-26 | 2006-10-31 | Selexis Sa | Matrix attachment regions and methods for use thereof |
| WO2003002609A2 (en) | 2001-06-28 | 2003-01-09 | Domantis Limited | Dual-specific ligand and its use |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| WO2004003019A2 (en) | 2002-06-28 | 2004-01-08 | Domantis Limited | Immunoglobin single variant antigen-binding domains and dual-specific constructs |
| US6913748B2 (en) | 2002-08-16 | 2005-07-05 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
| WO2004058821A2 (en) | 2002-12-27 | 2004-07-15 | Domantis Limited | Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand |
| US20050016993A1 (en) | 2003-04-17 | 2005-01-27 | Koskey James Donald | Heated pet mat |
| US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
| US7326567B2 (en) | 2003-11-12 | 2008-02-05 | Schering Corporation | Plasmid system for multigene expression |
| US7235641B2 (en) | 2003-12-22 | 2007-06-26 | Micromet Ag | Bispecific antibodies |
| WO2005084390A2 (en) | 2004-03-02 | 2005-09-15 | Seattle Genetics, Inc. | Partially loaded antibodies and methods of their conjugation |
| US20050276812A1 (en) | 2004-06-01 | 2005-12-15 | Genentech, Inc. | Antibody-drug conjugates and methods |
| US20080171040A1 (en) | 2004-06-01 | 2008-07-17 | Genentech, Inc. | Antibody-drug conjugates and methods |
| US20080305044A1 (en) | 2004-11-29 | 2008-12-11 | Seattle Genetics, Inc. | Engineered Antibodies and Immunoconjugates |
| US20060167245A1 (en) | 2005-01-21 | 2006-07-27 | Immunogen, Inc. | Method for the preparation of maytansinoid esters |
| WO2006138181A2 (en) | 2005-06-14 | 2006-12-28 | Amgen Inc. | Self-buffering protein formulations |
| US20070031402A1 (en) | 2005-08-03 | 2007-02-08 | Immunogen Inc. | Immunoconjugate formulations |
| US20070037972A1 (en) | 2005-08-09 | 2007-02-15 | Millennium Pharmaceuticals, Inc. | Method of acylating maytansinol with chiral amino acids |
| US20090030924A1 (en) | 2006-03-01 | 2009-01-29 | Ana Belen Benitez | Device and Method for Generating a Media Package |
| US20090028856A1 (en) | 2007-07-16 | 2009-01-29 | Genentech, Inc. | Anti-CD79B Antibodies and Immunoconjugates and Methods of Use |
| US7695963B2 (en) | 2007-09-24 | 2010-04-13 | Cythera, Inc. | Methods for increasing definitive endoderm production |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2009099728A1 (en) | 2008-01-31 | 2009-08-13 | Genentech, Inc. | Anti-cd79b antibodies and immunoconjugates and methods of use |
| US20090274713A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen Inc. | Cross-linkers and their uses |
| US9401875B2 (en) | 2012-06-01 | 2016-07-26 | Nippon Telegraph And Telephone Corporation | Packet transfer processing method and packet transfer processing device |
| US9209965B2 (en) | 2014-01-14 | 2015-12-08 | Microsemi Semiconductor Ulc | Network interface with clock recovery module on line card |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
Non-Patent Citations (118)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1995, JOHN WILEY & SONS, INC. |
| "Macromolecule Sequencing and Synthesis, Selected Methods and Applications", 1988, ALAN R. LISS, INC., article "Current Methods in Sequence Comparison and Analysis", pages: 127 - 149 |
| "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS, INC. |
| "Recombinant DNA Methodology", 1989, ACADEMIC PRESS, INC., pages: 189 - 196 |
| "REMINGTON'S PHARMACEUTICAL SCIENCES", 1990, MACK PUBLISHING COMPANY |
