WO2013034904A1 - Anti-cd40 antibodies, uses and methods - Google Patents

Anti-cd40 antibodies, uses and methods Download PDF

Info

Publication number
WO2013034904A1
WO2013034904A1 PCT/GB2012/052179 GB2012052179W WO2013034904A1 WO 2013034904 A1 WO2013034904 A1 WO 2013034904A1 GB 2012052179 W GB2012052179 W GB 2012052179W WO 2013034904 A1 WO2013034904 A1 WO 2013034904A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
fusion
variant
derivative
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2012/052179
Other languages
English (en)
French (fr)
Inventor
Peter Bo Joakim Ellmark
Eva Maria Dahlen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bioinvent International AB
Alligator Bioscience AB
Original Assignee
Bioinvent International AB
Alligator Bioscience AB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to PL12761786T priority Critical patent/PL2753646T3/pl
Priority to US14/342,141 priority patent/US9676862B2/en
Priority to JP2014527743A priority patent/JP6324891B2/ja
Priority to EP12761786.8A priority patent/EP2753646B1/en
Priority to RU2014113304A priority patent/RU2649055C2/ru
Priority to NO12761786A priority patent/NO2753646T3/no
Priority to CN201280054090.1A priority patent/CN103930442B/zh
Priority to RS20180200A priority patent/RS56868B1/sr
Priority to KR1020147008695A priority patent/KR102029946B1/ko
Priority to EP17195987.7A priority patent/EP3323834B1/en
Priority to ES12761786.8T priority patent/ES2658157T3/es
Priority to SI201231140T priority patent/SI2753646T1/en
Priority to LTEP12761786.8T priority patent/LT2753646T/lt
Priority to DK12761786.8T priority patent/DK2753646T3/en
Priority to CA2860406A priority patent/CA2860406C/en
Priority to SM20180144T priority patent/SMT201800144T1/it
Application filed by Bioinvent International AB, Alligator Bioscience AB filed Critical Bioinvent International AB
Priority to HRP20180269TT priority patent/HRP20180269T1/hr
Priority to AU2012306071A priority patent/AU2012306071B2/en
Publication of WO2013034904A1 publication Critical patent/WO2013034904A1/en
Anticipated expiration legal-status Critical
Priority to US15/588,919 priority patent/US10640567B2/en
Priority to CY20181100161T priority patent/CY1119925T1/el
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1027Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants
    • A61K51/103Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants against receptors for growth factors or receptors for growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1093Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody conjugates with carriers being antibodies
    • A61K51/1096Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody conjugates with carriers being antibodies radioimmunotoxins, i.e. conjugates being structurally as defined in A61K51/1093, and including a radioactive nucleus for use in radiotherapeutic applications
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0048Eye, e.g. artificial tears
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/02Suppositories; Bougies; Bases therefor; Ovules
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/08Solutions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/20Pills, tablets, discs, rods
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35Valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to antibody-based polypeptides with binding specificity for CD40 exhibiting improved affinity and/or agonist potency, which have utility in the treatment of diseases such as cancer.
  • the invention also relates to pharmaceutical compositions, uses, methods and kits comprising such antibodies.
  • Monoclonal antibody (Mab) therapy can be used to: i) target cancer cells for destruction, either using the antibodies naked or conjugated to a toxin
  • Cancer vaccines which includes tumour cell vaccines (autologous or allogeneic), antigenic vaccines and dendritic cells (DCs) vaccine, DNA vaccines, and vector- based vaccines (e.g. adenovirus-based gene transfer).
  • tumour cell vaccines autologous or allogeneic
  • DCs dendritic cells
  • DNA vaccines DNA vaccines
  • vector- based vaccines e.g. adenovirus-based gene transfer
  • Non-specific immunotherapies and adjuvants which act by stimulating the immune system more generally and thereby activate tumour-specific immune cells that have been suppressed by the tumour environment. This may be done either by stimulating or activating immune effector cells giving an immune reaction to the tumour (e.g. effector T cells, or T eff cells) or by inhibiting or inactivating cells with an inhibitory phenotype (e.g. regulatory T cells, or T reg cells).
  • An approach like this will include active molecules like cytokines, bacterial adjuvants as well as drugs (including mAbs) that target immuno-regulatory receptors (e.g. CTLA-4 and CD40). Additional approaches include adoptive T cell transfer and T reg depletion therapies, which fall somewhere between the two latter groups.
  • CD40 is a cell-surface expressed glycoprotein that belongs to the tumour necrosis factor receptor (TNFR) superfamily and plays a central role in the immune system. It is expressed on a variety of immune cells, such as B cells, dendritic cells, monocytes, and macrophages. Professional antigen-presenting cells (APCs), are activated when signalling via CD40 occurs (reviewed by Schonbeck and Libby, 2001 , Cell Mol Life Sci, 58(1): 4-43).
  • TNFR tumour necrosis factor receptor
  • CD154 or CD40L The natural ligand of CD40, designated CD154 or CD40L, is mainly expressed on mature T lymphocytes (Armitage et a/., 1992, Nature, 357: 80-82; Schonbeck et a/., 2001 , Cell Mol Life Sci., 58,40-43; van Kooten et a/., 2000, J. Leuk. Biol., 67: 2-17; Quezada et a/., 2004, Annu. Rev. Immunol., 22:3077-328).
  • CD40L-mediated signalling triggers several biological events, including immune cell activation, proliferation, and production of cytokines and chemokines (Schonbeck et ai, 2001 , Cell Mol Life Sci., 58:40-43; van Kooten et al., 2000, J. Leuk., Biol., 67: 2-17).
  • CD40 signalling is critical for T cell-dependent and B cell-dependent immune responses, and patients with non-functional CD40 or CD40L are markedly immune suppressed (Foy et ai, 1993, J Exp Med 5:1567-1575; Siepmann ef ai, 2001, Immunology 3:263-272; Allen et ai, 1993, Science, 259:990-993).
  • Stimulation of antigen presenting cells, such as human B cells and dendritic cells with recombinant CD40L or anti-CD40 antibodies induces up-regulation of surface markers, such as CD23, CD80, CD86, Fas and MHC II, and secretion of soluble cytokines, e.g.
  • CD40 stimulated dendritic cells can activate tumour specific effector T cells, which have the potential to eradicate tumour cells ((van Kooten ef a/., 2000, J Leucoc Biol,67:2-17; Sotomayor et ai, 1999, Nature Medicine, 5:780-787).
  • CD40 expression occurs in many normal cells and in tumour cells. For example, all B- lymphomas and 30% to 70% of solid tumours have CD40 expression. Melanomas and carcinomas belong to the tumours having CD40 expression. It is well established that activation of CD40 is effective in triggering anti-tumour responses (Tong et a/., 2003, Cancer Gene Therapy, 10(1):1-13; Ottalano et ai, 2002, Tumori, 88 (5):361-6).
  • the effect of CD40 activation contribute to tumour growth impairment, involves at least mechanisms of, immune activation producing a tumour-specific T cell response, a direct apoptotic effect on CD40-positive tumours and stimulating a humoral response leading to ADCC.
  • agonistic CD40 antibodies including SGN-40 (a humanized antibody having partial and weak agonistic properties) and CP-870,893 (a fully human and selective CD40 agonistic monoclonal antibody) (Khalil and Vonderheide, 2007, Update on Cancer Therapeutics, 2:61-65; Hussein er a/., 2010, Haematologica, 95:845-848).
  • CD40-antibodies have been associated with adverse side effects, such as shock syndrome, and cytokine release syndrome (van Mierlo et al., 2002, Proc. Natl. Acad. Sci. USA, 99:5561-5566; van Mierlo et al., 2004, J Immunol 173:6753-6759).
  • the invention provides an antibody or an antigen-binding fragment thereof with multivalent binding specificity for CD40, or a variant, fusion or derivative of said antibody or antigen-binding fragment, or a fusion of a said variant or derivative thereof, which retains the multivalent binding specificity for CD40, wherein the potency of the antibody, antigen-binding fragment, or fusion, variant or derivative thereof, for dendritic cell activation is higher than, or is equal to, its potency for B cell activation and wherein the antibody, antigen-binding fragment, or fusion, variant or derivative thereof has an affinity (KD) for CD40 of less than 1x10 "10 M (i.e. 0.1 nM).
  • KD affinity
  • the first aspect of the invention provides an antibody or an antigen-binding fragment thereof with multivalent binding specificity for CD40, or a variant, fusion or derivative of said antibody or antigen-binding fragment, or a fusion of a said variant or derivative thereof, which retains the multivalent binding specificity for CD40, wherein the antibody, antigen-binding fragment, or fusion, variant or derivative thereof is capable of exerting dual cytotoxic effects on CD40 + tumour cells (preferably in vivo).
  • dual cytotoxic effects we include a direct apoptotic effect on the tumour cells and an indirect immune cell-mediated cytotoxic (e.g. ADCC) effect on the tumour cells.
  • potency with respect to dendritic cell activation and B cell activation, we mean the EC50 for such cell activation by the antibody, antigen-binding fragment, or fusion, variant or derivative thereof. It will be appreciated by persons skilled in the art that potency for dendritic cell activation and B cell activation may be measured by different methods, including but lot limited to those methods described in the Examples below.
  • dendritic cell activation is defined by reference to an EC50 for the stimulation of expression of CD80 measured by FACS analysis (such as in Example 4) and B cell activation is defined by reference to an EC50 for the proliferation B cells (such as in Example 6).
  • CD40 agonist therapy of cancer is firmly linked to T-cell activation (French et al., 1999, Nature Medicine, 548- 553; van Kooten et al., 2000, J Leucoc Biol,67:2-17; Sotomayor et al., 1999, Nature Medicine, 5:780-787), and this T-cell activation depends on activation of professional antigen presenting cells, in particular dendritic cells (Melief et al., 2000, 75: 235-282).
  • the present inventors have developed agonistic anti-CD40 antibody clones which have an improved ability to activate dendritic cells.
  • the antibodies, antigen-binding fragments, variants, fusions and derivatives thereof, of the invention have a potency for dendritic cell activation which is higher than, or equal to, their potency for B cell activation.
  • the antibodies, antigen-binding fragments, variants, fusions and derivatives thereof, of the invention have a potency for B cell activation which is lower than, or is equal to, their dendritic cell activation which is higher than, or is equal to, its potency for dendritic cell activation.
  • binding specificity we include the ability of the antibody, antigen-binding fragment, variant, fusion or derivative thereof, of the invention to bind at least 10-fold more strongly to CD40 than to any other polypeptide; preferably at least 50-fold more strongly and more preferably at least 100-fold more strongly.
  • the antibody, antigen- binding fragment, variant, fusion or derivative thereof, of the invention binds selectively to CD40 under physiological conditions (for example, in vivo; and for example, when CD40 is present on the cell surface).
  • multivalent we include that the antibody, antigen-binding fragment, variant, fusion or derivative thereof, of the invention comprises two or more antigen binding sites with binding specificity for CD40.
  • the antibody may comprise two or three or four or five or six or more such antigen binding sites.
  • the antibody is an intact, bivalent IgG antibody.
  • CD40 is a cell-surface expressed glycoprotein that belongs to the tumour necrosis factor receptor (TNFR) superfamily and plays a central role in the immune system. It is expressed on a variety of immune cells, such as B cells, Dendritic cells, monocytes, and macrophages, and professional APCs, are activated when signalling via CD40 occurs (reviewed by Tasci et al., 2001 , Cell. Mol. Life Sci., (58), 4-43). CD40 expression occurs in many normal cells and tumour cells, such as B-lymphomas, solid tumours, melanomas and carcinomas.
  • TNFR tumour necrosis factor receptor
  • CD40 activation contributes to tumour growth impairment by at least the mechanisms of immune activation, a direct apoptotic effect on CD40-positive tumours and stimulation of a humoral response leading to ADCC and CDC.
  • ADCC and CDC depends on the host immune system interacting with the Fc-part of the antibody, which is determined by the heavy chain constant domain.
  • gammal is the isotype that most effectively evokes ADCC and CDC (Janeway ' s Immunobiology, 2008, 7th edition, Garland Science).
  • the preferred Fc for the antibodies of the invention is a gamma 1 Fc, making the anti-CD40 antibody an lgG1 isotype. It would also be possibly to further enhance these effects using a number of known methods, such as Fc-engineering (point mutations) and glycan modifications (reviewed by Carter, Nature Reviews Immunology, 2006 (6), 343-357).
  • the mechanism by which the antibodies activate CD40 on dendritic cells and B cells is dependent on both the epitope on CD40 to which it binds and on receptor multimerization.
  • the dimerization of the CD40 receptor by the exemplary bivalent antibody (lgG1) of the invention is advantageous for its agonistic effect.
  • CD40 we include any natural or synthetic protein with structural and/or functional identity to the human CD40 protein as defined herein and/or natural variants thereof.
  • the CD40 is human CD40, such as UniProt Accession No. P25942 and GenBank Accession No. AAH12419.
  • the CD40 be from any mammal such as a domesticated mammal (preferably of agricultural or commercial significance including a horse, pig, cow, sheep, dog and cat).
  • mammal preferably of agricultural or commercial significance including a horse, pig, cow, sheep, dog and cat.
  • mammal preferably of agricultural or commercial significance including a horse, pig, cow, sheep, dog and cat.
  • mammal we include any protein found in, derived from, and/or isolated from, one or more cells of a mammal; for example, the term “human protein” includes a protein found in, derived from, and/or isolated from one or more cells of a human.
  • the antibodies, antigen-binding fragments, variants, fusions and derivatives thereof, of the invention are capable of activating B cells and dendritic cells.
  • Dendritic cells are activated when signalling via CD40 occurs, which triggers several biological events, including immune cell activation, proliferation, and production of cytokines and chemokines.
  • Methods for determining Dendritic cell activation associated with CD40 are known in the art (discussed, for example, in Schonbeck ef a/., 2001 , Cell Mol Life Sci., 58:40-43; van Kooten et a/., 2000, J. Leuk., Biol., 67: 2-17) and are described in the accompanying Examples.
  • Stimulation of human B cells with recombinant CD40L or anti-CD40 antibodies induces up-regulation of surface markers, such as CD23, CD30, CD80, CD86, Fas and MHC II, secretion of soluble cytokines, e.g. IL-6, TNF- ⁇ and TNF-a, and homeotypic aggregation.
  • surface markers such as CD23, CD30, CD80, CD86, Fas and MHC II
  • soluble cytokines e.g. IL-6, TNF- ⁇ and TNF-a
  • homeotypic aggregation e.g. IL-6, TNF- ⁇ and TNF-a
  • the antibodies, antigen-binding fragments, variants, fusions and derivatives thereof, of the invention have been optimised in order to provide improved potency for the activation of dendritic cells.
  • the potency for the activation of dendritic cells is selectively increased relative to the potency for the activation of B cells.
  • the activation of dendritic cells may be assessed by measuring the upregulation of cell surface markers such as CD86 and CD80 (see Example 3) and/or by measuring anti-CD40 antibody-induced secretion of IFNy from T cells (see Example 4 below).
  • the activation of B cells may be assessed by measuring the upregulation of cell surface markers (such as CD86; see Gladue et a/., 2011 , supra.) and/or by measuring anti-CD40 antibody-induced B cell proliferation (see Example 6 below).
  • cell surface markers such as CD86; see Gladue et a/., 2011 , supra.
  • anti-CD40 antibody-induced B cell proliferation see Example 6 below.
  • the antibodies, antigen-binding fragments, variants, fusions and derivatives thereof, of the invention activate dendritic cells at least as potently as they activate B cells (for example, as determined by measurement of the upregulation of CD80 and/or CD86 thereon).
  • the antibodies, antigen-binding fragments, variants, fusions and derivatives thereof, of the invention may have two-fold greater potency for the activation of dendritic versus B cells, for example, at least three-fold, four-fold, five-fold, six-fold, seven-fold, eight-fold, nine-fold, ten-fold or more greater potency for the activation of dendritic cells.
  • antibody we include substantially intact antibody molecules, as well as chimaeric antibodies, humanised antibodies, human antibodies (wherein at least one amino acid is mutated relative to the naturally occurring human antibodies), single chain antibodies, bi- specific antibodies, antibody heavy chains, antibody light chains, homo-dimers and heterodimers of antibody heavy and/or light chains, and antigen binding fragments and derivatives of the same.
  • the term also includes antibody-like molecules which may be produced using phage-display techniques or other random selection techniques for molecules.
  • the term also includes all classes of antibodies, including: IgG, IgA, IgM, IgD and IgE.
  • antibody fragments such as Fab, F(ab')2, Fv and other fragments thereof that retain the antigen-binding site.
  • antibody includes genetically-engineered derivatives of antibodies such as single chain Fv molecules (scFv) and single domain antibodies (dAbs). Such fragments and derivatives can be made multivalent for CD40 by multimerisation, e.g. scFv-scFV or dAb-dAb dimers.
  • variable heavy (V H ) and variable light (V L ) domains of the antibody are involved in antigen recognition, a fact first recognised by early protease digestion experiments. Further confirmation was found by "humanisation" of rodent antibodies. Variable domains of rodent origin may be fused to constant domains of human origin such that the resultant antibody retains the antigenic specificity of the rodent parented antibody (Morrison et al (1984) Proc. Natl. Acad. Sci. USA 81 , 6851-6855).
  • the invention encompass variants, fusions and derivatives of the antibodies and antigen- binding fragments of the invention, as well as fusions of a said variants or derivatives, provided such variants, fusions and derivatives have binding specificity for CD40 and a potency for Dendritic cell activation which is higher than, or is equal to, potency for B cell activation.
  • antibodies and antigen-binding fragments thereof comprise one or more polypeptide component
  • suitable variants, fusions and derivatives of the antibody and antigen-binding fragment thereof as defined herein may be made using the methods of protein engineering and site-directed mutagenesis well known in the art using the recombinant polynucleotides (see example, see Molecular Cloning: a Laboratory Manual, 3rd edition, Sambrook & Russell, 2001 , Cold Spring Harbor Laboratory Press, which is incorporated herein by reference).
  • variants, fusions and derivatives of the antibody or antigen-binding fragment thereof as defined herein may be made based on the polypeptide component of the antibody or antigen-binding fragment thereof.
  • fusion we include said polypeptide fused to any other polypeptide.
  • the said polypeptide may be fused to a polypeptide such as glutathione-S-transferase (GST) or protein A in order to facilitate purification of said polypeptide. Examples of such fusions are well known to those skilled in the art.
  • the said polypeptide may be fused to an oligo-histidine tag such as His6 or to an epitope recognised by an antibody such as the well-known Myc-tag epitope. Fusions to any variant or derivative of said polypeptide are also included in the scope of the invention.
  • the fusion may comprise or consist of a further portion which confers a desirable feature on the said polypeptide; for example, the portion may be useful in detecting or isolating the polypeptide, or promoting cellular uptake of the polypeptide.
  • the portion may be, for example, a biotin moiety, a radioactive moiety, a fluorescent moiety, for example a small fluorophore or a green fluorescent protein (GFP) fluorophore, as well known to those skilled in the art.
  • the moiety may be an immunogenic tag, for example a Myc-tag, as known to those skilled in the art or may be a lipophilic molecule or polypeptide domain that is capable of promoting cellular uptake of the polypeptide, as known to those skilled in the art.
  • variants of said polypeptide we include insertions, deletions and substitutions, either conservative or non-conservative.
  • variants of the polypeptide where such changes do not substantially alter the activity of the said polypeptide.
  • Variants may include, for example, allelic variants which will typically, vary from the given sequence by only one or two or three, and typically no more than 10 or 20 amino acid residues. Typically, the variants have conservative substitutions.
  • the polypeptide variant may have an amino acid sequence which has at least 75% identity with one or more of the amino acid sequences given above, for example at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity with one or more of the amino acid sequences specified herein.
  • variants of the polypeptides defined herein include polypeptides comprising a sequence with at least 60% identity to an amino acid sequence selected from the group comprising: SEQ ID NO: 19; SEQ ID NO:20; SEQ ID NO:21 ; SEQ ID NO:22; SEQ ID NO:23; SEQ ID NO:24; SEQ ID NO:25; SEQ ID NO:26; SEQ ID NO:27; and SEQ ID NO:28; SEQ ID NO:32; SEQ ID NO:33; SEQ ID NO:34; SEQ ID NO:35; SEQ ID NO:36; SEQ ID NO:37; SEQ ID NO:38; and SEQ ID NO:39; and is preferably at least 70% or 80% or 85% or 90% identity to said sequence, and more preferably at least 95%, 96%, 97%, 98% or 99% identity to said sequence.
  • Percent identity can be determined by, for example, the LALIGN program (Huang and Miller, Adv. Appl. Math. (1991 ) 12:337-357) at the Expasy facility site (http://www.ch.embnet.org/software/l_ALIGN_form.html) using as parameters the global alignment option, scoring matrix BLOSUM62, opening gap penalty -14, extending gap penalty -A.
  • the percent sequence identity between two polypeptides may be determined using suitable computer programs, for example the GAP program of the University of Wisconsin Genetic Computing Group and it will be appreciated that percent identity is calculated in relation to polypeptides whose sequence has been aligned optimally.
  • the alignment may altematively be carried out using the Clustal W program (as described in Thompson et al., 1994, Nucl. Acid Res. 22:4673-4680, which is incorporated herein by reference).
  • the parameters used may be as follows:
  • the BESTFIT program may be used to determine local sequence alignments.
  • the antibody, antigen-binding fragment, variant, fusion or derivative of the invention may comprise or consist of one or more amino acids which have been modified or derivatised.
  • Chemical derivatives of one or more amino acids may be achieved by reaction with a functional side group.
  • derivatised molecules include, for example, those molecules in which free amino groups have been derivatised to form amine hydrochlorides, p- toluene sulphonyl groups, carboxybenzoxy groups, f-butyloxycarbonyl groups, chloroacetyl groups or formyl groups.
  • Free carboxyl groups may be derivatised to form salts, methyl and ethyl esters or other types of esters and hydrazides.
  • Free hydroxyl groups may be derivatised to form O-acyl or O-alkyl derivatives.
  • Also included as chemical derivatives are those peptides which contain naturally occurring amino acid derivatives of the twenty standard amino acids.
  • 4-hydroxyproline may be substituted for proline
  • 5-hydroxylysine may be substituted for lysine
  • 3-methylhistidine may be substituted for histidine
  • homoserine may be substituted for serine and ornithine for lysine.
  • Derivatives also include peptides containing one or more additions or deletions as long as the requisite activity is maintained.
  • Other included modifications are amidation, amino terminal acylation (e.g. acetylation or thioglycolic acid amidation), terminal carboxylamidation (e.g. with ammonia or methylamine), and the like terminal modifications.
  • peptidomimetic compounds may also be useful.
  • the term 'peptidomimetic' refers to a compound that mimics the conformation and desirable features of a particular peptide as a therapeutic agent.
  • the said polypeptide includes not only molecules in which amino acid residues are joined by peptide (-CO-NH-) linkages but also molecules in which the peptide bond is reversed.
  • Such retro-inverso peptidomimetics may be made using methods known in the art, for example such as those described in Meziere et al. (1997) J. Immunol. 159, 3230-3237, which is incorporated herein by reference.
  • Retro-inverse peptides which contain NH-CO bonds instead of CO-NH peptide bonds, are much more resistant to proteolysis.
  • the said polypeptide may be a peptidomimetic compound wherein one or more of the amino acid residues are linked by a -y(CH 2 NH)- bond in place of the conventional amide linkage.
  • the peptide bond may be dispensed with altogether provided that an appropriate linker moiety which retains the spacing between the carbon atoms of the amino acid residues is used; it may be advantageous for the linker moiety to have substantially the same charge distribution and substantially the same planarity as a peptide bond.
  • the said polypeptide may conveniently be blocked at its N- or C-terminus so as to help reduce susceptibility to exo-proteolytic digestion.
  • a presumed bioactive conformation may be stabilised by a covalent modification, such as cyclisation or by incorporation of lactam or other types of bridges, for example see Veber et al., 1978, Proc. Natl. Acad. Sci. USA 75:2636 and Thursell et al., 1983, Biochem. Biophys. Res. Comm. 111 :166, which are incorporated herein by reference.
  • a common theme among many of the synthetic strategies has been the introduction of some cyclic moiety into a peptide-based framework.
  • the cyclic moiety restricts the conformational space of the peptide structure and this frequently results in an increased specificity of the peptide for a particular biological receptor.
  • An added advantage of this strategy is that the introduction of a cyclic moiety into a peptide may also result in the peptide having a diminished sensitivity to cellular peptidases.
  • exemplary polypeptides of the invention comprise or consist of terminal cysteine amino acids.
  • Such a polypeptide may exist in a heterodetic cyclic form by disulphide bond formation of the mercaptide groups in the terminal cysteine amino acids or in a homodetic form by amide peptide bond formation between the terminal amino acids.
  • cyclising small peptides through disulphide or amide bonds between the N- and C-terminus cysteines may circumvent problems of specificity and half-life sometime observed with linear peptides, by decreasing proteolysis and also increasing the rigidity of the structure, which may yield higher specificity compounds.
  • Polypeptides cyclised by disulphide bonds have free amino and carboxy-termini which still may be susceptible to proteolytic degradation, while peptides cyclised by formation of an amide bond between the N-terminal amine and C-terminal carboxyl and hence no longer contain free amino or carboxy termini.
  • the peptides can be linked either by a C-N linkage or a disulphide linkage.
  • heterodetic linkages may include, but are not limited to formation via disulphide, alkylene or sulphide bridges.
  • Methods of synthesis of cyclic homodetic peptides and cyclic heterodetic peptides, including disulphide, sulphide and alkylene bridges, are disclosed in US 5,643,872, which is incorporated herein by reference.
  • Other examples of cyclisation methods are discussed and disclosed in US 6,008,058, which is incorporated herein by reference.
  • RCM ring-closing metathesis
  • terminal modifications are useful, as is well known, to reduce susceptibility by proteinase digestion and therefore to prolong the half-life of the peptides in solutions, particularly in biological fluids where proteases may be present.
  • Polypeptide cyclisation is also a useful modification because of the stable structures formed by cyclisation and in view of the biological activities observed for cyclic peptides.
  • the said polypeptide is cyclic.
  • the said polypeptide is linear.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof has a higher potency for dendritic cell activation than the known anti-CD40 antibody "B44" (the amino acid sequences of which are shown in Example 10 below).
  • the B44 agonistic antibody originates from the n-CoDeR ® library, which is a human antibody fragment display library, and property of Biolnvent International AB (Soderlind et a/., 2000, Nature Biotechnol., 18:852-6; WO 98/32845).
  • the B44 antibody has a moderate to low affinity constant (KD) of 1.7 nM, and moderate potency as determined in vitro (Ellmark et a/., 2002, Immunology, 106:456-463; Ellmark et a/., 2008, AIDS Research and Human Retroviruses, 243, 367-372).
  • KD moderate to low affinity constant
  • the affinity and potency of the B44 agonistic antibody renders it unsuitable as a clinically and therapeutically relevant anti- CD40 agonist antibody.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof has a potency for dendritic cell activation (measured as an EC50, as described in Example 4) of at least 0.5 pg/ml (i.e. the EC50 is lower or equal to 0.5 pg/ml).
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof may have an EC50 for stimulation of CD80 (as measured in Example 4) of less than 0.5 Mg/ml, e.g. less than 0.4 pg/ml, 0.3 Mg/ml, 0.2 pg/ml, 0.1 g/ml, or less than 0.05 Mg/ml.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof has improved binding specificity for CD40 relative to that of the B44 antibody.
  • the kinetic parameter that is most commonly referred to is the overall affinity, usually expressed as the dissociation constant (KD).
  • KD dissociation constant
  • This static parameter reflects the relative occupancy of a cell receptor at equilibrium and is relevant for systemic administration.
  • the antibody may leak out of the local tumour area and the reaction time is thus limited. Therefore, a high on-rate (high ka) may be very important for the clinical effect during local administration, since it determines the time it takes for the antibody to reach equilibrium (Katakura et al., Journal of Molecular Catalysis, (28), 191-200, 2004).
  • a slow off-rate may (low kd) affect the duration of the treatment, and may serve to constrain the antibody to the tumour area, thereby minimizing systemic exposure and toxicity.
  • the antibody of the invention has an affinity (KD) for CD40 of lower than 1.0 x10 "10 M, for example a KD lower than 9.0 x10 "11 M, 8.0 x10 "11 M, 7.0 x10 '11 M, 6.0 x10 "11 M, 5.0 x10 "11 M, 4.0 x10 "11 M, 3.0 x10 "11 M, 2.0 x10 "11 M or lower than 1.0 x10 "11 M.
  • KD affinity for CD40 of lower than 1.0 x10 "10 M, for example a KD lower than 9.0 x10 "11 M, 8.0 x10 "11 M, 7.0 x10 '11 M, 6.0 x10 "11 M, 5.0 x10 "11 M, 4.0 x10 "11 M, 3.0 x10 "11 M, 2.0 x10 "11 M or lower than 1.0 x10 "11 M.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof has an on-rate for CD40 higher than that of the B44 antibody, for example an on-rate (ka) of greater than 2.7 x10 6 Ms, and preferably an on-rate (ka) of greater than 3.0 x 10 6 Ms; or 4.0 x 10 6 Ms; or 5.0 x 10 6 Ms; or 6.0 x 10 6 Ms; or 7.0 x 10 6 Ms; or 8.0 x 10 6 Ms; or 9.0 x 10 6 Ms; orlO x 10 7 Ms.
  • an on-rate for CD40 higher than that of the B44 antibody for example an on-rate (ka) of greater than 2.7 x10 6 Ms, and preferably an on-rate (ka) of greater than 3.0 x 10 6 Ms; or 4.0 x 10 6 Ms; or 5.0 x 10 6 Ms; or 6.0 x 10 6 Ms; or 7.0 x 10 6 Ms; or 8.0 x 10 6
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof has a lower off-rate for CD40 lower than that of the B44 antibody, for example an off-rate (kd) of lower than 4.5 x10 "3 s, and preferably an off-rate of lower than 3.0 x 10 "3 s; or 2.0 x 10 "3 s; or 1.0 x 10 "3 s; or 9.0 x 10 "4 s; or 8.0 x 10 "4 s; or 7.0 x 10 "4 s; or 6.0 x 10 "4 s; or 5.0 x 10 "4 s; or 3.0 x 10 "4 s; or 2.0 x 10 "4 s; or 1.0 x 10 "4 s; or 9.0 x 10 "5 s; or 8.0 x 10 "5 s; or 7.0 x 10 "5 s; or 6.0 x 10 "5 s; or 5.0 x 10 "5 s; or4.0 x 10 "5 .
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof has an affinity (KD) for CD40 in the range 1.0 x10 "10 M to 1x10 "11 M and an on-rate (ka) for CD40 in the range 2.7 10 6 to 1 x 10 7 Ms.
  • the invention provides an antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, with affinity for CD40 localised on the surface of a cell.
  • CD40 is associated with the cell such that one or more region of CD40 is present on outer face of the cell surface.
  • CD40 may be inserted into the cell plasma membrane (i.e. orientated as a transmembrane protein) with one or more region presented on the extracellular surface.
  • CD40 may be outside the cell with covalent and/or ionic interactions localising it to a specific region or regions of the cell surface.
  • surface of a cancer cell we include the meaning that CD40 is localised in such a manner in relation to one or more cell derived from, or characteristic of, a cancerous cell or tumour.
  • the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof comprises or consist of an intact antibody.
  • the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof comprises or consists of an antigen-binding fragment selected from the group consisting of: an Fv fragment (such as a single chain Fv fragment, or a disulphide- bonded Fv fragment), and a Fab-like fragment (such as a Fab fragment; a Fab' fragment or a F(ab) 2 fragment).
  • an Fv fragment such as a single chain Fv fragment, or a disulphide- bonded Fv fragment
  • a Fab-like fragment such as a Fab fragment; a Fab' fragment or a F(ab) 2 fragment.
  • the antigen-binding fragment, or variant, fusion or derivative thereof may comprise an scFv.
  • ScFv molecules we include molecules wherein the V H and V L partner domains are linked via a flexible oligopeptide.
  • the potential advantages of using antibody fragments, rather than whole antibodies, are several-fold.
  • the smaller size of the fragments may lead to improved pharmacological properties, such as better penetration to the target site. Effector functions of whole antibodies, such as complement binding, are removed.
  • Fab, Fv, ScFv and dAb antibody fragments can all be expressed in and secreted from E. coli, thus allowing the facile production of large amounts of the said fragments.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof, of the invention is a recombinant molecule.
  • the antibody may be a polyclonal antibody, it is preferred if it is a monoclonal antibody, or that the antigen-binding fragment, variant, fusion or derivative thereof, is derived from a monoclonal antibody.
  • Suitable monoclonal antibodies may be prepared by known techniques, for example those disclosed in “Monoclonal Antibodies; A manual of techniques", H Zola (CRC Press, 1988) and in “Monoclonal Hybridoma Antibodies: Techniques and Application", SGR Hurrell (CRC Press, 1982). Polyclonal antibodies may be produced which are poly- specific or mono-specific. It is preferred that they are mono-specific.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof is human or humanised.
  • the antibodies may be human antibodies in the sense that they have the amino acid sequence of human antibodies with specificity for the CD40 protein defined herein, however it will be appreciated that they may be prepared using methods known in the art that do not require immunisation of humans.
  • the antibody polypeptides may be produced in vitro in a human or non-human cell line.
  • transgenic mice are available which contain, in essence, human immunoglobulin genes (see Vaughan et al ( 998) Nature Biotechnol. 16, 535-539.
  • suitable non-human antibodies can be "humanised” in known ways, for example by inserting the CDR regions of mouse antibodies into the framework of human antibodies.
  • binding specificity of an antibody or antigen-binding fragment thereof is conferred by the presence of complementarity determining regions (CDRs) within the variable regions of the constituent heavy and light chains.
  • CDRs complementarity determining regions
  • binding specificity for CD40 is conferred by the presence of one or more of the CDR amino acid sequences defined herein.
  • amino acid as used herein includes the standard twenty genetically-encoded amino acids and their corresponding stereoisomers in the 'D' form (as compared to the natural 'L' form), omega-amino acids other naturally-occurring amino acids, unconventional amino acids (e.g. ⁇ , ⁇ -disubstituted amino acids, N-alkyl amino acids, etc.) and chemically derivatised amino acids (see below).
  • omega-amino acids other naturally-occurring amino acids
  • unconventional amino acids e.g. ⁇ , ⁇ -disubstituted amino acids, N-alkyl amino acids, etc.
  • chemically derivatised amino acids see below.
  • polypeptides of the present invention may also be suitable components for polypeptides of the present invention, as long as the desired functional property is retained by the polypeptide.
  • each encoded amino acid residue where appropriate, is represented by a single letter designation, corresponding to the trivial name of the conventional amino acid.
  • polypeptides as defined herein comprise or consist of L-amino acids.
  • the antibody, fragment, variant, fusion or derivative comprises a variable light chain (V L ) in which CDR1 comprises or consists of the amino acid sequence:
  • X 2 is K or H or D or G or N.
  • the antibody, fragment, variant, fusion or derivative comprises a variable light chain (V L ) in which CDR2 comprises or consists of the amino acid sequence:
  • X 3 is G or R.
  • the antibody, fragment, variant, fusion or derivative comprises a variable light chain (V L ) in which CDR3 comprises or consists of the amino acid sequence:
  • X4 is D or S or E or G or K
  • X 5 is S or T or G
  • X 6 is L or S or T or L or I
  • X 7 is S or T or L
  • X 8 is V or L.
  • the antibody, fragment, variant, fusion or derivative comprises a variable light chain (V L ) in which CDR1 comprises or consists of an amino acid sequence selected from the group consisting of:
  • the antibody, fragment, variant, fusion or derivative comprises a variable light chain (V L ) in which CDR2 comprises or consists of an amino acid sequence selected from the group consisting of:
  • GNINRPS [SEQ ID NO:10]; and RNINRPS [SEQ ID NO:11].
  • the antibody, fragment, variant, fusion or derivative comprises a variable light chain (V L ) in which CDR3 comprises or consists of an amino acid sequence selected from the group consisting of:
  • CAAWDGGLLGLV [SEQ ID NO: 18].
  • the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof comprises a variable light chain (V L ) comprising the following CDRs:
  • the antibody, fragment, variant, fusion or derivative comprises a variable light chain (V L ) comprising an amino acid sequence selected from the group consisting of:
  • the antibody, fragment, variant, fusion or derivative comprises a constant light chain (C L ) comprising the amino acid sequence of SEQ ID NO:63.
  • the antibody, fragment, variant, fusion or derivative comprises a variable heavy chain (V H ) in which CDR1 comprises or consists of the amino acid sequence of:
  • V H variable heavy chain
  • the antibody, fragment, variant, fusion or derivative comprises a variable heavy chain (V H ) in which CDR3 comprises or consists of the amino acid sequence of:
  • the antibody, fragment, variant, fusion or derivative comprises a variable heavy chain (V H ) comprising the CDRs of SEQ ID NO:28 and SEQ ID NO:29 and SEQ ID NO:30.
  • V H variable heavy chain
  • the antibody, fragment, variant, fusion or derivative comprises a variable heavy chain (V H ) comprising an amino acid sequence selected from the group consisting of:
  • the antibody, fragment, variant, fusion or derivative comprises a constant heavy chain (C H ) comprising the amino acid sequence of SEQ ID NO:62.
  • the antibody, fragment, variant, fusion or derivative comprises the following CDRs:
  • the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, of the invention binds to an epitope within the first domain (D1) of CD40 (preferably, human CD40).
  • the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, of the invention may compete for binding to CD40 with one or more of the exemplary antibodies of the invention (see Table A; as described in the Examples below):
  • the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, of the invention may bind to the same CD40 epitope as one or more of the exemplary antibodies of the invention.
  • the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, of the invention comprises the V L and V H pairs of one of the exemplary antibodies of the invention (as shown in Table A)
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof comprises a variable light chain (V L ) and a variable heavy chain (V H ) comprising the following amino acid sequences:
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof comprises an antibody Fc-region.
  • the Fc portion may be from an IgG antibody, or from a different class of antibody (such as IgM, IgA, IgD or IgE).
  • the Fc region may be from an lgG1 , lgG2, lgG3 or lgG4 antibody.
  • the Fc region is from an lgG1 antibody.
  • the Fc region may be naturally-occurring (e.g. part of an endogenously produced antibody) or may be artificial (e.g. comprising one or more point mutations relative to a naturally-occurring Fc region).
  • Fc-regions with point mutations improving their ability to bind FcR may be advantageous, e.g. by altering serum half life or improve binding to Fey receptors (FcyR) involved in ADCC and CDC.
  • FcyR Fey receptors
  • mutations that enhance binding to FcyRIIB e.g.
  • S267E (Strohl et a/., 2009, Curr Opin Biotechnol, 20:685-691) may be advantageous for the invention giving the link between FcyRIIB binding and functional activity of CD40 antibodies (Li et al., 2011 , Science, 333: 1030-1034).
  • the Fc-region comprises or consists of the amino acid sequence of SEQ ID NO: 62.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof, of the invention is an IgG molecule, or is an antigen-binding fragment, a variant, a fusion or a derivative, of an IgG molecule.
  • the amino acid sequence of a particularly preferred IgG sequence is described in the accompanying Examples.
  • the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, of the invention further comprises a cytotoxic moiety, which may be directly and/or indirectly cytotoxic.
  • cytotoxic we include the meaning that the moiety is one which on its own is cytotoxic.
  • directly cytotoxic we include the meaning that the moiety is one which, although is not itself cytotoxic, can induce cytotoxicity, for example by its action on a further molecule or by further action on it.
  • the cytotoxic moiety is cytotoxic when intracellular and, preferably, is not cytotoxic when extracellular.
  • the invention provides an antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, wherein the cytotoxic moiety is a directly cytotoxic chemotherapeutic agent.
  • the cytotoxic moiety is a directly cytotoxic polypeptide. Cytotoxic chemotherapeutic agents are well known in the art.
  • Cytotoxic chemotherapeutic agents include: alkylating agents including nitrogen mustards such as mechlorethamine (HN 2 ), cyclophosphamide, ifosfamide, melphalan (L-sarcolysin) and chlorambucil; ethylenimines and methylmelamines such as hexamethylmelamine, thiotepa; alkyl sulphonates such as busulfan; nitrosoureas such as carmustine (BCNU), lomustine (CCNU), semustine (methyl-CCNU) and streptozocin (streptozotocin); and triazenes such as decarbazine (DTIC; dimethyltriazenoimidazole-carboxamide); Antimetabolites including folic acid analogues such as methotrexate (amethopterin); pynmidine analogues such as fluorouracil (5- fluorouracil; 5-
  • Natural Products including vinca alkaloids such as vinblastine (VLB) and vincristine; epipodophyllotoxins such as etoposide and teniposide; antibiotics such as dactinomycin (actinomycin D), daunorubicin (daunomycin; rubidomycin), doxorubicin, bleomycin, plicamycin (mithramycin) and mitomycin (mitomycin C); enzymes such as L- asparaginase; and biological response modifiers such as interferon alphenomes.
  • VLB vinblastine
  • epipodophyllotoxins such as etoposide and teniposide
  • antibiotics such as dactinomycin (actinomycin D), daunorubicin (daunomycin; rubidomycin), doxorubicin, bleomycin, plicamycin (mithramycin) and mitomycin (mitomycin C)
  • enzymes such as L- asparaginase
  • Miscellaneous agents including platinum coordination complexes such as cisplatin (c/ ' s- DDP) and carboplatin; anthracenedione such as mitoxantrone and anthracycline; substituted urea such as hydroxyurea; methyl hydrazine derivative such as procarbazine (N-methylhydrazine, MIH); and adrenocortical suppressant such as mitotane (o,p'-DDD) and aminoglutethimide; taxol and analogues/derivatives; and hormone agonists/antagonists such as flutamide and tamoxifen.
  • platinum coordination complexes such as cisplatin (c/ ' s- DDP) and carboplatin
  • anthracenedione such as mitoxantrone and anthracycline
  • substituted urea such as hydroxyurea
  • methyl hydrazine derivative such as procarbazine (N-methyl
  • the preparative procedure is simple, relatively fast, and is carried out under mild conditions.
  • Carbodiimide compounds attack carboxylic groups to change them into reactive sites for free amino groups.
  • the water-soluble carbodiimide, 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) is particularly useful for conjugating a functional moiety to a binding moiety and may be used to conjugate doxorubicin to tumour homing peptides.
  • the conjugation of doxorubicin and a binding moiety requires the presence of an amino group, which is provided by doxorubicin, and a carboxyl group, which is provided by the antibody.
  • EDC also can be used to prepare active esters such as N-hydroxysuccinimide (NHS) ester.
  • NHS N-hydroxysuccinimide
  • the NHS ester which binds only to amino groups, then can be used to induce the formation of an amide bond with the single amino group of the doxorubicin.
  • EDC and NHS in combination is commonly used for conjugation in order to increase yield of conjugate formation (Bauminger & Wilchek, supra, 1980).
  • cytotoxic moiety is a cytotoxic peptide or polypeptide moiety by which we include any moiety which leads to cell death.
  • Cytotoxic peptide and polypeptide moieties are well known in the art and include, for example, ricin, abrin, Pseudomonas exotoxin, tissue factor and the like. Methods for linking them to targeting moieties such as antibodies are also known in the art.
  • ricin as a cytotoxic agent is described in Burrows & Thorpe (1993) Proc. Natl. Acad. Sci. USA 90, 8996-9000, incorporated herein by reference, and the use of tissue factor, which leads to localised blood clotting and infarction of a tumour, has been described by Ran et al (1998) Cancer Res. 58, 4646-4653 and Huang et al (1997) Science 275, 547-550.
  • Tsai ef al (1995) Dis. Colon Rectum 38, 067-1074 describes the abrin A chain conjugated to a monoclonal antibody and is incorporated herein by reference.
  • Other ribosome inactivating proteins are described as cytotoxic agents in WO 96/06641.
  • Pseudomonas exotoxin may also be used as the cytotoxic polypeptide moiety (see, for example, Aiello et al (1995) Proc. Natl. Acad. Sci. USA 92, 10457-10461 ; incorporated herein by reference).
  • cytokines such as TNFa and IL-2, may also be useful as cytotoxic agents.
  • radioactive atoms may also be cytotoxic if delivered in sufficient doses.
  • the cytotoxic moiety may comprise a radioactive atom which, in use, delivers a sufficient quantity of radioactivity to the target site so as to be cytotoxic.
  • Suitable radioactive atoms include phosphorus-32, iodine-125, iodine-131 , indium-111 , rhenium-186, rhenium-188 or yttrium-90, or any other isotope which emits enough energy to destroy neighbouring cells, organelles or nucleic acid.
  • the isotopes and density of radioactive atoms in the agents of the invention are such that a dose of more than 4000 cGy (preferably at least 6000, 8000 or 10000 cGy) is delivered to the target site and, preferably, to the cells at the target site and their organelles, particularly the nucleus.
  • the radioactive atom may be attached to the antibody, antigen-binding fragment, variant, fusion or derivative thereof in known ways.
  • EDTA or another chelating agent may be attached to the binding moiety and used to attach 111 ln or 90 Y.
  • Tyrosine residues may be directly labelled with 125 l or 31 1.
  • the cytotoxic moiety may be a suitable indirectly-cytotoxic polypeptide.
  • the indirectly cytotoxic polypeptide is a polypeptide which has enzymatic activity and can convert a non-toxic and/or relatively non-toxic prodrug into a cytotoxic drug.
  • ADEPT Antibody-Directed Enzyme Prodrug Therapy
  • the system requires that the antibody locates the enzymatic portion to the desired site in the body of the patient and after allowing time for the enzyme to localise at the site, administering a prodrug which is a substrate for the enzyme, the end product of the catalysis being a cytotoxic compound.
  • the object of the approach is to maximise the concentration of drug at the desired site and to minimise the concentration of drug in normal tissues (see Senter, P.D. er al (1988) "Anti-tumour effects of antibody-alkaline phosphatase conjugates in combination with etoposide phosphate" Proc. Natl. Acad. Sci. USA 85, 4842-4846; Bagshawe (1987) Br. J. Cancer 56, 531-2; and Bagshawe, K.D. ef al (1988) "A cytotoxic agent can be generated selectively at cancer sites” Br. J. Cancer. 58, 700-703.)
  • the cytotoxic moiety is capable of converting a non-cytotoxic prodrug into a cytotoxic drug.
  • the enzyme and prodrug of the system using a targeted enzyme as described herein may be any of those previously proposed.
  • the cytotoxic substance may be any existing anti-cancer drug such as an alkylating agent; an agent which intercalates in DNA; an agent which inhibits any key enzymes such as dihydrofolate reductase, thymidine synthetase, ribonucleotide reductase, nucleoside kinases or topoisomerase; or an agent which effects cell death by interacting with any other cellular constituent.
  • Etoposide is an example of a topoisomerase inhibitor.
  • Reported prodrug systems include: a phenol mustard prodrug activated by an E. coli ⁇ - glucuronidase (Wang et al, 1992 and Roffler et al, 1991); a doxorubicin prodrug activated by a human ⁇ -glucuronidase (Bosslet et al, 1994); further doxorubicin prodrugs activated by coffee bean a-galactosidase (Azoulay et al, 1995); daunorubicin prodrugs, activated by coffee bean a-D-galactosidase (Gesson et al, 1994); a 5-fluorouridine prodrug activated by an E.
  • methotrexate prodrugs e.g. methotrexate-alanine activated by carboxypeptidase A (Kuefner et al, 1990, Vitols et al, 1992 and Vitols et al, 1995). These and others are included in Table B, below.
  • Table A is adapted from Bagshawe (1995) Drug Dev. Res. 34, 220-230, from which full references for these various systems may be obtained; the taxol derivative is described in Rodrigues, M.L. et al (1995) Chemistry & Biology 2, 223).
  • Suitable enzymes for forming part of an enzymatic portion include: exopeptidases, such as carboxypeptidases G, G1 and G2 (for glutamylated mustard prodrugs), carboxypeptidases A and B (for MTX-based prodrugs) and aminopeptidases (for 2-a- aminocyl MTC prodrugs); endopeptidases, such as e.g. thrombolysin (for thrombin prodrugs); hydrolases, such as phosphatases (e.g. alkaline phosphatase) or sulphatases (e.g.
  • aryl sulphatases (for phosphylated or sulphated prodrugs); amidases, such as penicillin amidases and arylacyl amidase; lactamases, such as ⁇ -lactamases; glycosidases, such as ⁇ -glucuronidase (for ⁇ -glucuronomide anthracyclines), a- galactosidase (for amygdalin) and ⁇ -galactosidase (for ⁇ -galactose anthracycline); deaminases, such as cytosine deaminase (for 5FC); kinases, such as urokinase and thymidine kinase (for gancyclovir); reductases, such as nitroreductase (for CB1954 and analogues), azoreductase (for azobenzene mustards) and DT-diaphorase (for CB
  • the prodrug is relatively non-toxic compared to the cytotoxic drug. Typically, it has less than 10% of the toxicity, preferably less than 1% of the toxicity as measured in a suitable in vitro cytotoxicity test.
  • each moiety is a polypeptide
  • the two portions may be linked together by any of the conventional ways of cross-linking polypeptides, such as those generally described in O'Sullivan et al (1979) Anal. Biochem. 100, 100-108.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof may be enriched with thiol groups and the further moiety reacted with a bifunctional agent capable of reacting with those thiol groups, for example the N-hydroxysuccinimide ester of iodoacetic acid (NHIA) or N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP).
  • NHS iodoacetic acid
  • SPDP N-succinimidyl-3-(2-pyridyldithio)propionate
  • Amide and thioether bonds for example achieved with m-maleimidobenzoyl-N-hydroxysuccinimide ester, are
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof may be produced as a fusion compound by recombinant DNA techniques whereby a length of DNA comprises respective regions encoding the two moieties of the agent of the invention either adjacent one another or separated by a region encoding a linker peptide which does not destroy the desired properties of the agent.
  • a length of DNA comprises respective regions encoding the two moieties of the agent of the invention either adjacent one another or separated by a region encoding a linker peptide which does not destroy the desired properties of the agent.
  • the two portions of the agent may overlap wholly or partly.
  • the cytotoxic moiety may be a radiosensitizer.
  • Radiosensitizers include fluoropyrimidines, thymidine analogues, hydroxyurea, gemcitabine, fludarabine, nicotinamide, halogenated pyrimidines, 3-aminobenzamide, 3-aminobenzodiamide, etanixadole, pimonidazole and misonidazole (see, for example, McGinn et al (1996) J. Natl. Cancer Inst. 88, 1193-11203; Shewach & Lawrence (1996) Invest. New Drugs 14, 257-263; Horsman (1995) Acta Oncol.
  • the further moiety may be one which becomes cytotoxic, or releases a cytotoxic moiety, upon irradiation.
  • the boron-10 isotope when appropriately irradiated, releases a particles which are cytotoxic (for example, see US 4, 348, 376 to Goldenberg; Primus et a/ (1996) Bioconjug. Chem. 7, 532-535).
  • the cytotoxic moiety may be one which is useful in photodynamic therapy such as photofrin (see, for example, Dougherty et al (1998) J. Natl. Cancer Inst. 90, 889-905).
  • the further moiety may comprise a nucleic acid molecule which is directly or indirectly cytotoxic.
  • the nucleic acid molecule may be an antisense oligonucleotide which, upon localisation at the target site is able to enter cells and lead to their death.
  • the oligonucleotide therefore, may be one which prevents expression of an essential gene, or one which leads to a change in gene expression which causes apoptosis.
  • the cytotoxic moiety is a nucleic acid molecule encoding a directly and/or indirectly cytotoxic polypeptide.
  • Suitable oligonucleotides include those directed at bcl-2 (Ziegler et al (1997) J. Natl. Cancer Inst. 89, 1027-1036), and DNA polymerase a and topoisomerase lla (Lee et al (1996) Anticancer Res. 16, 1805-1811.
  • Peptide nucleic acids may be useful in place of conventional nucleic acids (see Knudsen & Nielsen (1997) Anticancer Drugs 8, 113-118).
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof may be comprised in a delivery vehicle for delivering nucleic acid to the target.
  • the delivery vehicle may be any suitable delivery vehicle. It may, for example, be a liposome containing nucleic acid, or it may be a virus or virus-like particle which is able to deliver nucleic acid.
  • the molecule to be delivered is typically present on the surface of the delivery vehicle.
  • a suitable antibody fragment may be present in the outer surface of a liposome and the nucleic acid to be delivered may be present in the interior of the liposome.
  • a viral vector such as a retroviral or adenoviral vector
  • a viral vector is engineered so that the binding moiety is attached to or located in the surface of the viral particle thus enabling the viral particle to be targeted to the desired site.
  • Targeted delivery systems are also known such as the modified adenovirus system described in WO 94/10323 wherein, typically, the DNA is carried within the adenovirus, or adenovirus-like, particle.
  • Michael et al (1995) Gene Therapy 2, 660-668 describes modification of adenovirus to add a cell-selective moiety into a fibre protein.
  • Targeted retroviruses are also available for use in the invention; for example, sequences conferring specific binding affinities may be engineered into preexisting viral env genes (see Miller & Vile (1995) Faseb J. 9, 190-199 for a review of this and other targeted vectors for gene therapy).
  • Immunoliposomes (antibody-directed liposomes) may be used.
  • MPB-PE N-[4-(p-maleimidophenyl)-butyryl]-phosphatidylethanol- amine
  • MPB-PE N-[4-(p-maleimidophenyl)-butyryl]-phosphatidylethanol- amine
  • MPB-PE is incorporated into the liposomal bilayers to allow a covalent coupling of the antibody, or fragment thereof, to the liposomal surface.
  • the liposome is conveniently loaded with the DNA or other genetic construct for delivery to the target cells, for example, by forming the said liposomes in a solution of the DNA or other genetic construct, followed by sequential extrusion through polycarbonate membrane filters with 0.6 ⁇ and 0.2pm pore size under nitrogen pressures up to 0.8 MPa. After extrusion, entrapped DNA construct is separated from free DNA construct by ultracentrifugation at 80 000 x g for 45 min.
  • Freshly prepared MPB-PE-liposomes in deoxygenated buffer are mixed with freshly prepared antibody (or fragment thereof) and the coupling reactions are carried out in a nitrogen atmosphere at 4 ° C under constant end over end rotation overnight.
  • the immunoliposomes are separated from unconjugated antibodies by ultracentrifugation at 80 000 x g for 45 min.
  • Immunoliposomes may be injected intraperitoneally or directly into the tumour.
  • the nucleic acid delivered to the target site may be any suitable DNA which leads, directly or indirectly, to cytotoxicity.
  • the nucleic acid may encode a ribozyme which is cytotoxic to the cell, or it may encode an enzyme which is able to convert a substantially non-toxic prodrug into a cytotoxic drug (this latter system is sometime called GDEPT: Gene Directed Enzyme Prodrug Therapy).
  • Ribozymes which may be encoded in the nucleic acid to be delivered to the target are described in Cech and Herschlag "Site-specific cleavage of single stranded DNA” US 5,180,818; Altman et al "Cleavage of targeted RNA by RNAse P" US 5,168,053, Cantin et al "Ribozyme cleavage of HIV-1 RNA” US 5,149,796; Cech et al “RNA ribozyme restriction endoribonucleases and methods", US 5,116,742; Been et al "RNA ribozyme polymerases, dephosphorylases, restriction endonucleases and methods", US 5,093,246; and Been et al "RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods; cleaves single-stranded RNA at specific site by transesterification", US 4,987,071 , all incorporated herein by
  • Suitable targets for ribozymes include transcription factors such as c-fos and c-myc, and bcl-2.
  • Durai et al (1997) Anticancer Res. 17, 3307-3312 describes a hammerhead ribozyme against bcl-2.
  • EP 0 415 731 describes the GDEPT system. Similar considerations concerning the choice of enzyme and prodrug apply to the GDEPT system as to the ADEPT system described above.
  • the nucleic acid delivered to the target site may encode a directly cytotoxic polypeptide.
  • the further moiety may comprise a polypeptide or a polynucleotide encoding a polypeptide which is not either directly or indirectly cytotoxic but is of therapeutic benefit.
  • polypeptides include anti-proliferative or antiinflammatory cytokines, and anti-proliferative, immunomodulatory or factors influencing blood clotting which may be of benefit in medicine, for example in the treatment of cancer.
  • the further moiety may usefully be an inhibitor of angiogenesis such as the peptides angiostatin or endostatin.
  • the further moiety may also usefully be an enzyme which converts a precursor polypeptide to angiostatin or endostatin.
  • Human matrix metallo-proteases such as macrophage elastase, gelatinase and stromolysin convert plasminogen to angiostatin (Cornelius et al (1998) J. Immunol. 161, 6845-6852). Plasminogen is a precursor of angiostatin.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof comprises a cytotoxic moiety comprising a radioactive atom, for example a radioactive atom selected from the group consisting of: phosphorous-32; iodine-125; iodine-131; indium-111; rhenium-186; rhenium-188; yttrium-90.
  • the invention provides an antibody, antigen-binding fragment, variant, fusion or derivative thereof, further comprising a readily detectable moiety.
  • a "readily detectable moiety” we include the meaning that the moiety is one which, when located at the target site following administration of the agent of the invention into a patient, may be detected, typically non-invasively from outside the body and the site of the target located.
  • the agents of this embodiment of the invention are useful in imaging and diagnosis.
  • the readily detectable moiety is or comprises a radioactive atom which is useful in imaging.
  • Suitable radioactive atoms include 99m Tc and 123 l for scintigraphic studies.
  • Other readily detectable moieties include, for example, spin labels for magnetic resonance imaging (MRI) such as 23 l again, 131 l, 11 ln, 9 F, 13 C, 5 N, 7 0, gadolinium, manganese or iron.
  • MRI magnetic resonance imaging
  • the agent of the invention must have sufficient of the appropriate atomic isotopes in order for the molecule to be readily detectable.
  • the radio- or other labels may be incorporated in known ways.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof may be biosynthesised or may be synthesised by chemical amino acid synthesis using suitable amino acid precursors involving, for example, fluorine-19 in place of hydrogen.
  • Labels such as 99m Tc, 123 l, 186 Rh, 88 Rh and 111 ln can, for example, be attached via cysteine residues in polypeptides.
  • Yttrium-90 can be attached via a lysine residue.
  • the IODOGEN method (Fraker et a/ (1978) Biochem. Biophys. Res. Comm. 80, 49-57) can be used to incorporate 123 l.
  • Reference describes other methods in detail.
  • the readily detectable moiety comprises a radioactive atom, such as, for example technetium-99m or iodine-123.
  • the readily detectable moiety may be selected from the group comprising: iodine-123; iodine-131 ; indium-1 1 ; fluorine-19; carbon-13; nitrogen-15; oxygen-17; gadolinium; manganese; iron.
  • the further moiety is able to bind selectively to a directly or indirectly cytotoxic moiety or to a readily detectable moiety.
  • the further moiety may be any moiety which binds to a further compound or component which is cytotoxic or readily detectable.
  • the further moiety may, therefore be an antibody which selectively binds to the further compound or component, or it may be some other binding moiety such as streptavidin or biotin or the like.
  • the following examples illustrate the types of molecules that are included in the invention; other such molecules are readily apparent from the teachings herein.
  • a bi-specific antibody wherein one binding site comprises the antibody, antigen-binding fragment, variant, fusion or derivative thereof, of the invention, and the second binding site comprises a moiety which binds to, for example, an enzyme which is able to convert a substantially non-toxic prodrug to a cytotoxic drug.
  • the antibodies, antigen-binding fragments, variants, fusions, and derivatives thereof, of the invention are useful research reagents and therapeutic agents.
  • the antibodies, antigen-binding fragments, variants, fusions, and derivatives thereof, of the invention are detectably labelled, for example they may be labelled in such a way that they may be directly or indirectly detected.
  • the antibodies are labelled with a radioactive moiety or a coloured moiety or a fluorescent moiety, or they may be linked to an enzyme.
  • the enzyme is one which can convert a non-coloured (or non-fluorescent) substrate to a coloured (or fluorescent) product.
  • the antibody may be labelled by biotin (or streptavidin) and then detected indirectly using streptavidin (or biotin) which has been labelled with a radioactive moiety or a coloured moiety or a fluorescent moiety, or the like or they may be linked to any enzyme of the type described above.
  • the readily detectable moiety comprises a radioactive atom, for example technetium-99m or iodine-123, or a radioactive atom selected from the group consisting of: iodine-123; iodine-131 ; indium-111; fluorine-19; carbon-13; nitrogen-15; oxygen-17; gadolinium; manganese; iron.
  • a radioactive atom for example technetium-99m or iodine-123
  • nucleic acid molecule encoding an antibody or antigen-binding fragment, or variant, fusion or derivative thereof, according to the invention, or a component polypeptide chain thereof.
  • nucleic acid molecule we include DNA, cDNA and mRNA molecules, which may be single- or double-stranded.
  • the nucleic acid molecule comprises one or more nucleotide sequence selected from the group consisting of: SEQ ID NO:40; SEQ ID NO:41; SEQ ID NO:42; or SEQ ID NO:43; or SEQ ID NO:44; or SEQ ID NO:45; or SEQ ID NO:46; or SEQ ID NO:47; or SEQ ID NO:48; or SEQ ID NO:49; or SEQ ID NO:50; or SEQ ID NO:51 ; or SEQ ID NO:52; or SEQ ID NO:53; or SEQ ID NO:54; or SEQ ID NO:55; or SEQ ID NO:56; or SEQ ID NO:57;.
  • the invention provides a nucleic acid molecule comprising the following nucleotide sequences:
  • the invention provides a vector comprising a nucleic acid molecule according to the second aspect of the invention.
  • the vector is an expression vector.
  • expression vector we mean one which is capable, in an appropriate host, of expressing a polypeptide encoded by the nucleic acid molecule.
  • Such vectors may be useful in expressing the encoded antibody, antigen-binding fragment, variant, fusion or derivative thereof, of the invention in a host cell for production of useful quantities.
  • nucleic acid molecules especially DNA
  • vectors for example, via complementary cohesive termini.
  • complementary homopolymer tracts can be added to the DNA segment to be inserted into the vector DNA.
  • the vector and DNA segment are then joined by hydrogen bonding between the complementary homopolymeric tails to form recombinant DNA molecules.
  • Synthetic linkers containing one or more restriction sites provide an alternative method of joining the DNA segment to vectors.
  • the DNA segment e.g. generated by endonuclease restriction digestion, is treated with bacteriophage T4 DNA polymerase or E. coli DNA polymerase I, enzymes that remove protruding, 3'-single-stranded termini with their 3'-5'-exonucleolytic activities, and fill in recessed 3'-ends with their polymerising activities.
  • the combination of these activities therefore generates blunt-ended DNA segments.
  • the blunt-ended segments are then incubated with a larger molar excess of linker molecules in the presence of an enzyme that is able to catalyse the ligation of blunt- ended DNA molecules, such as bacteriophage T4 DNA ligase.