| ADAMES ET AL., NATURE, vol. 318, 1985, pages 533 - 538 |
| ALDRICH ET AL., BIOTECHNOL PROG., vol. 19, 2003, pages 1433 - 38 |
| ALEXANDER ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 1436 - 1444 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., METHODS IN ENZYMOLOGY, vol. 266, 1996, pages 460 - 480 |
| ALTSCHUL ET AL., NUCL. ACIDS RES., vol. 25, 1993, pages 3389 - 3402 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ANGEW CHEM. INTL. ED. ENGL., vol. 33, 1994, pages 183 - 186 |
| APLIN; WRISTON, CRC CRIT. REV. BIOCHEM., 1981, pages 259 - 306 |
| ARAKAWA ET AL.: "Solvent interactions in pharmaceutical formulations", PHARM RES., vol. 8, no. 3, 1991, pages 285 - 91, XP009052919, DOI: doi:10.1023/A:1015825027737 |
| ASHKENAZI ET AL., PNAS USA, vol. 88, 1991, pages 10535 |
| BAUM, EMBO J., vol. 13, 1994, pages 3992 - 4001 |
| BENOIST; CHAMBON, NATURE, vol. 290, 1981, pages 304 - 310 |
| BINZ ET AL., NAT. BIOTECH., vol. 23, no. 10, 2005, pages 1257 - 1268 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BIRD, SCIENCE, vol. 242, 1988, pages 423 |
| BYM ET AL., NATURE, vol. 344, 1990, pages 677 |
| CARLSSON ET AL., BIOCHEM. J., vol. 173, 1978, pages 723 - 737 |
| CHALFIE ET AL., SCIENCE, vol. 263, 1994, pages 802 - 805 |
| COSMAN ET AL., NATURE, vol. 312, 1984, pages 768 |
| DE GRAAF ET AL., METHODS MOL BIOL., vol. 178, 2002, pages 379 - 87 |
| DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25 |
| DEVEREUX ET AL., NUCL. ACID RES., vol. 12, 1984, pages 387 - 395 |
| DUCRY; STUMP, BIOCONJUGATE CHEM., vol. 21, 2010, pages 5 - 13 |
| DUSKIN, 7. BIOL. CHEM., vol. 257, 1982, pages 3105 |
| EDGE ET AL., ANAL. BIOCHEM., vol. 118, 1981, pages 13 1 |
| EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 82, 1985, pages 3688 - 3692 |
| FANSLOW ET AL., SEMIN. IMMUNOL., vol. 6, 1994, pages 267 - 78 |
| FENG; DOOLITTLE, J. MOL. EVOL., vol. 35, 1987, pages 351 - 360 |
| GEBAUER; SKERRA, CURR. OPIN. CHEM. BIOL., vol. 13, 2009, pages 245 - 255 |
| GLUZMAN ET AL., CELL, vol. 23, 1981, pages 175 |
| GREEN ET AL., NATURE GENETICS, vol. 7, 1994, pages 13 - 21 |
| GREEN; JAKOBOVITIS, J. EX. MED., vol. 188, 1998, pages 483 - 495 |
| GREWAL, EXPERT OPIN. THER. TARGETS, vol. 12, 2008, pages 341 - 351 |
| GREWAL, EXPERT OPIN. THER. TARGETS., vol. 12, 2008, pages 341 - 351 |
| GROSSCHEDL ET AL., CELL, vol. 38, 1984, pages 647 - 658 |
| HAKIMUDDIN ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 259, 1987, pages 52 |
| HAMMER ET AL., SCIENCE, vol. 253, 1987, pages 53 - 58 |
| HANAHAN, NATURE, vol. 315, 1985, pages 115 - 122 |
| HCIM ET AL., CURR. BIOL., vol. 6, 1996, pages 178 - 182 |
| HIGGINS; SHARP, CABIOS, vol. 5, 1989, pages 151 - 153 |
| HOLLENBAUGH ET AL.: "Construction of Immunoglobulin Fusion Proteins", CURRENT PROTOCOLS IN IMMUNOLOGY, no. 4, 1992, pages 10.19.1 - 10.19.11 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 90, 1993, pages 6444 - 6448 |
| HOPP ET AL., BIOLTECHNOLOGY, vol. 6, 1988, pages 1204 |
| HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 191 |
| HU ET AL., CANCER RES., vol. 56, 1996, pages 3055 - 3061 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 5879 - 5883 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 |
| ICHIKI ET AL., J. IMMUNOL., vol. 150, 1993, pages 5408 - 5417 |
| JONES, NATURE, vol. 321, 1986, pages 522 - 525 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE N.I.H. |
| KARIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 90, 1993, pages 5873 - 5787 |