  • an enzyme that is able to catalyse the ligation of blunt- ended DNA molecules, such as bacteriophage T4 DNA ligase.
  • the products of the reaction are DNA segments carrying polymeric linker sequences at their ends.
  • These DNA segments are then cleaved with the appropriate restriction enzyme and ligated to an expression vector that has been cleaved with an enzyme that produces termini compatible with those of the DNA segment.
  • Synthetic linkers containing a variety of restriction endonuclease site are commercially available from a number of sources including International Biotechnologies Inc., New Haven, CN, USA.
  • a desirable way to modify the DNA encoding a polypeptide is to use PCR.
  • This method may be used for introducing the DNA into a suitable vector, for example by engineering in suitable restriction sites, or it may be used to modify the DNA in other useful ways as is known in the art.
  • the DNA to be enzymatically amplified is flanked by two specific primers which themselves become incorporated into the amplified DNA.
  • the specific primers may contain restriction endonuclease recognition sites which can be used for cloning into expression vectors using methods known in the art.
  • the DNA (or in the case of retroviral vectors, RNA) is then expressed in a suitable host to produce a polypeptide comprising the agent of the invention.
  • the DNA encoding the polypeptide may be used in accordance with known techniques, appropriately modified in view of the teachings contained herein, to construct an expression vector, which is then used to transform an appropriate host cell for the expression and production of the polypeptide.
  • Such techniques include those disclosed in US Patent Nos.
  • DNA (or in the case or retroviral vectors, RNA) encoding a polypeptide may be joined to a wide variety of other DNA sequences for introduction into an appropriate host.
  • the companion DNA will depend upon the nature of the host, the manner of the introduction of the DNA into the host, and whether episomal maintenance or integration is desired.
  • the DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression.
  • an expression vector such as a plasmid
  • the DNA may be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognised by the desired host, although such controls are generally available in the expression vector.
  • the vector is then introduced into the host through standard techniques. Generally, not all of the hosts will be transformed by the vector. Therefore, it will be necessary to select for transformed host cells.
  • One selection technique involves incorporating into the expression vector a DNA sequence, with any necessary control elements, that codes for a selectable trait in the transformed cell, such as antibiotic resistance.
  • the gene for such selectable trait can be on another vector, which is used to co-transform the desired host cell.
  • Host cells that have been transformed by the expression vector of the invention are then cultured for a sufficient time and under appropriate conditions known to those skilled in the art in view of the teachings disclosed herein to permit the expression of the polypeptide, which can then be recovered.
  • the vectors typically include a prokaryotic replicon, such as the ColE1 ori, for propagation in a prokaryote, even if the vector is to be used for expression in other, non- prokaryotic, cell types.
  • the vectors can also include an appropriate promoter such as a prokaryotic promoter capable of directing the expression (transcription and translation) of the genes in a bacterial host cell, such as E. coli, transformed therewith.
  • a promoter is an expression control element formed by a DNA sequence that permits binding of RNA polymerase and transcription to occur.
  • Promoter sequences compatible with exemplary bacterial hosts are typically provided in plasmid vectors containing convenient restriction sites for insertion of a DNA segment of the present invention.
  • Typical prokaryotic vector plasmids are pUC18, pUC19, pBR322 and pBR329 available from Biorad Laboratories, (Richmond, CA, USA) and pTrc99A and pKK223-3 available from Pharmacia, Piscataway, NJ, USA.
  • a typical mammalian cell vector plasmid is pSVL available from Pharmacia, Piscataway, NJ, USA. This vector uses the SV40 late promoter to drive expression of cloned genes, the highest level of expression being found in T antigen-producing cells, such as COS-1 cells.
  • an inducible mammalian expression vector is pMSG, also available from Pharmacia. This vector uses the glucocorticoid-inducible promoter of the mouse mammary tumour virus long terminal repeat to drive expression of the cloned gene.
  • Useful yeast plasmid vectors are pRS403-406 and pRS413-416 and are generally available from Stratagene Cloning Systems, La Jolla, CA 92037, USA.
  • Plasmids pRS403, pRS404, pRS405 and pRS406 are Yeast Integrating plasmids (Yips) and incorporate the yeast selectable markers HIS3, TRP1, LEU2 and URA3.
  • Plasmids pRS413-416 are Yeast Centromere plasmids (Ycps).
  • vectors and expression systems are well known in the art for use with a variety of host cells.
  • the invention provides a recombinant host cell comprising a nucleic acid molecule according to the second aspect of the invention or a vector according to the third aspect of the invention.
  • the host cell is a bacterial cell or is a mammalian cell, such as a human cell.
  • the host cell can be either prokaryotic or eukaryotic.
  • Bacterial cells are preferred prokaryotic host cells and typically are a strain of E .coli such as, for example, the E. coli strains DH5 available from Bethesda Research Laboratories Inc., Bethesda, MD, USA, and RR1 available from the American Type Culture Collection (ATCC) of Rockville, MD, USA (No. ATCC 31343).
  • Preferred eukaryotic host cells include yeast, insect and mammalian cells, preferably vertebrate cells such as those from a mouse, rat, monkey or human fibroblastic and kidney cell lines.
  • Yeast host cells include YPH499, YPH500 and YPH501 which are generally available from Stratagene Cloning Systems, La Jolla, CA 92037, USA.
  • Preferred mammalian host cells include Chinese hamster ovary (CHO) cells available from the ATCC as CRL 1658 and 293 cells which are human embryonic kidney cells.
  • Preferred insect cells are Sf9 cells which can be transfected with baculovirus expression vectors.
  • Transformation of appropriate cell hosts with a DNA construct of the present invention is accomplished by well known methods that typically depend on the type of vector used. With regard to transformation of prokaryotic host cells, see, for example, Cohen et al (1972) Proc. Natl. Acad. Sci. USA 69, 2110 and Sambrook et al (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY. Transformation of yeast cells is described in Sherman et al (1986) Methods In Yeast Genetics, A Laboratory Manual, Cold Spring Harbor, NY. The method of Beggs (1978) Nature 275, 104-109 is also useful.
  • reagents useful in transfecting such cells for example calcium phosphate and DEAE-dextran or liposome formulations, are available from Stratagene Cloning Systems, or Life Technologies Inc., Gaithersburg, MD 20877, USA.
  • Electroporation is also useful for transforming and/or transfecting cells and is well known in the art for transforming yeast cells, bacterial cells, insect cells and vertebrate cells.
  • bacterial species may be transformed by the methods described in Luchansky et al (1988) Mol. Microbiol. 2, 637-646 incorporated herein by reference. The greatest number of transformants is consistently recovered following electroporation of the DNA-cell mixture suspended in 2.5 PEB using 6250V per cm at 25 FD.
  • Successfully transformed cells i.e. cells that contain a DNA construct of the present invention, can be identified by well-known techniques. For example, cells resulting from the introduction of an expression construct of the present invention can be grown to produce the polypeptide of the invention. Cells can be harvested and lysed and their DNA content examined for the presence of the DNA using a method such as that described by Southern (1975) J. Mol. Biol. 98, 503 or Berent et al (1985) Biotech. 3, 208. Alternatively, the presence of the protein in the supernatant can be detected using antibodies as described below.
  • the host cell may be a host cell within a non-human animal body.
  • transgenic non-human animals which express an agent according to the invention (or a binding moiety thereof) by virtue of the presence of the transgene are included.
  • the transgenic non-human animal is a rodent such as a mouse.
  • Transgenic non-human animals can be made using methods well known in the art.
  • the invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising an effective amount of an antibody or antigen-binding fragment, or variant, fusion or derivative thereof, of the invention, and a pharmaceutically-acceptable buffer, excipient, diluent or carrier.
  • a 'therapeutically effective amount', or 'effective amount', or 'therapeutically effective', as used herein, refers to that amount which provides a therapeutic effect for a given condition and administration regimen.
  • This is a predetermined quantity of active antibody calculated to produce a desired therapeutic effect in association with the required additive and diluent, i.e. a carrier or administration vehicle.
  • diluent i.e. a carrier or administration vehicle.
  • a therapeutically effective amount is sufficient to cause an improvement in a clinically significant condition in a host.
  • the amount of a compound may vary depending on its specific activity. Suitable dosage amounts may contain a predetermined quantity of active composition calculated to produce the desired therapeutic effect in association with the required diluent.
  • a therapeutically effective amount can be determined by the ordinary skilled medical or veterinary worker based on patient characteristics, such as age, weight, sex, condition, complications, other diseases, etc., as is well known in the art.
  • the antibody or antigen-binding fragment, variant, fusion or derivative thereof can be formulated at various concentrations, depending on the efficacy/toxicity of the polypeptide being used.
  • the formulation comprises the active polypeptide at a concentration of between 0.1 ⁇ and 1 mM, for example between 1 ⁇ and 500 ⁇ , between 500 ⁇ and 1 mM, or between 300 ⁇ and 700 ⁇ .
  • Suitable pharmaceutical carriers are well known in the art of pharmacy.
  • the carrier(s) must be “acceptable” in the sense of being compatible with the antibody of the invention and not deleterious to the recipients thereof.
  • the carriers will be water or saline which will be sterile and pyrogen free; however, other acceptable carriers may be used.
  • buffer is intended to include an aqueous solution containing an acid-base mixture with the purpose of stabilising pH.
  • buffers are Trizma, Bicine, Tricine, MOPS, MOPSO, MOBS, Tris, Hepes, HEPBS, MES, phosphate, carbonate, acetate, citrate, glycolate, lactate, borate, ACES, ADA, tartrate, AMP, AMPD, AMPSO, BES, CABS, cacodylate, CHES, DIPSO, EPPS, ethanolamine, glycine, HEPPSO, imidazole, imidazolelactic acid, PIPES, SSC, SSPE, POPSO, TAPS, TABS, TAPSO and TES.
  • diluent is intended to include an aqueous or non-aqueous solution with the purpose of diluting the agent in the pharmaceutical preparation.
  • the diluent may be one or more of saline, water, polyethylene glycol, propylene glycol, ethanol or oils (such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil).
  • adjuvant is intended to include any compound added to the formulation to increase the biological effect of the agent of the invention.
  • the adjuvant may be one or more of zinc, copper or silver salts with different anions, for example, but not limited to fluoride, chloride, bromide, iodide, tiocyanate, sulfite, hydroxide, phosphate, carbonate, lactate, glycolate, citrate, borate, tartrate, and acetates of different acyl composition.
  • the adjuvant may also be cationic polymers such as cationic cellulose ethers, cationic cellulose esters, deacetylated hyaluronic acid, chitosan, cationic dendrimers, cationic synthetic polymers such as polyvinyl imidazole), and cationic polypeptides such as polyhistidine, polylysine, polyarginine, and peptides containing these amino acids.
  • cationic polymers such as cationic cellulose ethers, cationic cellulose esters, deacetylated hyaluronic acid, chitosan, cationic dendrimers, cationic synthetic polymers such as polyvinyl imidazole
  • cationic polypeptides such as polyhistidine, polylysine, polyarginine, and peptides containing these amino acids.
  • the excipient may be one or more of carbohydrates, polymers, lipids and minerals.
  • carbohydrates include lactose, glucose, sucrose, mannitol, and cyclodextrines, which are added to the composition, e.g., for facilitating lyophilisation.
  • polymers are starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polysulphonate, polyethylenglycol/polyethylene oxide, polyethyleneoxide/polypropylene oxide copolymers, polyvinylalcohol/polyvinylacetate of different degree of hydrolysis, and polyvinylpyrrolidone, all of different molecular weight, which are added to the composition, e.g., for viscosity control, for achieving bioadhesion, or for protecting the lipid from chemical and proteolytic degradation.
  • lipids are fatty acids, phospholipids, mono-, di-, and triglycerides, ceramides, sphingolipids and glycolipids, all of different acyl chain length and saturation, egg lecithin, soy lecithin, hydrogenated egg and soy lecithin, which are added to the composition for reasons similar to those for polymers.
  • minerals are talc, magnesium oxide, zinc oxide and titanium oxide, which are added to the composition to obtain benefits such as reduction of liquid accumulation or advantageous pigment properties.
  • the active antibody-based agents of the invention may be formulated into any type of pharmaceutical composition known in the art to be suitable for the delivery thereof.
  • the pharmaceutical compositions of the invention may be in the form of a liposome, in which the agent is combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids, which exist in aggregated forms as micelles, insoluble monolayers and liquid crystals.
  • Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like.
  • Suitable lipids also include the lipids above modified by poly(ethylene glycol) in the polar headgroup for prolonging bloodstream circulation time. Preparation of such liposomal formulations is can be found in for example US 4,235,871, the disclosures of which are incorporated herein by reference.
  • compositions of the invention may also be in the form of biodegradable microspheres.
  • Aliphatic polyesters such as poly(lactic acid) (PLA), poly(glycolic acid) (PGA), copolymers of PLA and PGA (PLGA) or poly(carprolactone) (PCL), and polyanhydrides have been widely used as biodegradable polymers in the production of microspheres. Preparations of such microspheres can be found in US 5,851,451 and in EP 0 213 303, the disclosures of which are incorporated herein by reference.
  • compositions of the invention are provided in the form of polymer gels, where polymers such as starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polyvinyl imidazole, polysulphonate, polyethylenglycol/polyethylene oxide, polyethyleneoxide/polypropylene oxide copolymers, polyvinylalcohol/polyvinylacetate of different degree of hydrolysis, and polyvinylpyrrolidone are used for thickening of the solution containing the agent.
  • polymers such as starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carageenans, hyaluronic acid and
  • the polymers may also comprise gelatin or collagen.
  • the agents may simply be dissolved in saline, water, polyethylene glycol, propylene glycol, ethanol or oils (such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil), tragacanth gum, and/or various buffers.
  • compositions of the invention may include ions and a defined pH for potentiation of action of the active agent. Additionally, the compositions may be subjected to conventional pharmaceutical operations such as sterilisation and/or may contain conventional adjuvants such as preservatives, stabilisers, wetting agents, emulsifiers, buffers, fillers, etc.
  • compositions according to the invention may be administered via any suitable route known to those skilled in the art.
  • routes of administration include parenteral (intravenous, subcutaneous, and intramuscular), topical, ocular, nasal, pulmonar, buccal, oral, parenteral, vaginal and rectal.
  • parenteral intravenous, subcutaneous, and intramuscular
  • topical ocular, nasal, pulmonar, buccal, oral, parenteral, vaginal and rectal.
  • administration from implants is possible.
  • the pharmaceutical composition is suitable for administration at or near the site of a tumour, e.g. intra-tumourally or peri-tumourally.
  • the pharmaceutical composition is suitable for parenteral administration.
  • Methods for formulating an antibody into a pharmaceutical composition will be well-known to those skilled in the arts of medicine and pharmacy. Preferred compositions are described in the accompanying Examples.
  • the agents i.e. antibody, antigen-binding fragment, variant, fusion or derivative thereof
  • medicaments and pharmaceutical compositions of the invention may be delivered using an injectable sustained-release drug delivery system. These are designed specifically to reduce the frequency of injections.
  • An example of such a system is Nutropin Depot which encapsulates recombinant human growth hormone (rhGH) in biodegradable microspheres that, once injected, release rhGH slowly over a sustained period.
  • delivery is performed intra-muscularly (i.m.) and/or sub-cutaneously (s.c.) and/or intravenously (i.v.).
  • the agents, medicaments and pharmaceutical compositions of the invention can be administered by a surgically implanted device that releases the drug directly to the required site.
  • a surgically implanted device that releases the drug directly to the required site.
  • Vitrasert releases ganciclovir directly into the eye to treat CMV retinitis.
  • the direct application of this toxic agent to the site of disease achieves effective therapy without the drug's significant systemic side-effects.
  • Electroporation therapy (EPT) systems can also be employed for the administration of the agents, medicaments and pharmaceutical compositions of the invention.
  • a device which delivers a pulsed electric field to cells increases the permeability of the cell membranes to the drug, resulting in a significant enhancement of intracellular drug delivery.
  • the agents, medicaments and pharmaceutical compositions of the invention can also be delivered by electro-incorporation (El).
  • El occurs when small particles of up to 30 microns in diameter on the surface of the skin experience electrical pulses identical or similar to those used in electroporation. In El, these particles are driven through the stratum corneum and into deeper layers of the skin.
  • the particles can be loaded or coated with drugs or genes or can simply act as "bullets" that generate pores in the skin through which the drugs can enter.
  • ReGel injectable system that is thermo-sensitive. Below body temperature, ReGel is an injectable liquid while at body temperature it immediately forms a gel reservoir that slowly erodes and dissolves into known, safe, biodegradable polymers. The active substance is delivered over time as the biopolymers dissolve.
  • the agents, medicaments and pharmaceutical compositions of the invention can also be delivered orally.
  • the process employs a natural process for oral uptake of vitamin B 12 and/or vitamin D in the body to co-deliver proteins and peptides.
  • the agents, medicaments and pharmaceutical compositions of the invention can move through the intestinal wall.
  • Complexes are synthesised between vitamin B 12 analogues and/or vitamin D analogues and the drug that retain both significant affinity for intrinsic factor (IF) in the vitamin B 12 portion/vitamin D portion of the complex and significant bioactivity of the active substance of the complex.
  • IF intrinsic factor
  • the agents, medicaments and pharmaceutical compositions of the invention can be introduced to cells by "Trojan peptides". These are a class of polypeptides called penetratins which have translocating properties and are capable of carrying hydrophilic compounds across the plasma membrane. This system allows direct targeting of oligopeptides to the cytoplasm and nucleus, and may be non-cell type specific and highly efficient. See Derossi et al. (1998), Trends Cell Biol. 8, 84-87.
  • the medicaments and/or pharmaceutical compositions of the present invention is a unit dosage containing a daily dose or unit, daily sub-dose or an appropriate fraction thereof, of the active ingredient.
  • the agents, medicaments and pharmaceutical compositions of the invention will normally be administered orally or by any parenteral route, in the form of a pharmaceutical composition comprising the active ingredient, optionally in the form of a non-toxic organic, or inorganic, acid, or base, addition salt, in a pharmaceutically acceptable dosage form.
  • the compositions may be administered at varying doses.
  • the agents, medicaments and pharmaceutical compositions of the invention can be administered alone but will generally be administered in admixture with a suitable pharmaceutical excipient, diluent or carrier selected with regard to the intended route of administration and standard pharmaceutical practice.
  • the agents, medicaments and pharmaceutical compositions of the invention can be administered orally, buccally or sublingually in the form of tablets, capsules, ovules, elixirs, solutions or suspensions, which may contain flavouring or colouring agents, for immediate-, delayed- or controlled-release applications.
  • the agents, medicaments and pharmaceutical compositions of the invention may also be administered via intracavernosal injection.
  • Such tablets may contain excipients such as microcrystalline cellulose, lactose, sodium citrate, calcium carbonate, dibasic calcium phosphate and glycine, disintegrants such as starch (preferably corn, potato or tapioca starch), sodium starch glycollate, croscarmellose sodium and certain complex silicates, and granulation binders such as polyvinylpyrrolidone, hydroxypropylmethylcellulose (HPMC), hydroxy-propylcellulose (HPC), sucrose, gelatin and acacia. Additionally, lubricating agents such as magnesium stearate, stearic acid, glyceryl behenate and talc may be included.
  • Solid compositions of a similar type may also be employed as fillers in gelatin capsules.
  • Preferred excipients in this regard include lactose, starch, cellulose, milk sugar or high molecular weight polyethylene glycols.
  • the agents, medicaments and pharmaceutical compositions of the invention may be combined with various sweetening or flavouring agents, colouring matter or dyes, with emulsifying and/or suspending agents and with diluents such as water, ethanol, propylene glycol and glycerin, and combinations thereof.
  • the agents, medicaments and pharmaceutical compositions of the invention can be administered parenterally, for example, intravenously, intra-arterially, intraperitoneally, intra-thecally, intraventricularly, intrasternally, intracranially, intra-muscularly or subcutaneously, or they may be administered by infusion techniques. They are best used in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood.
  • the aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9), if necessary.
  • the preparation of suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well-known to those skilled in the art.
  • Medicaments and pharmaceutical compositions suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain antioxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
  • the medicaments and pharmaceutical compositions may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
  • Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
  • agents, medicaments and pharmaceutical compositions of the invention can also be administered intranasally or by inhalation and are conveniently delivered in the form of a dry powder inhaler or an aerosol spray presentation from a pressurised container, pump, spray or nebuliser with the use of a suitable propellant, e.g. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1 ,1,2- tetrafluoroethane (HFA 134A3 or 1 ,1,1 ,2,3,3,3-heptafluoropropane (HFA 227EA3), carbon dioxide or other suitable gas.
  • a suitable propellant e.g. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1 ,1,2- te
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • the pressurised container, pump, spray or nebuliser may contain a solution or suspension of the active agent, e.g. using a mixture of ethanol and the propellant as the solvent, which may additionally contain a lubricant, e.g. sorbitan trioleate.
  • a lubricant e.g. sorbitan trioleate.
  • Capsules and cartridges (made, for example, from gelatin) for use in an inhaler or insufflator may be formulated to contain a powder mix of an agent of the invention and a suitable powder base such as lactose or starch.
  • the agents, medicaments and pharmaceutical compositions of the invention can be administered in the form of a suppository or pessary, or they may be applied topically in the form of a lotion, solution, cream, gel, ointment or dusting powder.
  • the agents, medicaments and pharmaceutical compositions of the invention may also be transdermal ⁇ administered, for example, by the use of a skin patch. They may also be administered by the ocular route, particularly for treating diseases of the eye.
  • the agents, medicaments and pharmaceutical compositions of the invention can be formulated as micronised suspensions in isotonic, pH adjusted, sterile saline, or, preferably, as solutions in isotonic, pH adjusted, sterile saline, optionally in combination with a preservative such as a benzylalkonium chloride.
  • a preservative such as a benzylalkonium chloride.
  • they may be formulated in an ointment such as petrolatum.
  • the agents, medicaments and pharmaceutical compositions of the invention can be formulated as a suitable ointment containing the active agent suspended or dissolved in, for example, a mixture with one or more of the following: mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene polyoxypropylene agent, emulsifying wax and water.
  • ком ⁇ онентs can be formulated as a suitable lotion or cream, suspended or dissolved in, for example, a mixture of one or more of the following: mineral oil, sorbitan monostearate, a polyethylene glycol, liquid paraffin, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2- octyldodecanol, benzyl alcohol and water.
  • Formulations suitable for topical administration in the mouth include lozenges comprising the active ingredient in a flavoured basis, usually sucrose and acacia or tragacanth; pastilles comprising the active ingredient in an inert basis such as gelatin and glycerin, or sucrose and acacia; and mouth-washes comprising the active ingredient in a suitable liquid carrier.
  • lozenges comprising the active ingredient in a flavoured basis, usually sucrose and acacia or tragacanth
  • pastilles comprising the active ingredient in an inert basis such as gelatin and glycerin, or sucrose and acacia
  • mouth-washes comprising the active ingredient in a suitable liquid carrier.
  • local administration of the agents, medicaments and pharmaceutical compositions of the invention at or near the site of a tumour is the preferred route, in particular intra-tumoural or peri-tumoural administration.
  • the agents, medicaments and pharmaceutical compositions of the invention are administered as a suitably acceptable formulation in accordance with normal veterinary practice and the veterinary surgeon will determine the dosing regimen and route of administration which will be most appropriate for a particular animal.
  • the invention provides a kit comprising a pharmaceutical composition according to the fifth aspect of the invention.
  • the invention provides an antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, according to the first aspect of the invention, or a nucleic acid molecule according to the second aspect of the invention, or a vector according to the third aspect of the invention, or a host cell according to the fourth aspect of the invention, or a pharmaceutical composition according to the fifth aspect of the invention, for use in medicine.
  • the invention provides an antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, according to the first aspect of the invention, or a nucleic acid molecule according to the second aspect of the invention, or a vector according to the third aspect of the invention, or a host cell according to the fourth aspect of the invention, or a pharmaceutical composition according to the fifth aspect of the invention, for use in the treatment of cancer.
  • the invention provides an antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, according to the first aspect of the invention, or a nucleic acid molecule according to the second aspect of the invention, or a vector according to the third aspect of the invention, or a host cell according to the fourth aspect of the invention, or a pharmaceutical composition according to the fifth aspect of the invention, in the manufacture of a medicament for the treatment of cancer.
  • the treatment of cancer comprises the step of administering an effective amount the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof or nucleic acid molecule or vector or host cell or pharmaceutical composition to an individual in need thereof.
  • the invention provides, a method for treating an individual with cancer, the method comprising the step of administering to an individual in need thereof an effective amount of: an antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, according to the first aspect of the invention, or a nucleic acid molecule according to the second aspect of the invention, or a vector according to the third aspect of the invention, or a host cell according to the fourth aspect of the invention, or a pharmaceutical composition according to the fifth aspect of the invention.
  • the step of administering to an individual in need thereof comprises local administration, for example, local administration to a tumour in a patient (for example, intra-tumourally or peri-tumourally).
  • the patient is then administered the maximum therapeutic dose for the duration of the treatment.
  • the dose may be lowered over time once the treatment starts to have the required therapeutic effect.
  • the therapeutic dose of the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, in a human patient will be in the range of 100 g to 700 mg per administration (based on a body weight of 70kg).
  • the maximum therapeutic dose may be in the range of 0.1 to 10 mg/kg per administration, e.g. between 0.1 and 5 mg/kg or between 1 and 5 mg/kg or between 0.1 and 2 mg/kg. It will be appreciated that such a dose may be administered at different intervals, as determined by the oncologist/physician; for example, a dose may be administered daily, twice-weekly, weekly, bi-weekly or monthly.
  • the maximum therapeutic dose of the antibody or antigen-binding fragment, or a variant, fusion or derivative thereof is a low dose.
  • the dose to be administered locally in the present invention may be less than 25% of the typical systemic dose of the same agent needed to produce a therapeutic effect.
  • the dose is less than or equal to 1 mg per administration, for example less than or equal to 500 pg, 400 pg, 300 pg, 200 pg, 100 pg, 50 pg, 30 pg, 20 pg, 10 pg, 5 pg or 1 pg per administration. It will be appreciated that such doses may be administered repeatedly to the patient over time, for example twice daily, once daily, once every other day, twice weekly, once weekly, twice monthly, once monthly, etc.).
  • the antibody-based agent(s) is/are for use at a dose of 10 pg to 100 pg per administration.
  • the antibody-based agent(s) may be used at a dose of 20 pg to 40 pg per administration, for example 30 pg per administration.
  • the antibody-based agent(s) is/are capable of providing a systemic anti-tumour effect.
  • a systemic anti-tumour effect may be achieved even if the therapy is made locally/intratumourally.
  • an immunotherapeutic antibody e.g. by intratumoural injections
  • only cells in the tumour area are targeted for CD40 therapy. Therefore, only the concentration of the CD40 agonist in the tissue-area where it is intended to exert its effects influence the level of CD40 activation.
  • the optimal dose may be determined by the volume of the tissue area that is relevant to treat and not the body weight of the patient. When treating intratumourally this volume may instead be defined by the tumour volume.
  • the relevant total dose may thus be lower than for systemic treatment, and may be defined based on diagnosis of the tumour by PET scan or other imaging methods, rather than by the weight of the patient. It will be appreciated that the antibody-based agents of the invention are suitable for use in the treatment of any type of cancer for which CD40 activation may provide a therapeutic benefit.
  • the cancer may be selected from the group consisting of: prostate cancer; breast cancer; colorectal cancer; pancreatic cancer; ovarian cancer; lung cancer; cervical cancer; rhabdomyosarcoma; neuroblastoma; multiple myeloma; leukemia, acute lymphoblastic leukemia, melanoma, bladder and glioblastoma.
  • the cancer is associated with CD40 + tumour cells.
  • the antibody-based agents of the invention may also be used in the treatment of cancers associated with CD40 " tumour cells. It will be further appreciated that the antibody-based agents of the invention may be used as a sole treatment for cancer in a patient or as part of a combination treatment (which further treatment may be a pharmaceutical agent, radiotherapy and/or surgery). Thus, the patient may also receive one or more further treatments for cancer, for example pharmaceutical agents (such as chemotherapeutic agents), radiotherapy and/or surgery.
  • the one or more further treatments are selected from the group consisting of conventional chemotherapeutic agents (such as alkylating agents, antimetabolites, plant alkaloids and terpenoids, topoisomerase inhibitors and antineoplastics), radiotherapeutic agents, antibody-based therapeutic agents (such as gemtuzumab, alemtuzumab, rituximab, trastuzumab, nimotuzumab, cetuximab, bevacizumab), and steroids.
  • conventional chemotherapeutic agents such as alkylating agents, antimetabolites, plant alkaloids and terpenoids, topoisomerase inhibitors and antineoplastics
  • radiotherapeutic agents such as gemtuzumab, alemtuzumab, rituximab, trastuzumab, nimotuzumab, cetuximab, bevacizumab
  • steroids such as gemtuzumab, alemtuzumab, rituxim
  • the invention provides a method for producing an antibody or antigen-binding fragment, or a variant, fusion or derivative thereof, according to the invention, the method comprising culturing a host cell according to the fourth aspect of the invention under conditions which permit expression of the encoded antibody or antigen-binding fragment thereof.
  • the antibodies, antigen-binding fragments, variants, fusions or derivatives thereof, of the invention are produced in a eukaryotic system, such as a mammalian cell.
  • the antibodies, antigen-binding fragments, variants, fusions or derivatives thereof, of the invention can be produced in vitro using a commercially available in vitro translation system, such as rabbit reticulocyte lysate or wheatgerm lysate (available from Promega).
  • a commercially available in vitro translation system such as rabbit reticulocyte lysate or wheatgerm lysate (available from Promega).
  • the translation system is rabbit reticulocyte lysate.
  • the translation system may be coupled to a transcription system, such as the TNT transcription-translation system (Promega). This system has the advantage of producing suitable mRNA transcript from an encoding DNA polynucleotide in the same reaction as the translation.
  • the agent comprises distinct moieties, for example binding and/or cytotoxic domains
  • those moieties may be encoded by one or more separate nucleic acid molecules.
  • the production method of this aspect of the invention comprises a further step of isolating the antibodies, antigen-binding fragments, variants, fusions or derivatives thereof, of the invention produced from the host cell or from the in vitro translation mix.
  • the isolation employs an antibody which selectively binds the expressed polypeptide of the invention.
  • antibodies may be raised in an animal by immunising with an appropriate peptide.
  • immunising with an appropriate peptide.
  • the antibody, antigen-binding fragment, variant, fusion or derivative thereof, of the invention is the product, directly or indirectly, of in vitro protein optimisation (e.g. using the FIND ® technology of Alligator Bioscience AB, as described in WO 02/48351 and WO 03/097834).
  • the heat maps are restricted to positions where mutations has been introduced and/or found by sequence analysis. The linker between V H and V L is not displayed. The mutational frequency in each position is indicated by darker shade.
  • (B) Number of positions with more than 5 mutations calculated based on sequences from the selection procedure.
  • the ratio from the two ELISA measurements is displayed on the y-axis; on the x-axis, the binding signal from the primary ELISA (normal wash) is displayed.
  • Each sphere in the graph represents the data from one clone.
  • B44 (grey) and clones from selection round number 5 (black) are shown.
  • FIG. 3 Schematic diagram of the domains of CD40.
  • Figure 4 Surface plasmon resonance analysis of the CD40 antibody clones binding to target at 37°C and physiological pH.
  • Figure 6 The weight of the tumours measured at the end point day (day 28) is displayed. Treatment with 30 ug G12 or isotype control is displayed (**p ⁇ 0.01 for both treatment groups compared to control using Mann-Whitney test, two tailed).
  • the mice treated with 30 ug drug is compared to isotype control (30 ug).
  • Treatment with G12 provides a significant anti-tumour effect compared to the isotype control.
  • FIG 8 The weight of the tumours measured at the end point day (day 28) is displayed.
  • Treatment with G12 is significant compared to the isotype control (p ⁇ 0.05 for the treatment group compared to control using students t-test, two tailed).
  • Treatment with G12 is significant compared to the isotype control.
  • Figure 10 - Survival curves of tumour inoculated mice treated with drug are shown.
  • Treatment with G12 significantly increases the survival of animals compared to isotype control (p ⁇ 0.013).
  • the survival curve of mice treated with G12 compared to S2C6 p ⁇ 0.13).
  • the survival of mice treated with S2C6 compared to isotype control p ⁇ 0.088).
  • FIG 11 Survival curves of tumour-bearing mice treated with drug are shown.
  • the displayed survival curves are based on pooled data.
  • the group of treated mice with G12 and isotype control consisted of 20 animals in each of the group.
  • the mice treated with S2C6 consisted of 12 animals.
  • the survival curve of the G12 treated group and the S2C6 treated group was compared to the isotype control treated group by log rank test using Bonferroni method to adjust for multiple comparisons.
  • the survival curve of G12 is significantly different compared to the isotype control (unadjusted p 0.004).
  • FIG 13 Antibody levels in serum from treated mice. Serum samples taken 4 h after the first (day 7) and the second (day 10) treatment with G12 or controls were analyzed for antibody levels. At day 7 and 10, the antibody titer was significantly lower, approximately two-fold, for the anti-CD40 antibody clone G12 compared to clone S2C6. A one tailed unpaired t-test was used to calculate the p value for the comparison of the means of G12 and S2C6. The serum G12 titer was approximately 100 fold lower compared to isotype control due to target related effects, (the G12 titer is similar to the isotype titer in human CD40 negative mice).
  • G12 and S2C6 After treatment with identical doses (30 Dg) G12 and S2C6 there is a significant difference in serum titers of G12 and S2C6 4 hour post treatment. This indicates that G12 is retained longer in the tumour and surrounding tissue compared to S2C6. This difference may be a result of G12 ' s high on-rate and affinity to the target (CD40) compared to other CD40 antibodies, eg. S2C6.
  • Example 1 Directed evolution of an agonistic CD40 antibody with improved potency
  • the B44 antibody originates from the n-CoDeR ® library, which is a human antibody fragment display library (Soderlind et al., 2000).
  • the amino acid sequences and a structure model of the anti-CD40 agonistic antibody B44 was used to design the libraries, except for one library, in which random mutations were inserted throughout the entire sequence.
  • Antibodies of the invention were prepared and selected as follows.
  • Germline hot spot residues are amino acid positions in rearranged variable immunoglobulin domains that are prone to undergo mutations during the somatic hypermutation process.
  • the Germline hot spot residues in CDRL3 were randomized along with selected germ-line hot spot residues in the structurally adjacent CDRL1.
  • the entire B44 sequence was randomized using an error-prone PCR method designed to minimize mutational bias (Genemorph).
  • the generated size of the library was 6.3 x 10 8 unique variants.
  • the starting libraries were enriched for binders to biotinylated CD40-Fcy, thereby creating a pool of sequences from each library which encoded functional binders ("Round 1" in Table 1). The initial enrichment for binders was verified by sequencing.
  • the pools of sequences encoding functional variants were subsequently recombined using FIND ® .
  • the FIND ® technology of Alligator Bioscience AB is described in WO 02/48351 and WO 03/097834.
  • the FIND ® -recombined library comprised 2 x 10 8 unique variants.
  • the produced FIND ® -recombined library was subjected to four rounds of additional selection ("Rounds 2 to 5" in Table 1). From each selection round, approximately 2,000 clones were selected and screened in a high through-put assay.
  • the selection protocol for affinity maturation included steps impacting the following properties: affinity; on-rate; off-rate; multimerization; and epitope maintenance.
  • the on-rate was designed to be retained, and was addressed by shortening the incubation time.
  • the off-rate was designed to be improved by increasing washing stringency.
  • Unbiotinylated CD40 was included in rounds 4 and 5 to prevent mulitmerization and to suppress selection for avidity.
  • Results from the selection to primary high through put screening are summarised in "heat maps" of libraries, which show the position and frequency of mutations generated in each library ( Figure 1A).
  • Figure 1B demonstrates how the FIND ® recombination technology decreases the number of mutated residues while still improving the affinity.
  • the standard wash comprised seven wash of using selection buffer (PBS- T/BSA) followed by four washes with PBS. The protocol was extended in round 3- 5 adding a prolonged incubation (time given in minutes).
  • the high throughput screening assay was designed as follows: a method for measuring the off-rate at two different washing conditions in a direct binding ELISA was performed. Improved off-rate correlated to increased ratio of the two measurements. The results from the high-through-put assay was plotted measured ratio versus binding signal in ELISA ( Figure 2).
  • the HTS assay was based on a sandwich ELISA measuring binding of ScFv-his fragment in crude E. coli supernatants to CD40 coated in microtitre plates.
  • the FIND ® recombined anti-CD40 antibodies were selected for having improved affinity (KD) to the CD40 receptor.
  • the affinity of the anti-CD40 antibodies to target was determined by surface plasmon resonance and calculated kinetic constants are shown in Table 1 and Table 2.
  • the affinities were improved approximately a hundred-fold for the anti-CD40 antibody clones compared to the original B44 antibody, Table 2 and Figure 3, at physiological pH and 37°C.
  • the improved affinity by the anti-CD40 antibody clones were also observed at a low pH, Table 2.
  • Surface plasmon resonance was used to determine the kinetic constants at pH 5.4 and 37°C, and compared to the B44 antibody.
  • the CD40hfc (R&Dsystems, USA) was immobilized to the BIAcore sensorchip, CM5, using conventional amine coupling.
  • the anti-CD40 antibodies of the invention (serially diluted 1/3 from 1-0,012 nM) were analysed for binding in HBS-P (GE, BR-1003-68) at a flow rate of 30 ⁇ /min at 37°C and pH 7.3. The association was followed for 3 minutes and the dissociation for 10 minutes. Regeneration was performed twice using 50 mM NaOH for 30 seconds. The kinetic parameters and the affinity constants were calculated using BIAevaluation 4.1 software. Alternatively, samples were incubated in Acetate buffer pH 5.4, 10mM Acetate, 150 mM NaCI, 0,005% T20, at 37°C. Results are shown in Tables 2 and 3 Results
  • the CD40 receptor consists of four extracellular domains, each composed of two types of modular units (Naismith and Sprang, 1998, Trends Biochem, (23) 74-79) and each module is stabilised by one or two disulfide bonds.
  • the location of each scFv epitope was determined by domain mapping.
  • the ability of the scFv fragments to bind to truncated CD40-constructs, expressed on the surface of transfected COS-7 or L-cells were measured using FACScan analysis (as described by Ellmark et al 2002, Immunology).
  • the exemplary antibodies of the invention were able to bind constructs were the first module had been removed (D1/B2), but not to constructs were the whole first domain of CD40 had been removed (see Figure 4 and Table 4).
  • the antibody clones of the invention cross-react with CD40 from cynomolgous monkey, rhesus macaque and other relevant macaque-species. They do not cross react with murine or canine CD40.
  • Example 4 Up-regulation of dendritic cell surface molecules by exemplary anti- CD40 antibodies
  • CD40 receptor induces activation of Dendritic cells, which potentially leads to activation of a specific anti-tumour T-cell response.
  • Monocyte-derived Dendritic cells treated with an anti-CD40 antibody display up-regulated expression of surface molecules CD80, CD83, CD86, and HLA-DR. The up-regulation of the surface molecules, CD80 and CD86, are required in the co-stimulation of T-cell activation.
  • Other agonistic CD40 antibodies e.g. CP-870,893, have an approximately 20-fold higher potency for B cell activation than for activation of Dendritic cells (Gladue et a/., 2011 , Cancer Immunol Immunother 60[7]; 1009-1017).
  • the activation of Dendritic cells is more clinically relevant than B-cell activation, and the effect on B cells may result in dose limiting toxicity at a treatment dose that do not activate Dendritic cells. It is thus advantageous to improve the potency for activation of Dendritic cells, while keeping the potency for B cell activation in the same range.
  • the clones described in the invention have a potency for B cell activation that is in the same range as activation of Dendritic cells, which may provide clinical advantages.
  • Dendritic cells were derived from peripheral blood monocytes. Briefly, peripheral blood mononuclear cells (PBMC) were separated from whole blood buffy coats of whole blood by Ficoll gradient and CD14+ monocytes were isolated with CD14+ MACS microbeads (Miltenyi) according to manufacturer's instructions. The CD14+ cells, which reached -95% purity were cultured in RPMI medium +10% FCS, 150ng/ml GM-CSF and 50ng/ml IL-4 at 37°C for six days at a concentration of 1x10 cells/ml. 80% of the medium were replaced with fresh medium and cytokines after three days culture.
  • PBMC peripheral blood mononuclear cells
  • CD14+ MACS microbeads Miltenyi
  • the cells After six days in culture the cells had down regulated CD14 and up-regulated CD1a. They were washed, re-suspended in medium with fresh cytokines and dilution series of stimulating antibodies. Cells were cultured at a concentration of 667000 cells/ml and antibodies from 3.3-0.013 g/ml. Stimulating antibodies were B44 and eight clones A4, A5, B9, C4, F6, G12, H11 and H12. The Dendritic cells were cultured at 37°C for an additional 48 hours. Then, the up-regulation of the activation markers CD86, CD80 and HLA-DR were analysed by FACS.
  • Table 5 The mean EC50 and maximum fold increase of CD86, CD80, and MHC II expression of clones of the invention and B44.
  • Example 5 - Enhanced IFN- ⁇ secretion by activated T cells induced by exemplary anti-CD40 antibodies
  • the potency of the anti-CD40 antibody clones was improved compared to the B44 antibody in the allogenic T cell and Dendritic cell assay.
  • Dendritic cells were derived from peripheral blood monocytes as described in the Dendritic cell activation assay.
  • T cells were washed, re-suspended in medium with fresh cytokines and cultured in presence of T cells from a different donator.
  • T cells were isolated from PBMCs with CD3+ MACS microbeads (Miltenyi) according to manufacturer's instructions.
  • the concentrations of Dendritic cells and T cells in the T cell activation assay were 667,000 cells/ml of each cell-type.
  • the co-culture contained 150ng/ml GM- CSF and 50ng/ml IL-4 and dilution series of stimulating antibodies from 3,3-0.013 pg/ml. Stimulating antibodies were B44 and eight clones A4, A5, B9, C4, F6, G12, H11 and H12. The co-culture was incubated at 37°C for additionally 72 hours. Then, the supernatants were analysed for IFN- ⁇ content by ELISA (Biolegends) according to manufacturer's instructions. Alio DC/ T IFN-Y
  • Table 6 Enhancement of IFN- ⁇ secretion by anti-CD40 antibodies of the invention compared to the B44 antibody.
  • Binding of agonistic anti-CD40 antibodies to CD40 on B-cells results in B cell activation and proliferation, homeotypic aggregation and up-regulation of surface markers such as CD23, CD30, CD80, CD86, Fas, major histocompatibility complex (MHC) II and soluble cytokines, e.g. IL-6, TNF-a and TNF- ⁇ (Schonbeck and Libby, 2001 , Cell Mol Life 58(1), 4-43).
  • surface markers such as CD23, CD30, CD80, CD86, Fas, major histocompatibility complex (MHC) II and soluble cytokines, e.g. IL-6, TNF-a and TNF- ⁇ (Schonbeck and Libby, 2001 , Cell Mol Life 58(1), 4-43).
  • CD40 induced B cell proliferation is commonly used to evaluate CD40 agonistic antibodies (Pound et al, 1999, Int Immunol, (11), 11-20).
  • PBMC Peripheral blood mononuclear cells
  • CD19+ B cells were isolated with CD19+ MACS microbeads (Miltenyi) according to manufacturer's instructions.
  • the CD19+ cells (5-7.5 x 10 4 /well), which reached ⁇ 95% purity were cultured in RPMI medium +10% FCS + 10ng/ml IL4 and dilution series of antibodies. After 48-72 h, the metabolic activity was measured with Cell titer-Glo (Promega).
  • the EC50 values were calculated using Graph Pad prism.
  • the anti-CD40 antibodies of the invention have similar potency in activating B cells (i.e. of the same order of magnitude) as B44 (see Table 7).
  • anti-CD40 antibodies of the invention The ability of anti-CD40 antibodies of the invention to bind to RAMOS cells was determined in vitro. We performed FACS analysis of the anti-CD40 antibodies binding to the human Burkitt ' s lymphoma cell line RAMOS. EC50 values were calculated for the anti-CD40 antibodies of the invention and the original B44 anti-CD40 antibody.
  • the human Burkitt's lymphoma cell line RAMOS was used for binding analysis (ECACC, Sigma Aldrich, USA).
  • the unconjugated anti-CD40 antibodies of the invention were assayed for binding to RAMOS cells.
  • RAMOS cells approximately 125,000 cells, were incubated with anti-CD40 antibody, serially diluted 1/3 from 30-0.0015 pg/ml, for 30 minutes at 4°C.
  • the cells were washed twice with FACS buffer and the secondary antibody, anti-human Ig Rabbit F(ab')2 /FITC (DAKO, Glostrup, Denmark), was subsequently added to the cells for another 30 minutes at 4°C.
  • the cells were washed and analysed on a FACScalibur instrument, according to the manufacturer's instructions (Becton Dickinson, USA) and then the mean fluorescent intensity ("MFI") was determined.
  • MFI mean fluorescent intensity
  • the exemplary anti-CD40 antibody clones have approximately a 100-fold increased potency compared to the B44 antibody.
  • Table 8 Binding of antibody clones to RAMOS cells.
  • Example 8 Effect of exemplary antibodies in vivo in mouse tumour model
  • the anti-tumour activity of the exemplary anti-CD40 antibodies of the invention was studied in a NSG mouse model in the absence and in the presence of T cells and dendritic cells.
  • mice Female NSG mice (NOD.Cg-Prkdc scid ll2rg tmWjl SzJ (NSG)) from Jackson, and allowed them to acclimatize before treatment.
  • Bladder cancer cells, (EJ-cells, 3 x 10 6 cells/mouse) were injected subcutaneously.
  • G12, or isotope control was injected intratumourally day 0, 7 and 14 at a dose of 1.2 mg/kg (30 ug).
  • the tumour volume was measured at day 0, 7, 10, 14, 17, 21 , 23 and 27.
  • the tumours was excised and weighed at day 28.
  • mice Female NSG mice (NOD.Cg-Prkdc scid N2rg tm WJI/ SzJ (NSG)) from Jackson, and allowed them to acclimatize before treatment.
  • Bladder cancer cells, (EJ-cells, 2.5 x 10 6 cells/mouse) were injected subcutaneously together with DC (1x10 5 ) and T cells (5x10 5 ) obtained from the same donor.
  • the dendritic cells were prepared from monocytes (as described above).
  • Each treatment group consisted of 10 mice (n 10), where T cells and DCs from two donors was used in five mice/donor (see Table 9). Table 9
  • G12, or PBS control was injected intratumourally day 0, 7 and 14 at a dose of 1.2 mg/kg (30 ug).
  • the tumour volume was measured at day 0, 7, 10, 14, 17, 21, 23 and 27.
  • the tumours was excised and weighed at day 28.
  • the ability of the anti-CD40 antibodies to rescue cells expressing human CD40 from apoptosis and growth arrest was performed in vitro. Apoptosis and growth arrest was induced in transfected WEHI-231 cells by addition of anti-lgM antibodies. The cells were rescued by addition of anti-CD40 antibody. Subsequently to this, the ability of the cells to proliferate was determined.
  • a stable cell line was transfected with human CD40, huCD40 WEHI-231 , and used for investigating rescue from apoptosis and growth arrest (Ellmark et a/., 2003, Immunology, 108, 452-7).
  • the cells, huCD40/WEHI-231 were cultured in a 96-well plate (2x10 4 cells/well) in the presence or absence of anti-mouse IgM, (Jackson Immunoresearch, USA), and an anti-CD40 antibody of the invention, serially diluted 1/3 from 25-0.0001 pg/ml, for 72 hours.
  • Cell titer-Glo was added and the mixture was incubated for 30 minutes at room temperature (Promega, USA). The cells were assayed for proliferation by measuring ATP release.
  • Luminescence signal was measured in FluoSTAR OPTIMA and the signal was normalized (BMG, Germany)
  • V L amino acid positions 1-112 and V H amino acid positions 1-119 are shown, along with the corresponding nucleotide sequence.
  • CDRs are underlined in the amino acid sequences - in the V L amino acid sequence, CDRs are found at amino acid positions 23-40 (CDR1), positions 52-58 (CDR2) and 90-101 (CDR3); in the V H amino acid sequence, CDRs are found at amino acid positions 26-35 (CDR1), positions 42-67 (CDR2) and 97-108 (CDR3).
  • Antibody B44 is found at amino acid positions 26-35 (CDR1), positions 42-67 (CDR2) and 97-108 (CDR3).
  • Vi Variable light chain amino acid sequence - SEQ ID NO:58
  • V L Variable light chain nucleotide sequence - SEQ ID NO:59
  • VH Variable heavy chain amino acid sequence - SEQ ID NO:60
  • VH Variable heavy chain nucleotide sequence - SEQ ID NO:61 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTG AGACTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTACTTATGGCATGCACTGGGT CCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGCTTTCATATATTAGTGGTGGTAGT AGTTACATTTTCTACGCAGACTCAGTGAGGGGCCGATTCACCATCTCCAGAGACAA CTCCGAGAACGCGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCC GTGTATTACTGTGCGAGAATATTAAGAGGCGGGAGCGGTATGGACCTCTGGGGCC AAGGTACACTGGTCACCGTGAGCTCA
  • Vi Variable light chain amino acid sequence - SEQ ID NO:19
  • V L Variable light chain nucleotide sequence - SEQ ID NO:40
  • VH Variable heavy chain amino acid sequence - SEQ ID NO:31
  • VH Variable heavy chain
  • V L CDRs CDR1 CTGSTSNIGAGYKVY [SEQ ID NO:4]
  • CDR3 CAAWDDSLSGLV [SEQ ID NO: 12]
  • Vi Variable light chain amino acid sequence - SEQ ID NO:20
  • V L Variable light chain nucleotide sequence - SEQ ID NO:41
  • VH Variable heavy chain amino acid seguence - SEQ ID NO:32
  • VH Variable heavy chain nucleotide sequence - SEQ ID NO:50
  • V L CDRs CDR1 CTGSSSN IGAGYHVY [SEQ ID NO:5]
  • V H CDRs CDR1 GFTFSTYGMH [SEQ ID NO:28]
  • Vi Variable light chain amino acid sequence - SEQ ID NO:21 QSVLTQPPSASGTPGQRVTISCTGSTSNIGAGYKVYWYQQLPGTAPKLLIYGNINRPSG VPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSGLVFGGGTKLTVLG
  • V L Variable light chain nucleotide sequence - SEQ ID NO:48 CAGTCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCA CCATCTCTTGCACTGGGAGCACCTCCAACATCGGGGCAGGTTACAAAGTATATTGG TATCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATGGTAACATCAATCG GCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCC CTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCAGCATG GGATGACAGCCTGAGTGGTCTGGTTTTCGGCGGAGGAACCAAGCTGACGGTCCTA GGT
  • VH Variable heavy chain amino acid sequence - SEQ ID NO:33
  • V H Variable heavy chain nucleotide sequence - SEQ ID NO:51
  • V L CDRS CDR1 CTGSTSNIGAGYKVY [SEQ ID NO:4]
  • V H CDRS CDR1 GFTFSTYGMH [SEQ ID NO:28]
  • V> amino acid sequence - SEQ ID NO:22
  • V Variable light chain
  • VH Variable heavy chain amino acid sequence - SEQ ID NO:34
  • VH Variable heavy chain nucleotide sequence - SEQ ID NO:52
  • V H CDRS CDR1 GFTFSTYGMH [SEQ ID NO:28]
  • V L Variable light chain nucleotide sequence - SEQ ID NO:43 CAGTCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCA CCATCTCTTGCACTGGGAGCAGCTCCAACATCGGGGCAGGTTATGATGTATACTGG TATCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATCGTAACATCAATCG GCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCC CTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCAGCATG GGATGGCAGCCTGCTGGGTCTGGTTTTCGGCGGAGGAACCAAGCTGACGGTCCTG GGT
  • VH Variable heavy chain amino acid sequence - SEQ ID NO:35
  • V H Variable heavy chain nucleotide sequence - SEQ ID NO:53
  • V H CDRS CDR1 GFTFSTYGMH [SEQ ID NO:28]
  • V Variable light chain amino acid sequence - SEQ ID NO:24
  • V Variable light chain
  • VH Variable heavy chain amino acid sequence - SEQ ID NO:36
  • VH Variable heavy chain nucleotide sequence - SEQ ID NO:54
  • V H CDRS CDR1 GFTFSTYGMH [SEQ ID NO:28]
  • V L Variable light chain amino acid sequence - SEQ ID NO:25
  • V L Variable light chain nucleotide sequence - SEQ ID NO:45
  • VH Variable heavy chain amino acid seguence - SEQ ID NO:37
  • V H Variable heavy chain nucleotide sequence - SEQ ID NO:55
  • CDR2 GNINRPS [SEQ ID NO:10]
  • CDR3 CAAWDKSISGLV [SEQ ID NO: 17]
  • V H CDRS CDR1 GFTFSTYGMH [SEQ ID NO:28]
  • CDR3 CARILRGGSGMDL [SEQ ID NO:30]
  • Variable light chain ( ⁇ amino acid sequence - SEQ ID NO:26
  • V L Variable light chain nucleotide sequence - SEQ ID NO:46 CAGTCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCA CCATCTCTTGCACTGGGAGCAGCTCCAACATCGGGGCAGGTTATAATGTATACTGG TATCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATGGTAACATCAATCG GCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCC CTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCAGCATG GGATGACAGCCTGAGTGGTCTGGTTTTCGGCGGAGGAACCAAGCTGACGGTCCTA GGTGAGTAGAACGTACGCTAGCAAGCTTGGATCCACGATCCTGAGCAAGGACCTCT GCCCTCCCTGTTCAGACCCTTGCTTGCCTCAGCAGGTCATTACAACCACTTCACCTC TGACCGCAGGGGCAGGGGACT
  • VH VSS Variable heavy chain (VH) nucleotide sequence - SEQ ID NO:56
  • V H CDRS CDR1 GFTFSTYGMH [SEQ ID NO:28]
  • V Variable light chain amino acid sequence - SEQ ID NO:27
  • Vi Variable light chain
  • VH Variable heavy chain amino acid sequence - SEQ ID NO:39
  • VH Variable heavy chain nucleotide sequence - SEQ ID NO:57
  • V H CDRs CDR1 GFTFSTYG H [SEQ ID NO:28]
  • V H heavy chain variable region
  • VH variable heavy chain amino acid sequence
  • VH Variable heavy chain nucleotide sequence fSEQ ID NO:651
  • VH Variable heavy chain amino acid sequence [SEQ ID NO:661
  • VH Variable heavy chain
  • Antibody clone amino acid changes and position in V L relative to antibody B44
  • Antibody clone amino acid changes and position in VH relative to antibody B44
  • Example 11 Exemplary pharmaceutical formulations
  • an antibody of the invention Whilst it is possible for an antibody of the invention to be administered alone, it is preferable to present it as a medicament or pharmaceutical formulation, together with one or more acceptable carriers.
  • the carrier(s) must be "acceptable” in the sense of being compatible with the agent of the invention and not deleterious to the recipients thereof.
  • the carriers will be water or saline which will be sterile and pyrogen-free.
  • Tablets are prepared from the foregoing ingredients by wet granulation followed by compression.
  • Example B Ophthalmic Solution Active ingredient 1 mg
  • formulations A and B are prepared by wet granulation of the ingredients with a solution of povidone, followed by addition of magnesium stearate and compression.
  • formulations D and E are prepared by direct compression of the admixed ingredients.
  • the lactose used in formulation E is of the direction compression type.
  • the formulation is prepared by wet granulation of the ingredients (below) with a solution of povidone followed by the addition of magnesium stearate and compression. mg/tablet
  • Example D Capsule Formulations Formulation A
  • a capsule formulation is prepared by admixing the ingredients of Formulation D in Example C above and filling into a two-part hard gelatin capsule.
  • Formulation B (infra) is prepared in a similar manner.
  • Capsules are prepared by melting the Macrogol 4000 BP, dispersing the active ingredient in the melt and filling the melt into a two-part hard gelatin capsule.
  • Capsules are prepared by dispersing the active ingredient in the lecithin and arachis oil and filling the dispersion into soft, elastic gelatin capsules.
  • Formulation E Controlled Release Capsule
  • the following controlled release capsule formulation is prepared by extruding ingredients a, b, and c using an extruder, followed by spheronisation of the extrudate and drying. The dried pellets are then coated with release-controlling membrane (d) and filled into a two- piece, hard gelatin capsule. mg/capsule
  • Example F Intramuscular injection
  • the sodium benzoate is dissolved in a portion of the purified water and the sorbitol solution added.
  • the active ingredient is added and dispersed.
  • the glycerol is dispersed the thickener (dispersible cellulose). The two dispersions are mixed and made up to the required volume with the purified water. Further thickening is achieved as required by extra shearing of the suspension.
  • the active ingredient is used as a powder wherein at least 90% of the particles are of 63 ⁇ diameter or less.
  • Witepsol H15 is melted in a steam-jacketed pan at 45 ° C maximum.
  • the active ingredient is sifted through a 200 ⁇ sieve and added to the molten base with mixing, using a silverson fitted with a cutting head, until a smooth dispersion is achieved. Maintaining the mixture at 45 ° C, the remaining Witepsol H15 is added to the suspension and stirred to ensure a homogenous mix.
  • the entire suspension is passed through a 250 ⁇ stainless steel screen and, with continuous stirring, is allowed to cool to 40°C. At a temperature of 38 ° C to 40 ° C 2.02 g of the mixture is filled into suitable plastic moulds. The suppositories are allowed to cool to room temperature.
  • Example I Pessaries
  • Example 12 Effect of exemplary antibodies in vivo in mouse tumour model
  • the anti-tumour activity of an anti-CD40 antibody of the invention was studied in human CD40 transgenic mice inoculated with bladder cancer cells.
  • MB49 bladder cancer cells were inoculated subcutaneously into human CD40 transgenic mice.
  • the mice were treated peritumourally on day 7 and 10 with G12 or controls.
  • Treatment with G12 results in a significant anti-tumour effect compared to the isotype control.
  • the reference antibody S2C6 is an chimeric anti-CD40 antibody composed of the murine variable domains, VH and VL, fused to the human gammal and kappa constant regions respectively (European patent no. EP1885399, Francisco et al., 2000 Cancer Research).
  • the antibody is thus an analog to the humanized anti-CD40 antibody SGN-40 (Law et al., 2005 Cancer Research).
  • SGN-40 has been studied in clinical trials (Advani et al., 2009 J Clinical Oncology; Hussein et al., 2010 Haematologica).
  • the MB49 cell line is a carcinogen induced transitional cell carcinoma derived from C57B176 male mice (Summerhayes & Franks, 1979, Journal of the National Cancer Institute). MB49 express murine CD40 but do not express human CD40. G12 does not cross react with murine CD40 and cannot bind to the MB49 tumour cells.
  • Cytokine levels in the serum samples were analyzed on Mouse Proinflammatory 7-Plex Ultra-Sensitive Kit using Mesoscale discovery platform (MSD, Gaithersburg, MD, USA). The antibody titer was measured in the serum using sandwich ELISA.
  • the MB49 cell line is a carcinogen induced transitional cell carcinoma derived from C57BL/6 male mice (Summerhayes & Franks, 1979, Journal of the National Cancer Institute). MB49 express murine CD40 but do not express human CD40. G12 does not cross react with murine CD40 and can not bind to the MB49 tumour cells. Results
  • Example 13 Effect of exemplary antibodies in vivo in mouse tumour model
  • the anti-tumour activity of the anti-CD40 antibodies lnterleukin-6 (IL-6), Tumour Necrosis factor-alpha (TNF-a) and Keratinocyte-derived Cytokine (KC) (also known as Chemokine (C-X-C motif) ligand 1 / CXCL1) were studied using pooled data from a larger group of treated animals.
  • the G12 treatment group contained a group of 20 animals
  • the S2C6 treatment group contain 12 animals
  • the isotype control group contained 20 animals.
  • MB49 bladder cancer cells were inoculated subcutaneously into human CD40 transgenic mice. The mice were treated peritumourally on day 7 and 10 with G12, or controls. Treatment with G12 provides a significant increase of survival of tumour-bearing mice compared to the group treated with the isotype control ( Figure 11).
  • Serum samples were taken from treated mice and analysed for cytokine levels.
  • the cytokine levels after treatment demonstrates a stronger induction of the immune response of G12 compared to the reference antibody, S2C6 ( Figure 12).
  • Cytokine levels in the serum samples were analyzed on Mouse Proinflammatory 7-Plex Ultra-Sensitive Kit using Mesoscale discovery platform (MSD, Gaithersburg, MD, USA). The statistical analysis was performed using Graph Pad Prism 6.0 (GraphPad Software, Inc. La Jolla , CA)
  • Example 14 In vivo analysis of antibody levels
  • mice were analysed for antibody levels in serum. Serum samples were taken after the first (day 7) and second treatment (day 10). The antibody titer was significantly lower for the anti-CD40 antibody clone compared to reference antibodies. Data shown in Figure 13.
  • Serum samples taken 4 h after the first (day 7) and the second (day 10) treatment from the experiment described in Example I was analyzed for antibody levels.
  • the antibody titer was measured in the serum using sandwich ELISA.
  • Soderlind E. et al. Recombining germline-derived CDR sequences for creating diverse single-framework antibody libraries. Nat Biotechnol 18, 852-6 (2000) Sotomayor, E.M. et al. Conversion of tumor-specific CD4+ T-cell tolerance to T-cell priming through in vivo ligation of CD40. Nature Medicine 5, 780-787 (1999).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Physics & Mathematics (AREA)
  • Optics & Photonics (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Endocrinology (AREA)
  • Ophthalmology & Optometry (AREA)
  • Dermatology (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/GB2012/052179 2011-09-05 2012-09-05 Anti-cd40 antibodies, uses and methods Ceased WO2013034904A1 (en)