| KELSEY ET AL., GENES AND DEVEL., vol. 1, 1987, pages 161 - 171 |
| KENDRICK ET AL.: "RATIONAL DESIGN OF STABLE PROTEIN FORMULATIONS: THEORY AND PRACTICE", vol. 13, 2002, article "Physical stabilization of proteins in aqueous solution", pages: 61 - 84 |
| KOLLIAS ET AL., CELL, vol. 46, 1986, pages 89 - 94 |
| KORNDORFER ET AL., PROTEINS: STRUCTURE, FUNCTION, AND BIOINFORMATICS, vol. 53, no. 1, 2003, pages 121 - 129 |
| KORTT ET AL., BIOMOL. ENG., vol. 18, 2001, pages 95 - 108 |
| KORTT ET AL., PROTO ENG., vol. 10, 1997, pages 423 |
| KRIANGKUM ET AL., BIOMOL. ENG., vol. 18, 2001, pages 31 - 40 |
| KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 1648 |
| LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759 |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LEDER ET AL., CELL, vol. 45, 1986, pages 485 - 495 |
| LENS ET AL., BRIT. J. HEMATOL., vol. 106, 1999, pages 491 - 503 |
| LUCKOW; SUMMERS, BIOLTECHNOLOGY, vol. 6, 1988, pages 47 |
| MACDONALD, HEPATOLOGY, vol. 7, 1987, pages 425 - 515 |
| MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 1378 |
| MATTER ET AL., J EXP MED, vol. 203, 2006, pages 2145 - 55 |
| MCMAHAN ET AL., EMBO J., vol. 10, 1991, pages 2821 |
| MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156 |
| MOGRAM ET AL., NATURE, vol. 315, 1985, pages 338 - 340 |
| MORTON ET AL., BLOOD, vol. 107, 2002, pages 265 - 276 |
| NAKAJIMA ET AL., J. NEUROIMMUNOL., vol. 109, 2000, pages 188 - 96 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| NOLAN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2603 - 2607 |
| OMITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399 - 409 |
| PEARSON; LIPMAN, PROC. NAT. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2444 |
| PINKERT ET AL., GENES AND DEVEL., vol. 1, 1987, pages 268 - 276 |
| POUWELS ET AL.: "Cloning Vectors: A Laboratory Manual", 1985, ELSEVIER |
| PRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42 |
| RANDOLPH ET AL.: "Surfactant-protein interactions", PHARM BIOTECHNOL., vol. 13, 2002, pages 159 - 75 |
| RANHEIM ET AL., BLOOD, vol. 85, 1965, pages 3556 - 3565 |
| RASMUSSEN ET AL., CYTOTECHNOLOGY, vol. 28, 1998, pages 31 |
| READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 712 |
| REITER ET AL., NATURE BIOTECH., vol. 14, 1996, pages 1239 - 1245 |
| ROQUE ET AL., BIOTECHNOL. PROG., vol. 20, 2004, pages 639 - 654 |
| SAIKI ET AL., SCIENCE, vol. 239, 1988, pages 487 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY |
| SAMBROOK; FRITSCH; MANIATIS: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SANI, NATURE, vol. 314, 1985, pages 283 - 286 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 2, 1983, pages 547 - 556 |
| SIMON ET AL., PROC. NAIL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 9367 |
| SLACK ET AL., INT. IMMUNOL., vol. 7, no. 7, 1995, pages 1087 - 1092 |
| SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| STAUBCR, BIOTECHNIQUES, vol. 24, 1998, pages 462 - 471 |
| STROHL, CURR. OPIN. BIOTECH., vol. 20, 2009, pages 685 - 691 |
| SUMMERS; SMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN NO. 1555, 1987 |
| SWIFT ET AL., CELL, vol. 38, 1984, pages 639 - 646 |
| T. E. CREIGHTON: "Proteins: Structure and Molecular Properties", 1983, W. H. FREEMAN & CO., pages: 79 - 86 |
| TARABAN, J. IMMUNOL., vol. 173, 2004, pages 6542 - 6 |
| THORNSEN ET AL., PROC. NATL. ACAD. U.S.A., vol. 81, 1984, pages 659 - 663 |