Priority Applications (20)

Application Number Priority Date Filing Date Title
ES12761786.8T ES2658157T3 (es) 2011-09-05 2012-09-05 Anticuerpos anti-CD40, usos y métodos
JP2014527743A JP6324891B2 (ja) 2011-09-05 2012-09-05 抗cd40抗体、使用、および方法
EP12761786.8A EP2753646B1 (en) 2011-09-05 2012-09-05 Anti-cd40 antibodies, uses and methods
RU2014113304A RU2649055C2 (ru) 2011-09-05 2012-09-05 Анти-cd40-антитела, применение и методы
NO12761786A NO2753646T3 (https=) 2011-09-05 2012-09-05
US14/342,141 US9676862B2 (en) 2011-09-05 2012-09-05 Anti-CD40 antibodies and methods of treating cancer
RS20180200A RS56868B1 (sr) 2011-09-05 2012-09-05 Anti-40 antitela, upotrebe i postupci
KR1020147008695A KR102029946B1 (ko) 2011-09-05 2012-09-05 항-cd40 항체, 용도 및 방법
EP17195987.7A EP3323834B1 (en) 2011-09-05 2012-09-05 Anti-cd40 antibodies, uses and methods
SI201231140T SI2753646T1 (en) 2011-09-05 2012-09-05 Anti-CD40 antibodies, uses and methods
CN201280054090.1A CN103930442B (zh) 2011-09-05 2012-09-05 抗cd40抗体、用途和方法
PL12761786T PL2753646T3 (pl) 2011-09-05 2012-09-05 Przeciwciała anty-cd40, zastosowania i sposoby
DK12761786.8T DK2753646T3 (en) 2011-09-05 2012-09-05 ANTI-CD40 ANTIBODIES, APPLICATIONS AND PROCEDURES
CA2860406A CA2860406C (en) 2011-09-05 2012-09-05 Anti-cd40 antibodies, uses and methods
SM20180144T SMT201800144T1 (it) 2011-09-05 2012-09-05 Anticorpi anti-cd40, usi e metodi
LTEP12761786.8T LT2753646T (lt) 2011-09-05 2012-09-05 Anti-cd40 antikūnai ir jų panaudojimo būdai
HRP20180269TT HRP20180269T1 (hr) 2011-09-05 2012-09-05 Anti-cd40 protutijela, upotrebe i postupci
AU2012306071A AU2012306071B2 (en) 2011-09-05 2012-09-05 Anti-CD40 antibodies, uses and methods
US15/588,919 US10640567B2 (en) 2011-09-05 2017-05-08 Anti-CD40 antibodies and methods of treating cancer having CD40+ tumor cells
CY20181100161T CY1119925T1 (el) 2011-09-05 2018-02-09 Aνti-cd40 αντισωματα, χρησεις και μεθοδοι

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1115280.8 2011-09-05
GBGB1115280.8A GB201115280D0 (en) 2011-09-05 2011-09-05 Antibodies, uses and methods

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/342,141 A-371-Of-International US9676862B2 (en) 2011-09-05 2012-09-05 Anti-CD40 antibodies and methods of treating cancer
US15/588,919 Division US10640567B2 (en) 2011-09-05 2017-05-08 Anti-CD40 antibodies and methods of treating cancer having CD40+ tumor cells

Publications (1)

Publication Number Publication Date
WO2013034904A1 true WO2013034904A1 (en) 2013-03-14

Family

ID=44882205

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2012/052179 Ceased WO2013034904A1 (en) 2011-09-05 2012-09-05 Anti-cd40 antibodies, uses and methods

Country Status (22)

Country Link
US (2) US9676862B2 (https=)
EP (2) EP3323834B1 (https=)
JP (1) JP6324891B2 (https=)
KR (1) KR102029946B1 (https=)
CN (1) CN103930442B (https=)
AU (1) AU2012306071B2 (https=)
CA (1) CA2860406C (https=)
CY (1) CY1119925T1 (https=)
DK (2) DK3323834T3 (https=)
ES (2) ES2967316T3 (https=)
GB (1) GB201115280D0 (https=)
HR (1) HRP20180269T1 (https=)
HU (1) HUE036538T2 (https=)
LT (1) LT2753646T (https=)
NO (1) NO2753646T3 (https=)
PL (1) PL2753646T3 (https=)
PT (1) PT2753646T (https=)
RS (1) RS56868B1 (https=)
RU (1) RU2649055C2 (https=)
SI (1) SI2753646T1 (https=)
SM (1) SMT201800144T1 (https=)
WO (1) WO2013034904A1 (https=)

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016023960A1 (en) * 2014-08-12 2016-02-18 Alligator Bioscience Ab Combination therapies with anti cd40 antibodies
WO2017009842A2 (en) 2015-07-16 2017-01-19 Biokine Therapeutics Ltd. Compositions and methods for treating cancer
WO2017079112A1 (en) 2015-11-03 2017-05-11 Janssen Biotech, Inc. Antibodies specifically binding pd-1 and their uses
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2018031258A1 (en) 2016-08-12 2018-02-15 Janssen Biotech, Inc. Engineered antibodies and other fc-domain containing molecules with enhanced agonism and effector functions
WO2018091739A1 (en) 2016-11-21 2018-05-24 Alligator Bioscience Ab Bispecific polypeptides to gitr and ctla-4
WO2018219327A1 (zh) 2017-06-01 2018-12-06 江苏恒瑞医药股份有限公司 抗cd40抗体、其抗原结合片段及其医药用途
EP3534952A1 (en) 2016-11-04 2019-09-11 Memorial Sloan-Kettering Cancer Center Bi-specific activators for tumor therapy
WO2019241730A2 (en) 2018-06-15 2019-12-19 Flagship Pioneering Innovations V, Inc. Increasing immune activity through modulation of postcellular signaling factors
US10544229B2 (en) 2015-09-30 2020-01-28 Janssen Biotech, Inc. Agonistic antibodies specifically binding CD40 and methods of use
WO2020108621A1 (zh) 2018-11-30 2020-06-04 江苏恒瑞医药股份有限公司 一种cd40抗体药物组合物及其用途
WO2020108611A1 (zh) 2018-11-30 2020-06-04 江苏恒瑞医药股份有限公司 抗cd40抗体、其抗原结合片段及其医药用途
US10689449B2 (en) 2015-01-20 2020-06-23 Igm Biosciences, Inc. Multimeric death domain-containing receptor-5 (DR5) antibodies and uses thereof
WO2020227159A2 (en) 2019-05-03 2020-11-12 Flagship Pioneering Innovations V, Inc. Methods of modulating immune activity
US10857230B2 (en) * 2017-03-03 2020-12-08 Janssen Biotech, Inc. Co-therapy comprising a small molecule CSF-1R inhibitor and an agonistic antibody that specifically binds CD40 for the treatment of cancer
WO2021127217A1 (en) 2019-12-17 2021-06-24 Flagship Pioneering Innovations V, Inc. Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly
WO2021140222A1 (en) 2020-01-10 2021-07-15 Symphogen A/S Anti-cd40 antibodies and compositions
WO2022006179A1 (en) 2020-06-29 2022-01-06 Flagship Pioneering Innovations V, Inc. Viruses engineered to promote thanotransmission and their use in treating cancer
US11359029B2 (en) 2016-08-12 2022-06-14 Janssen Biotech, Inc. FC engineered anti-TNFR superfamily member antibodies having enhanced agonistic activity and methods of using them
EP3856790A4 (en) * 2018-09-28 2022-09-28 Lyvgen Biopharma Holdings Limited ANTI-CD40 BINDING MOLECULES WITH ENGINEERED FC DOMAINS AND THEIR THERAPEUTIC USES
US11702478B2 (en) 2017-09-19 2023-07-18 Mab Discovery Gmbh Agonistic CD40 antibodies
WO2023247050A1 (en) 2022-06-23 2023-12-28 Alligator Bioscience Ab Combination therapies
US11873348B2 (en) * 2021-11-05 2024-01-16 Alligator Bioscience Ab Peptides
US20240141016A1 (en) * 2021-11-05 2024-05-02 Navicure Biopharmaceuticals Limited Immunogenic fusion proteins against infectious animal diseases
US11976123B2 (en) 2018-04-20 2024-05-07 Lyvgen Biopharma Holdings Limited Anti-CD40 antibodies and uses thereof
WO2024151687A1 (en) 2023-01-09 2024-07-18 Flagship Pioneering Innovations V, Inc. Genetic switches and their use in treating cancer
US12065499B2 (en) 2017-11-03 2024-08-20 Novartis Ag Anti-CD40 antibodies for use in treatment of Sjögren's syndrome
WO2025093035A1 (en) * 2023-11-03 2025-05-08 Utc Therapeutics (Shanghai) Co., Ltd. Cd40-targetting antibodies and uses thereof
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201115280D0 (en) * 2011-09-05 2011-10-19 Alligator Bioscience Ab Antibodies, uses and methods
PL2953634T3 (pl) 2013-02-07 2021-11-22 The General Hospital Corporation Sposoby namnażania lub zubożania limfocytów t-regulatorowych
BR112017020952A2 (pt) 2015-04-13 2018-07-10 Five Prime Therapeutics Inc método de tratamento de câncer, composição e uso da composição
EP3294773A1 (en) * 2015-05-15 2018-03-21 The General Hospital Corporation Antagonistic anti-tumor necrosis factor receptor superfamily antibodies
WO2017040312A1 (en) 2015-08-28 2017-03-09 The General Hospital Corporation Agonistic anti-tumor necrosis factor receptor 2 antibodies
CA3023930C (en) 2016-05-13 2025-09-23 The General Hospital Corporation TUMOR-ANTAGONISTIC ANTIBODIES OF THE NECROSIS FACTOR RECEPTOR SUPERFAMILY
SI3464361T1 (sl) * 2016-05-27 2022-01-31 Abbvie Biotherapeutics Inc. Protitelesa proti CD40 in njihove uporabe
WO2018115003A2 (en) 2016-12-19 2018-06-28 Glenmark Pharmaceuticals S.A. Novel tnfr agonists and uses thereof
JP7626698B2 (ja) * 2018-09-28 2025-02-04 リビジェン バイオファーマ ホールディングス リミテッド 操作されたFcドメインを有する抗CD40結合分子およびその治療用途
CN113302205B (zh) 2018-11-15 2024-12-06 综合医院公司 激动性肿瘤坏死因子受体超家族多肽
WO2020240434A1 (en) 2019-05-28 2020-12-03 Janssen Biotech, Inc. Method of providing safe administration of an anti-cd40 antibody
GB202004677D0 (en) 2020-03-31 2020-05-13 Alligator Bioscience Ab Methods and compositions
JP2024512669A (ja) 2021-03-31 2024-03-19 フラグシップ パイオニアリング イノベーションズ ブイ,インコーポレーテッド タノトランスミッションポリペプチド及び癌の処置におけるそれらの使用
US20240336659A1 (en) * 2021-04-15 2024-10-10 Onecuregen Co., Ltd. Cell-penetrating peptide, anti-cancer peptide, and pharmaceutical composition for preventing or treating cancer, comprising same
BR112023026111A2 (pt) * 2021-06-28 2024-03-05 Jiangsu Hengrui Pharmaceuticals Co Ltd Anticorpo anti-cd40, fragmento de ligação ao antígeno e uso médico do mesmo
US20240316104A1 (en) 2021-06-29 2024-09-26 Flagship Pioneering Innovations V, Inc. Immune cells engineered to promote thanotransmission and uses thereof
EP4534559A4 (en) 2022-05-31 2025-11-05 Futuregen Biopharmaceutical Beijing Co Ltd Anti-CD40 antibodies, bispecific anti-PD-L1×CD40 antibodies, and their use
WO2024077191A1 (en) 2022-10-05 2024-04-11 Flagship Pioneering Innovations V, Inc. Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer
WO2024140903A1 (zh) * 2022-12-28 2024-07-04 苏州盛迪亚生物医药有限公司 一种cd40结合分子的组合物及医药用途