| THOTAKURA ET AL., METH. ENZYMOL., vol. 138, 1987, pages 350 |
| TOMLINSON, METHODS ENZYMOL., vol. 326, 2000, pages 461 - 479 |
| TRENTIN ET AL., CANCER RES., vol. 57, 1997, pages 4940 - 4947 |
| TROUET ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 626 - 629 |
| UMEMOTO ET AL., INT. J. CANCER, vol. 43, 1989, pages 677 - 684 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 3731 |
| WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1444 - 1445 |
| WARD ET AL., NATURE, vol. 334, 1989, pages 544 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797 |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2016519124A (ja) * | 2013-04-29 | 2016-06-30 | サノフイ | 抗il−4/抗il−13二特異的抗体製剤 |
| US10603388B2 (en) | 2014-09-02 | 2020-03-31 | Immunogen, Inc. | Methods for formulating antibody drug conjugate compositions |
| US10889652B2 (en) | 2015-01-16 | 2021-01-12 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ROR1 |
| US11919970B2 (en) | 2015-01-16 | 2024-03-05 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ROR1 |
| US10968275B2 (en) | 2016-02-02 | 2021-04-06 | Fred Hutchinson Cancer Research Center | Anti-ROR1 antibodies and uses thereof |
| US11932691B2 (en) | 2016-02-02 | 2024-03-19 | Fred Hutchinson Cancer Center | Anti-ROR1 antibodies and uses thereof |
| US11613584B1 (en) | 2021-10-13 | 2023-03-28 | Immuneonco Biopharmaceuticals (Shanghai) Inc. | Antibodies binding CD70, preparation and use thereof |
| EP4166571A1 (en) * | 2021-10-13 | 2023-04-19 | ImmuneOnco Biopharmaceuticals (Shanghai) Inc. | Antibodies binding cd70, preparation and use thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2018200154B2 (en) | CD27L Antigen Binding Proteins | |
| AU2017228686B2 (en) | Oncostatin M Receptor Antigen Binding Proteins | |
| HK40072994A (en) | Oncostatin m receptor antigen binding proteins | |
| HK40108780A (en) | Oncostatin m receptor antigen binding proteins | |
| HK1199042B (en) | Cd27l antigen binding proteins | |
| NZ622711B2 (en) | Cd27l antigen binding proteins | |
| NZ717820B2 (en) | Cd27l antigen binding proteins | |
| HK1221961B (en) | Oncostatin m receptor antigen binding proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12766835 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2849318 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 231603 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2014531981 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014000699 Country of ref document: CL Ref document number: 000398-2014 Country of ref document: PE Ref document number: MX/A/2014/003482 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12014500666 Country of ref document: PH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012766835 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14075643 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: CR2014-000169 Country of ref document: CR |
|
| ENP | Entry into the national phase |
Ref document number: 2012312274 Country of ref document: AU Date of ref document: 20120920 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2014000236 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 20147010524 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201490677 Country of ref document: EA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112014006822 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112014006822 Country of ref document: BR Kind code of ref document: A2 Effective date: 20140321 |