Citations (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4348376A (en) 1980-03-03 1982-09-07 Goldenberg Milton David Tumor localization and therapy with labeled anti-CEA antibody
US4440859A (en) 1977-05-27 1984-04-03 The Regents Of The University Of California Method for producing recombinant bacterial plasmids containing the coding sequences of higher organisms
US4530901A (en) 1980-01-08 1985-07-23 Biogen N.V. Recombinant DNA molecules and their use in producing human interferon-like polypeptides
US4582800A (en) 1982-07-12 1986-04-15 Hoffmann-La Roche Inc. Novel vectors and method for controlling interferon expression
EP0213303A2 (en) 1985-07-12 1987-03-11 Bo Magnus Ekman A method for producing small, spherical polymer particles
US4677063A (en) 1985-05-02 1987-06-30 Cetus Corporation Human tumor necrosis factor
US4678751A (en) 1981-09-25 1987-07-07 Genentech, Inc. Hybrid human leukocyte interferons
US4704362A (en) 1977-11-08 1987-11-03 Genentech, Inc. Recombinant cloning vehicle microbial polypeptide expression
US4710463A (en) 1978-12-22 1987-12-01 Biogen N.V. Recombinant DNA molecules capable of expressing HBV core and surface antigens
US4757006A (en) 1983-10-28 1988-07-12 Genetics Institute, Inc. Human factor VIII:C gene and recombinant methods for production
US4766075A (en) 1982-07-14 1988-08-23 Genentech, Inc. Human tissue plasminogen activator
US4810648A (en) 1986-01-08 1989-03-07 Rhone Poulenc Agrochimie Haloarylnitrile degrading gene, its use, and cells containing the gene
US4987071A (en) 1986-12-03 1991-01-22 University Patents, Inc. RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods
EP0415731A2 (en) 1989-08-30 1991-03-06 The Wellcome Foundation Limited Novel entities for cancer therapy
US5116742A (en) 1986-12-03 1992-05-26 University Patents, Inc. RNA ribozyme restriction endoribonucleases and methods
US5149796A (en) 1989-08-31 1992-09-22 City Of Hope Chimeric DNA-RNA catalytic sequences
US5168053A (en) 1989-03-24 1992-12-01 Yale University Cleavage of targeted RNA by RNAase P
US5180818A (en) 1990-03-21 1993-01-19 The University Of Colorado Foundation, Inc. Site specific cleavage of single-stranded dna
WO1994010323A1 (en) 1992-11-04 1994-05-11 Imperial Cancer Research Technology Limited Virus with modified binding moiety specific for the target cells
WO1996006641A1 (en) 1994-08-29 1996-03-07 Prizm Pharmaceuticals, Inc. Conjugates of vascular endothelial growth factor with targeted agents
US5643872A (en) 1989-10-23 1997-07-01 Smithkline Beecham Corporation Cyclic anti-aggregatory peptides
WO1998032845A1 (en) 1997-01-24 1998-07-30 Bioinvent International Ab A method for in vitro molecular evolution of protein function
US5851451A (en) 1995-12-15 1998-12-22 Takeda Chemical Industries, Ltd. Production of microspheres
US6008058A (en) 1993-06-18 1999-12-28 University Of Louisville Cyclic peptide mixtures via side chain or backbone attachment and solid phase synthesis
WO2001083755A2 (en) * 2000-04-28 2001-11-08 La Jolla Institute For Allergy And Immunology Human anti-cd40 antibodies and methods of making and using same
WO2002048351A2 (en) 2000-12-12 2002-06-20 Alligator Bioscience Ab A method for in vitro molecular evolution of protein function
WO2003097834A2 (en) 2002-05-17 2003-11-27 Alligator Bioscience Ab A method for in vitro molecular evolution of protein function
WO2006073443A2 (en) * 2004-04-27 2006-07-13 Novartis Vaccines And Diagnostics, Inc. Antagonist anti-cd40 monoclonal antibodies and methods for their use
EP1885399A2 (en) 2005-05-26 2008-02-13 Seattle Genetics, Inc. Humanized anti-cd40 antibodies and their methods of use
EP2011802A2 (en) * 2001-04-27 2009-01-07 Kirin Pharma Kabushiki Kaisha Anti-CD40 monoclonal antibody

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL135578A0 (en) * 1997-10-29 2001-05-20 Genzyme Corp Compositions and methods for treating lysosomal storage disease
US6051228A (en) 1998-02-19 2000-04-18 Bristol-Myers Squibb Co. Antibodies against human CD40
US6946129B1 (en) * 1999-06-08 2005-09-20 Seattle Genetics, Inc. Recombinant anti-CD40 antibody and uses thereof
US20030059427A1 (en) * 2000-04-28 2003-03-27 Force Walker R. Isolation and characterization of highly active anti-CD40 antibody
US6958213B2 (en) * 2000-12-12 2005-10-25 Alligator Bioscience Ab Method for in vitro molecular evolution of protein function
AR039067A1 (es) * 2001-11-09 2005-02-09 Pfizer Prod Inc Anticuerpos para cd40
US7432063B2 (en) 2002-02-14 2008-10-07 Kalobios Pharmaceuticals, Inc. Methods for affinity maturation
AU2003217912A1 (en) * 2002-03-01 2003-09-16 Xencor Antibody optimization
WO2009094391A1 (en) 2008-01-23 2009-07-30 Xencor, Inc. Optimized cd40 antibodies and methods of using the same
GB201115280D0 (en) * 2011-09-05 2011-10-19 Alligator Bioscience Ab Antibodies, uses and methods

Patent Citations (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4440859A (en) 1977-05-27 1984-04-03 The Regents Of The University Of California Method for producing recombinant bacterial plasmids containing the coding sequences of higher organisms
US4704362A (en) 1977-11-08 1987-11-03 Genentech, Inc. Recombinant cloning vehicle microbial polypeptide expression
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4710463A (en) 1978-12-22 1987-12-01 Biogen N.V. Recombinant DNA molecules capable of expressing HBV core and surface antigens
US4530901A (en) 1980-01-08 1985-07-23 Biogen N.V. Recombinant DNA molecules and their use in producing human interferon-like polypeptides
US4348376A (en) 1980-03-03 1982-09-07 Goldenberg Milton David Tumor localization and therapy with labeled anti-CEA antibody
US4678751A (en) 1981-09-25 1987-07-07 Genentech, Inc. Hybrid human leukocyte interferons
US4582800A (en) 1982-07-12 1986-04-15 Hoffmann-La Roche Inc. Novel vectors and method for controlling interferon expression
US4766075A (en) 1982-07-14 1988-08-23 Genentech, Inc. Human tissue plasminogen activator
US4757006A (en) 1983-10-28 1988-07-12 Genetics Institute, Inc. Human factor VIII:C gene and recombinant methods for production
US4677063A (en) 1985-05-02 1987-06-30 Cetus Corporation Human tumor necrosis factor
EP0213303A2 (en) 1985-07-12 1987-03-11 Bo Magnus Ekman A method for producing small, spherical polymer particles
US4810648A (en) 1986-01-08 1989-03-07 Rhone Poulenc Agrochimie Haloarylnitrile degrading gene, its use, and cells containing the gene
US5116742A (en) 1986-12-03 1992-05-26 University Patents, Inc. RNA ribozyme restriction endoribonucleases and methods
US5093246A (en) 1986-12-03 1992-03-03 University Patents, Inc. Rna ribozyme polymerases, dephosphorylases, restriction endoribo-nucleases and methods
US4987071A (en) 1986-12-03 1991-01-22 University Patents, Inc. RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods
US5168053A (en) 1989-03-24 1992-12-01 Yale University Cleavage of targeted RNA by RNAase P
EP0415731A2 (en) 1989-08-30 1991-03-06 The Wellcome Foundation Limited Novel entities for cancer therapy
US5149796A (en) 1989-08-31 1992-09-22 City Of Hope Chimeric DNA-RNA catalytic sequences
US5643872A (en) 1989-10-23 1997-07-01 Smithkline Beecham Corporation Cyclic anti-aggregatory peptides
US5180818A (en) 1990-03-21 1993-01-19 The University Of Colorado Foundation, Inc. Site specific cleavage of single-stranded dna
WO1994010323A1 (en) 1992-11-04 1994-05-11 Imperial Cancer Research Technology Limited Virus with modified binding moiety specific for the target cells
US6008058A (en) 1993-06-18 1999-12-28 University Of Louisville Cyclic peptide mixtures via side chain or backbone attachment and solid phase synthesis
WO1996006641A1 (en) 1994-08-29 1996-03-07 Prizm Pharmaceuticals, Inc. Conjugates of vascular endothelial growth factor with targeted agents
US5851451A (en) 1995-12-15 1998-12-22 Takeda Chemical Industries, Ltd. Production of microspheres
WO1998032845A1 (en) 1997-01-24 1998-07-30 Bioinvent International Ab A method for in vitro molecular evolution of protein function
WO2001083755A2 (en) * 2000-04-28 2001-11-08 La Jolla Institute For Allergy And Immunology Human anti-cd40 antibodies and methods of making and using same
WO2002048351A2 (en) 2000-12-12 2002-06-20 Alligator Bioscience Ab A method for in vitro molecular evolution of protein function
EP2011802A2 (en) * 2001-04-27 2009-01-07 Kirin Pharma Kabushiki Kaisha Anti-CD40 monoclonal antibody
WO2003097834A2 (en) 2002-05-17 2003-11-27 Alligator Bioscience Ab A method for in vitro molecular evolution of protein function
WO2006073443A2 (en) * 2004-04-27 2006-07-13 Novartis Vaccines And Diagnostics, Inc. Antagonist anti-cd40 monoclonal antibodies and methods for their use
EP1885399A2 (en) 2005-05-26 2008-02-13 Seattle Genetics, Inc. Humanized anti-cd40 antibodies and their methods of use

Non-Patent Citations (158)

* Cited by examiner, † Cited by third party
Title
"handbook of Pharmaceutical Excipients", 2000, PHARMACEUTICAL PRESS
"Janeway's Immunobiology", 2008, GARLAND SCIENCE
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY
ADVANI ET AL., J CLINICAL ONCOLOGY, 2009
ADVANI ET AL.: "Phase I Study of the humanized anti-CD40 monoclonal antibody Dacetuzumab in refractory of recurrent non-hodgkin's lymphoma", J CLINICAL ONCOLOGY, vol. 27, 2009, pages 4371 - 4377
AIELLO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 10457 - 10461
ALLEN ET AL., SCIENCE, vol. 259, 1993, pages 990 - 993
ARMITAGE ET AL., NATURE, vol. 357, 1992, pages 80 - 82
ARMITAGE ET AL.: "Molecular and biological characterization of a murine ligand for CD40", NATURE, vol. 357, 1992, pages 80 - 82, XP002024662, DOI: doi:10.1038/357080a0
BAGSHAWE, BR. J. CANCER, vol. 56, 1987, pages 531 - 2
BAGSHAWE, DRUG DEV. RES., vol. 34, 1995, pages 220 - 230
BAGSHAWE, K.D. ET AL.: "A cytotoxic agent can be generated selectively at cancer sites", BR. J. CANCER., vol. 58, 1988, pages 700 - 703, XP000121545
BAJORATH, J. ET AL.: "Analysis of gp39/CD40 interactions using molecular models and site-directed mutagenesis", BIOCHEMISTRY, vol. 34, 1995, pages 9884 - 92, XP002017168, DOI: doi:10.1021/bi00031a009
BAJORATH, J. ET AL.: "Identification of residues on CD40 and its ligand which are critical for the receptor-ligand interaction", BIOCHEMISTRY, vol. 34, 1995, pages 1833 - 44, XP002019526, DOI: doi:10.1021/bi00006a003
BAJORATH, J.: "Detailed comparison of two molecular models of the human CD40 ligand with an x-ray structure and critical assessment of model-based mutagenesis and residue mapping studies", J BIOL CHEM, vol. 273, 1998, pages 24603 - 9
BAUMINGER; WILCHEK, METHODS ENZYMOL., vol. 70, 1980, pages 151 - 159
BECKER; GUARENTE, METHODS ENZYMOL., vol. 194, 1990, pages 182
BEGGS, NATURE, vol. 275, 1978, pages 104 - 109
BERENT ET AL., BIOTECH, vol. 3, 1985, pages 208
BERINSTEIN, VACCINE, vol. 25, no. 2, 2007, pages B72 - B88
BROWN, CANCER, vol. 55, 1985, pages 2222 - 2228
BROWN, INT. J. RADIAT. ONCOL. BIOL. PHYS., vol. 16, 1989, pages 987 - 993
BURROWS; THORPE, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 8996 - 9000
CARTER ET AL., NATURE REVIEWS IMMUNOLOGY, vol. 6, 2006, pages 343 - 357
CARTER, NATURE REVIEWS IMMUNOLOGY, 2006, pages 343 - 357
COCO MARTIN ET AL., CANCER RES., vol. 59, 1999, pages 1134 - 1140
COHEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 69, 1972, pages 2110
CORNELIUS ET AL., J. IMMUNOL., vol. 161, 1998, pages 6845 - 6852
D. H. RICH: "Protease Inhibitors", 1986, ELSEVIER
DEROSSI ET AL., TRENDS CELL BIOL., vol. 8, 1998, pages 84 - 87
DIEHL, L. ET AL.: "CD40 activation in vivo overcomes peptide-induced peripheral cytotoxic T-lymphocyte tolerance and augments anti-tumor vaccine efficacy", NAT. MED., vol. 5, 1999, pages 774 - 779, XP002153727, DOI: doi:10.1038/10495
DOUGHERTY ET AL., J. NATL. CANCER INST., vol. 90, 1998, pages 889 - 905
DURAI ET AL., ANTICANCER RES., vol. 17, 1997, pages 3307 - 3312
ELLMARK ET AL., AIDS RESEARCH AND HUMAN RETROVIRUSES, vol. 243, 2008, pages 367 - 372
ELLMARK ET AL., IMMUNOLOGY, 2002
ELLMARK ET AL., IMMUNOLOGY, vol. 106, 2002, pages 456 - 463
ELLMARK ET AL., IMMUNOLOGY, vol. 108, 2003, pages 452 - 7
ELLMARK ET AL.: "Identification of a Strongly Activating Human Anti-Cd40 Antibody that Suppresses HIV Type 1 Infection", AIDS RESEARCH AND HUMAN RETTROVIRUSES, vol. 24, no. 3, 2008, pages 367 - 373, XP055096256, DOI: doi:10.1089/aid.2007.0215
ELLMARK ET AL.: "Modulation of the CD40-CD40L ligand interaction using human anti-CD40 single-chain antibody fragments obtained from the n-CoDeRO phage display library", IMMUNOLOGY, vol. 106, pages 456 - 463
ELLMARK PETER ET AL: "Modulation of the CD40-CD40 ligand interaction using human anti-CD40 single-chain antibody fragments obtained from the n-CoDeR phage display library", IMMUNOLOGY, vol. 106, no. 4, August 2002 (2002-08-01), pages 456 - 463, XP002689067, ISSN: 0019-2805 *
FELLOUSE ET AL., J MOL BIOL, 2007
FELLOUSE,F.A. ET AL.: "High-throughput generation of synthetic antibodies from highly functional minimalist phage-displayed libraries", J MOL BIOL, vol. 373, 2007, pages 924 - 940, XP022285568, DOI: doi:10.1016/j.jmb.2007.08.005
FOY ET AL., J EXP MED, vol. 5, 1993, pages 1567 - 1575
FRAKER ET AL., BIOCHEM. BIOPHYS. RES. COMM., vol. 80, 1978, pages 49 - 57
FRANCISCO ET AL., CANCER RESEARCH, 2000
FRANCISCO ET AL.: "Agonistic properties and in vivo antitumor activity of the anti-CD40 antibody SGN-14", CANCER RESEARCH, vol. 60, 2000, pages 3225 - 3231, XP002302208
FRENCH ET AL., NATURE MEDICINE, 1999, pages 548 - 553
FRENCH, R.R. ET AL.: "CD40 antibody evokes a cytotoxic T-cell response that eradicates lymphoma and bypasses T-cell help", NAT MED, vol. 5, 1999, pages 548 - 53, XP002159390, DOI: doi:10.1038/8426
GATENBY ET AL.: "Why do cancers have high aerobi glycolysis?", NATURE REVIEW CANCER, vol. 4, 2004, pages 891 - 899
GLADUE ET AL., CANCER IMMUNOL IMMUNOTHER, vol. 60, no. 7, 2011, pages 1009 - 1017
GLAUDE ET AL.: "The CD40 agonist antibody CP-870,893 enhances dendritic cell and B-cell activity and promotes anti-tumor efficacy in SCID-hu mice", CANCER IMMUNOL IMMUNOTHERAPY, vol. 60, no. 7, 2011, pages 1009 - 17, XP019918501, DOI: doi:10.1007/s00262-011-1014-6
H ZOLA: "Monoclonal Antibodies; A manual of techniques", 1988, CRC PRESS
HO; PASTAN: "Therapeutic antibodies: Methods and protocols", 2009, HUMANA PRESS
HORSMAN, ACTA ONCOL., vol. 34, 1995, pages 571 - 587
HUANG ET AL., SCIENCE, vol. 275, 1997, pages 547 - 550
HUANG; MILLER, ADV. APPL. MATH., vol. 12, 1991, pages 337 - 357
HUSSEIN ET AL., HAEMATOLOGICA, 2010
HUSSEIN ET AL., HAEMATOLOGICA, vol. 95, 2010, pages 845 - 848
HUSSEIN ET AL.: "A phase I multi-dose study of dacetumuzumab (SGN-40, a humananized anti-CD40 monoclonal antibody) in patients with multiple myeloma", HAEMATOLOGICA, vol. 95, 2010, pages 845 - 848
ILIAKIS; KURTZMAN, INT. J. RADIAT. ONCOL. BIOL. PHYS., vol. 16, 1989, pages 1235 - 1241
J-F CHATAL: "Monoclonal Antibodies in Immunoscintigraphy", 1989, CRC PRESS
KAI ET AL., NATURE BIOTECHNOLOGY, vol. 26, 2008, pages 209 - 211
KALBASHI ET AL., J IMMUNOTHERAPY, vol. 33, 2010, pages 810 - 816
KALBASI ET AL., J IMMUNOTHERAPY, vol. 33, 2010, pages 810 - 816
KALBASI, A. ET AL.: "CD40 expression by human melanocytic lesions and melanoma cell lines and direct CD40 targeting with the therapeutic anti-CD40 antibody CP-870,893", J IMMUNOTHER, vol. 33, 2010, pages 810 - 816
KATAKURA ET AL., JOURNAL OF MOLECULAR CATALYSIS B: ENZYMATIC, 2008
KATAKURA, JOURNAL OF MOLECULAR CATALYSIS, 2004, pages 191 - 200
KHALIL; VONDERHEIDE, UPDATE ON CANCER THERAPEUTICS, vol. 2, 2007, pages 61 - 65
KHAWLI ET AL., HANDB. EXP. PHARMACAL., vol. 181, 2008, pages 291 - 328
KNUDSEN; NIELSEN, ANTICANCER DRUGS, vol. 8, 1997, pages 113 - 118
KOIDE ET AL., ACS CHEMICAL BIOLOGY, 2009
KOIDE, A. ET AL.: "Exploring the capacity of minimalist protein interfaces: interface energetics and affinity maturation to picomolar KD of a single-domain antibody with a flat paratope", J MOL BIOL, vol. 373, 2007, pages 941 - 953, XP022285569, DOI: doi:10.1016/j.jmb.2007.08.027
LANG ET AL., J. NEUROSURG., vol. 89, 1998, pages 125 - 132
LAW ET AL., CANCER RESEARCH, 2005
LAW ET AL.: "Preclinical antilymphoma activity of a humanized anti-CD40 monoclonal antibody, SGN-14", CANCER RESEARCH, vol. 65, no. 18, 2005, pages 8331 - 8338, XP055096240, DOI: doi:10.1158/0008-5472.CAN-05-0095
LEE ET AL., ANTICANCER RES., vol. 16, 1996, pages 1805 - 1811
LI ET AL., SCIENCE, vol. 333, 2011, pages 1030 - 1034
LOSKOG ET AL., SEMIN IMMUNOLOGY, vol. 21, 2009, pages 301 - 307
LOSKOG, A.S.; ELIOPOULOS, A.G.: "The Janus faces of CD40 in cancer", SEMIN. IMMUNOL, vol. 21, 2009, pages 301 - 307, XP026624974, DOI: doi:10.1016/j.smim.2009.07.001
LUCHANSKY ET AL., MOL. MICROBIOL., vol. 2, 1988, pages 637 - 646
MARTIN; PAPAHADJOPOULOS, J. BIOL. CHEM., vol. 257, 1982, pages 286 - 288
MCGINN ET AL., J. NATL. CANCER INST., vol. 88, 1996, pages 1193 - 11203
MELERO ET AL., NAT REV CANCER, vol. 7, 2007, pages 95 - 106
MELIEF, IMMUNITY, vol. 29, 2008, pages 372 - 383
MELLOR; MUNN, NAT REV IMMUNOL, vol. 8, 2008, pages 74 - 80
MEZIERE ET AL., J. IMMUNOL., vol. 159, 1997, pages 3230 - 3237
MICHAEL ET AL., GENE THERAPY, vol. 2, 1995, pages 660 - 668
MIERLO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 99, 2002, pages 5561 - 5566
MILLER; VILE, FASEB J., vol. 9, 1995, pages 190 - 199
MITCHELL ET AL., INT. J. RADIAT. BIOL., vol. 56, 1989, pages 827 - 836
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
NAISMITH; SPRANG, TRENDS BIOCHEM, 1998, pages 74 - 79
NERON SONIA ET AL: "Tuning of CD40-CD154 Interactions in Human B-Lymphocyte Activation: A Broad Array of In Vitro Models for a Complex In Vivo Situation", ARCHIVUM IMMUNOLOGIAE ET THERAPIAE EXPERIMENTALIS, vol. 59, no. 1, February 2011 (2011-02-01), pages 25 - 40, XP002689065 *
NEUBERGER ET AL., 8TH INTERNATIONAL BIOTECHNOLOGY SYMPOSIUM, 1998, pages 792 - 799
O'SULLIVAN ET AL., ANAL. BIOCHEM., vol. 100, 1979, pages 100 - 108
OTTALANO ET AL., TUMORI, vol. 88, no. 5, 2002, pages 361 - 6
POUND ET AL., INT IMMUNOL, 1999, pages 11 - 20
PRIMUS ET AL., BIOCONJUG. CHEM., vol. 7, 1996, pages 532 - 535
QIN HUANG ET AL: "Sensitization of SiHa cell to gemcitabine by CD40 activation and its overexpression in cervical carcinoma", MEDICAL ONCOLOGY, SPRINGER-VERLAG, NEW YORK, vol. 28, no. 3, 14 May 2010 (2010-05-14), pages 781 - 788, XP019937670, ISSN: 1559-131X, DOI: 10.1007/S12032-010-9538-8 *
QUEZADA ET AL., ANNU. REV. IMMUNOL., vol. 22, 2004, pages 3077 - 328
QUEZADA, S.A.; JARVINEN, L.Z.; LIND, E.F.; NOELLE, R.J.: "CD40/CD154 interactions at the interface of tolerance and immunity", ANNU. REV. IMMUNOL., vol. 22, 2004, pages 307 - 28
RAN ET AL., CANCER RES., vol. 58, 1998, pages 4646 - 4653
ROCH HOUOT ET AL: "Immunomodulating antibodies and drugs for the treatment of hematological malignancies", CANCER AND METASTASIS REVIEWS, KLUWER ACADEMIC PUBLISHERS, DO, vol. 30, no. 1, 28 January 2011 (2011-01-28), pages 97 - 109, XP019885789, ISSN: 1573-7233, DOI: 10.1007/S10555-011-9274-3 *
RODRIGUES, M.L. ET AL., CHEMISTRY & BIOLOGY, vol. 2, 1995, pages 223
RONALD P GLADUE ET AL: "The CD40 agonist antibody CP-870,893 enhances dendritic cell and B-cell activity and promotes anti-tumor efficacy in SCID-hu mice", CANCER IMMUNOLOGY, IMMUNOTHERAPY, SPRINGER, BERLIN, DE, vol. 60, no. 7, 12 April 2011 (2011-04-12), pages 1009 - 1017, XP019918501, ISSN: 1432-0851, DOI: 10.1007/S00262-011-1014-6 *
S6DERLIND, E.: "Recombining germline-derived CDR sequences for creating diverse single-framework antibody libraries", NAT BIOTECHNOL, vol. 18, 2000, pages 852 - 6, XP009010618, DOI: doi:10.1038/78458
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY
SAMBROOK; RUSSELL: "Molecular Cloning: a Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SCHONBECK ET AL., CELL MOL LIFE SCI., vol. 58, 2001, pages 40 - 43
SCHONBECK, CELL MOL LIFE SCI., vol. 58, 2001, pages 40 - 43
SCHONBECK, U.; LIBBY, P.: "The CD40/CD154 receptor/ligand dyad", CELL MOL LIFE SCI, vol. 58, 2001, pages 4 - 43, XP002525365, DOI: doi:10.1007/PL00000776
SCHONBECK; LIBBY, CELL MOL LIFE SCI, vol. 58, no. 1, 2001, pages 4 - 43
SCHONBECK; LIBBY, CELL MOL LIFE, vol. 58, no. 1, 2001, pages 4 - 43
SENTER, P.D. ET AL.: "Anti-tumour effects of antibody-alkaline phosphatase conjugates in combination with etoposide phosphate", PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 4842 - 4846
SGR HURRELL: "Monoclonal Hybridoma Antibodies: Techniques and Application", 1982, CRC PRESS
SHENOY; SINGH, CLIN. INVEST., vol. 10, 1992, pages 533 - 551
SHERMAN ET AL.: "Methods In Yeast Genetics, A Laboratory Manual", 1986, COLD SPRING HARBOR
SHEWACH; LAWRENCE, INVEST. NEW DRUGS, vol. 14, 1996, pages 257 - 263
SIEPMANN ET AL., IMMUNOLOGY, vol. 3, 2001, pages 263 - 272
SIEPMANN ET AL.: "Rewiring CD40 is necessary for deliveru of rescue signals to B cells in germinal centres and subsequent entry into the memory pool", IMMUNOLOGY, vol. 102, no. 3, 2001, pages 263 - 72
SKLAR ET AL., ANNU REV BIOPHYS BIOMOL STRUCT, 2002, pages 97 - 119
SKLAR ET AL., ANNUAL REVIEW BIOPHYSICAL BIOMOL STRUCTURE, vol. 31, 2002, pages 97 - 119
SÖDERLIND ET AL., NATURE BIOTECHNOL., vol. 18, 2000, pages 852 - 6
SOTOMAYOR ET AL., NATURE MEDICINE, vol. 5, 1999, pages 780 - 787
SOTOMAYOR, E.M. ET AL.: "Conversion of tumor-specific CD4+ T-cell tolerance to T-cell priming through in vivo ligation of CD40", NATURE MEDICINE, vol. 5, 1999, pages 780 - 787, XP002320182, DOI: doi:10.1038/10503
SOUTHERN, J. MOL. BIOL., vol. 98, 1975, pages 503
STAGG ET AL., IMMUNOL REV., vol. 220, 2007, pages 82 - 101
STAVELEY ET AL., NATURE MEDICINE, vol. 171, 2003, pages 697 - 707
STAVELEY-O'CARROLL, K. ET AL.: "In vivo ligation of CD40 enhances priming against the endogenous tumor antigen and promotes CD8+ T cell effector function in SV40 T antigen transgenic mice", J IMMUNOL, vol. 171, 2003, pages 697 - 707
STROHL ET AL., CURR OPIN BIOTECHNOL, vol. 20, 2009, pages 685 - 691
SUMMERHAYES; FRANKS, JOURNAL OF THE NATIONAL CANCER INSTITUTE, 1979
SUMMERHAYES; FRANKS, JOURNAL OF THE NATIONAL CANCER INSTITUTE, vol. 62, 1979, pages 1017 - 1023
TANPING, PROTEIN ENGINEERING, vol. 16, 2003, pages 323 - 330
TASCI ET AL., CELL. MOL. LIFE SCI., 2001, pages 4 - 43
TASCI, I. ET AL.: "Soluble CD40 ligand levels in otherwise healthy subjects with impaired fasting glucose", CELL. LIFE. SCI., vol. 58, 2001, pages 4 - 43
THOMPSON ET AL., NUCL. ACID RES., vol. 22, 1994, pages 4673 - 4680
THURSELL ET AL., BIOCHEM. BIOPHYS. RES. COMM., vol. 111, 1983, pages 166
TONG ET AL.: "CD40-directed gene therapy shows prospects for treating human cancers", CANCER GENE THERAPY, vol. 10, no. 1, 2003, pages 1 - 13
TONG, CANCER GENE THERAPY, vol. 10, no. 1, 2003, pages 1 - 13
TSAI ET AL., DIS. COLON RECTUM, vol. 38, 1995, pages 1067 - 1074
TUTT ET AL., J IMMUNOL., vol. 168, no. 6, 2002, pages 2720 - 8
TUTT ET AL.: "T cell immunity to lymphoma following treatment with anti-CD40 monoclonal antibody", J IMMUNOL, vol. 168, no. 6, 2002, pages 2720 - 8
VAN KOOTEN ,C.; BANCHEREAU, J: "CD40-CD40 ligand", J LEUKOC BIOL, vol. 67, 2000, pages 2 - 17
VAN KOOTEN ET AL., J LEUCOC BIOL, vol. 67, 2000, pages 2 - 17
VAN KOOTEN ET AL., J. LEUK. BIOL., vol. 67, 2000, pages 2 - 17
VAN KOOTEN ET AL., J. LEUK., BIOL., vol. 67, 2000, pages 2 - 17
VAN MIERLO ET AL., J IMMUNOL, vol. 173, 2004, pages 6753 - 6759
VAN MIERLO ET AL., PROC NATL ACAD SCI, USA, vol. 99, no. 8, 2002, pages 5561 - 6
VAN MIERLO, PROC NATL ACAD SCI USA, vol. 99, 2002, pages 5561 - 5566
VAN MIERLO,G.J. ET AL.: "CD40 stimulation leads to effective therapy of CD40(-) tumors through induction of strong systemic cytotoxic T lymphocyte immunity", PROC. NATL. ACAD. SCI. U. S. A., vol. 99, 2002, pages 5561 - 5566, XP008046904, DOI: doi:10.1073/pnas.082107699
VAUGHAN ET AL., NATURE BIOTECHNOL., vol. 16, 1998, pages 535 - 539
VEBER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 75, 1978, pages 2636
VONDERHEIDE ET AL., JOURNAL OF CLINICAL ONCOLOGY, vol. 25, no. 7, 2007, pages 876 - 883
WALDMANN, ANNU. REV MED., vol. 57, 2006, pages 65 - 81
WHITE ANN L ET AL: "Interaction with Fc gamma RIIB Is Critical for the Agonistic Activity of Anti-CD40 Monoclonal Antibody", JOURNAL OF IMMUNOLOGY, vol. 187, no. 4, August 2011 (2011-08-01), pages 1754 - 1763, XP002689066, ISSN: 0022-1767 *
WHITE ET AL.: "Interaction with Fc?RIIB is critical for the agonistic activity of anti-CD40 monoclonal antibody", JOURNAL OF IMMUNOLOGY, 2011, pages 1754 - 1763, XP002689066, DOI: doi:10.4049/jimmunol.1101135
WILSON ET AL., CANCER CELL, 2011, pages 101 - 113
ZIEGLER ET AL., J. NATL. CANCER INST., vol. 89, 1997, pages 1027 - 1036

Cited By (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11149090B2 (en) 2014-08-12 2021-10-19 Alligator Bioscience Ab Combination therapies with anti CD40 antibodies
EP3552665A3 (en) * 2014-08-12 2019-12-18 Alligator Bioscience AB Antibodies
EP4653463A2 (en) 2014-08-12 2025-11-26 Alligator Bioscience AB Antibodies
WO2016023960A1 (en) * 2014-08-12 2016-02-18 Alligator Bioscience Ab Combination therapies with anti cd40 antibodies
US12570753B2 (en) 2014-08-12 2026-03-10 Alligator Bioscience Ab Combination therapies with anti CD40 antibodies
EP4653463A3 (en) * 2014-08-12 2026-02-25 Alligator Bioscience AB Antibodies
US10689449B2 (en) 2015-01-20 2020-06-23 Igm Biosciences, Inc. Multimeric death domain-containing receptor-5 (DR5) antibodies and uses thereof
US11578131B2 (en) 2015-01-20 2023-02-14 Igm Biosciences, Inc. Polynucleotides encoding death domain-containing receptor-5 (DR5) binding molecules
WO2017009842A2 (en) 2015-07-16 2017-01-19 Biokine Therapeutics Ltd. Compositions and methods for treating cancer
EP3744340A2 (en) 2015-07-16 2020-12-02 Biokine Therapeutics Ltd. Compositions and methods for treating cancer
EP3943098A2 (en) 2015-07-16 2022-01-26 Biokine Therapeutics Ltd. Compositions and methods for treating cancer
US10544229B2 (en) 2015-09-30 2020-01-28 Janssen Biotech, Inc. Agonistic antibodies specifically binding CD40 and methods of use
EP4046655A1 (en) 2015-11-03 2022-08-24 Janssen Biotech, Inc. Antibodies specifically binding pd-1 and their uses
WO2017079115A1 (en) 2015-11-03 2017-05-11 Janssen Biotech, Inc. Antibodies specifically binding tim-3 and their uses
WO2017079116A2 (en) 2015-11-03 2017-05-11 Janssen Biotech, Inc. Antibodies specifically binding pd-1 and tim-3 and their uses
WO2017079112A1 (en) 2015-11-03 2017-05-11 Janssen Biotech, Inc. Antibodies specifically binding pd-1 and their uses
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2018031258A1 (en) 2016-08-12 2018-02-15 Janssen Biotech, Inc. Engineered antibodies and other fc-domain containing molecules with enhanced agonism and effector functions
US10669344B2 (en) 2016-08-12 2020-06-02 Janssen Biotech, Inc. Engineered antibodies and other Fc-domain containing molecules with enhanced agonism and effector functions
US11359029B2 (en) 2016-08-12 2022-06-14 Janssen Biotech, Inc. FC engineered anti-TNFR superfamily member antibodies having enhanced agonistic activity and methods of using them
EP3534952A1 (en) 2016-11-04 2019-09-11 Memorial Sloan-Kettering Cancer Center Bi-specific activators for tumor therapy
WO2018091739A1 (en) 2016-11-21 2018-05-24 Alligator Bioscience Ab Bispecific polypeptides to gitr and ctla-4
US10857230B2 (en) * 2017-03-03 2020-12-08 Janssen Biotech, Inc. Co-therapy comprising a small molecule CSF-1R inhibitor and an agonistic antibody that specifically binds CD40 for the treatment of cancer
WO2018219327A1 (zh) 2017-06-01 2018-12-06 江苏恒瑞医药股份有限公司 抗cd40抗体、其抗原结合片段及其医药用途
US11525005B2 (en) 2017-06-01 2022-12-13 Jiangsu Hengrui Medicine Co., Ltd. Anti-CD40 antibody, antigen binding fragment thereof and medical use thereof
US12565533B2 (en) 2017-09-19 2026-03-03 Mab Discovery Gmbh Agonistic CD40 antibodies
US11702478B2 (en) 2017-09-19 2023-07-18 Mab Discovery Gmbh Agonistic CD40 antibodies
US12065499B2 (en) 2017-11-03 2024-08-20 Novartis Ag Anti-CD40 antibodies for use in treatment of Sjögren's syndrome
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies
US11976123B2 (en) 2018-04-20 2024-05-07 Lyvgen Biopharma Holdings Limited Anti-CD40 antibodies and uses thereof
WO2019241730A2 (en) 2018-06-15 2019-12-19 Flagship Pioneering Innovations V, Inc. Increasing immune activity through modulation of postcellular signaling factors
EP3856790A4 (en) * 2018-09-28 2022-09-28 Lyvgen Biopharma Holdings Limited ANTI-CD40 BINDING MOLECULES WITH ENGINEERED FC DOMAINS AND THEIR THERAPEUTIC USES
WO2020108611A1 (zh) 2018-11-30 2020-06-04 江苏恒瑞医药股份有限公司 抗cd40抗体、其抗原结合片段及其医药用途
WO2020108621A1 (zh) 2018-11-30 2020-06-04 江苏恒瑞医药股份有限公司 一种cd40抗体药物组合物及其用途
WO2020227159A2 (en) 2019-05-03 2020-11-12 Flagship Pioneering Innovations V, Inc. Methods of modulating immune activity
WO2021127217A1 (en) 2019-12-17 2021-06-24 Flagship Pioneering Innovations V, Inc. Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly
WO2021140222A1 (en) 2020-01-10 2021-07-15 Symphogen A/S Anti-cd40 antibodies and compositions
WO2022006179A1 (en) 2020-06-29 2022-01-06 Flagship Pioneering Innovations V, Inc. Viruses engineered to promote thanotransmission and their use in treating cancer
AU2022380700A9 (en) * 2021-11-05 2026-02-19 Navicure Biopharmaceuticals Limited Immunogenic fusion proteins against infectious animal diseases
US12448465B2 (en) 2021-11-05 2025-10-21 Alligator Bioscience Ab Peptides
AU2022380700B9 (en) * 2021-11-05 2026-02-19 Navicure Biopharmaceuticals Limited Immunogenic fusion proteins against infectious animal diseases
US20240141016A1 (en) * 2021-11-05 2024-05-02 Navicure Biopharmaceuticals Limited Immunogenic fusion proteins against infectious animal diseases
US11873348B2 (en) * 2021-11-05 2024-01-16 Alligator Bioscience Ab Peptides
WO2023247050A1 (en) 2022-06-23 2023-12-28 Alligator Bioscience Ab Combination therapies
WO2024151687A1 (en) 2023-01-09 2024-07-18 Flagship Pioneering Innovations V, Inc. Genetic switches and their use in treating cancer
WO2025093035A1 (en) * 2023-11-03 2025-05-08 Utc Therapeutics (Shanghai) Co., Ltd. Cd40-targetting antibodies and uses thereof

Also Published As

Publication number Publication date
SMT201800144T1 (it) 2018-05-02
ES2967316T3 (es) 2024-04-29
US10640567B2 (en) 2020-05-05
CN103930442B (zh) 2017-09-26
CA2860406C (en) 2024-01-16
LT2753646T (lt) 2018-02-26
ES2658157T3 (es) 2018-03-08
RS56868B1 (sr) 2018-04-30
PL2753646T3 (pl) 2018-05-30
JP6324891B2 (ja) 2018-05-16
CY1119925T1 (el) 2018-12-12
KR102029946B1 (ko) 2019-10-10
EP3323834B1 (en) 2023-10-11
CN103930442A (zh) 2014-07-16
CA2860406A1 (en) 2013-03-14
EP3323834A1 (en) 2018-05-23
US20170240642A1 (en) 2017-08-24
HRP20180269T1 (hr) 2018-03-23
SI2753646T1 (en) 2018-04-30
JP2014531201A (ja) 2014-11-27
AU2012306071B2 (en) 2017-06-15
US9676862B2 (en) 2017-06-13
HUE036538T2 (hu) 2018-07-30
GB201115280D0 (en) 2011-10-19
RU2649055C2 (ru) 2018-04-02
DK3323834T3 (en) 2023-11-06
AU2012306071A1 (en) 2014-03-20
RU2014113304A (ru) 2015-10-20
PT2753646T (pt) 2018-02-07
US20140348836A1 (en) 2014-11-27
EP2753646B1 (en) 2017-11-22
NO2753646T3 (https=) 2018-04-21
DK2753646T3 (en) 2018-01-02
KR20140066213A (ko) 2014-05-30
EP2753646A1 (en) 2014-07-16

Similar Documents

Publication Publication Date Title
US10640567B2 (en) Anti-CD40 antibodies and methods of treating cancer having CD40+ tumor cells
EP3083688B1 (en) Human anti-cd40 human antibodies
TWI796283B (zh) Msln及cd3抗體構築體
JP6879998B2 (ja) Cd70及びcd3に対する抗体構築物
EP3105252B1 (en) Bispecific antibodies for use in stem cell transplantation
JP7501991B2 (ja) 抗体及び関連分子並びにその使用
CN111012921A (zh) 针对组织因子的人抗体药物缀合物
TW201805310A (zh) 包含tnf家族配位三聚體及肌腱蛋白結合部份之抗原結合分子
WO2016126608A1 (en) Car-expressing cells against multiple tumor antigens and uses thereof
WO2016090034A2 (en) Methods for b cell preconditioning in car therapy
WO2022057871A1 (zh) 抗4-1bb-抗pd-l1双特异性抗体、其药物组合物及用途
CN113692413A (zh) 外排泵-癌症抗原多特异性抗体以及与其相关的组合物、试剂、试剂盒和方法
KR20240032847A (ko) Cldn18.2 및 cd3에 결합하는 이중특이 결합제
WO2024193635A1 (en) Sirp variants and uses thereof
JP2024522234A (ja) 新規な併用療法及びその使用
WO2024213119A1 (en) Ph-sensitive cd47-binding domains and uses thereof
JP7822652B2 (ja) 新規なpdl1単一ドメイン抗体の開発
Alam The effects of radiation on CAR-T cell functionality against neuroblastoma, within the context of an intact immune system
WO2026085716A1 (zh) 新型il-18替代物及其用途
BR112018015715B1 (pt) Construto de anticorpo de cadeia única, seu uso, composição farmacêutica e kit

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12761786

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2014527743

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2012306071

Country of ref document: AU

Date of ref document: 20120905

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2012761786

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012761786

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20147008695

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014113304

Country of ref document: RU

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14342141

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2860406

Country of ref document: CA