WO2013011076A2 - Antigen-binding proteins with increased fcrn binding - Google Patents

Antigen-binding proteins with increased fcrn binding Download PDF

Info

Publication number
WO2013011076A2
WO2013011076A2 PCT/EP2012/064129 EP2012064129W WO2013011076A2 WO 2013011076 A2 WO2013011076 A2 WO 2013011076A2 EP 2012064129 W EP2012064129 W EP 2012064129W WO 2013011076 A2 WO2013011076 A2 WO 2013011076A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antigen binding
binding protein
substitution
variant
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2012/064129
Other languages
English (en)
French (fr)
Other versions
WO2013011076A3 (en
Inventor
Jonathan Henry Ellis
Michael J MOLLOY
Tejash SHAH
Ian M Tomlinson
Ahmed YASIN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Glaxo Group Ltd
Original Assignee
Glaxo Group Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=44586854&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2013011076(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to US13/988,400 priority Critical patent/US20130243764A1/en
Priority to ES12738101.0T priority patent/ES2600854T3/es
Priority to AU2012285786A priority patent/AU2012285786B2/en
Priority to NZ618897A priority patent/NZ618897B2/en
Priority to PH1/2014/500167A priority patent/PH12014500167A1/en
Priority to BR112014000341A priority patent/BR112014000341A2/pt
Priority to MX2014000739A priority patent/MX2014000739A/es
Priority to CA2841105A priority patent/CA2841105A1/en
Application filed by Glaxo Group Ltd filed Critical Glaxo Group Ltd
Priority to JP2014520658A priority patent/JP2014524748A/ja
Priority to EA201391789A priority patent/EA201391789A1/ru
Priority to CN201280034887.5A priority patent/CN103748110A/zh
Priority to KR1020147004161A priority patent/KR20140054085A/ko
Priority to EP12738101.0A priority patent/EP2734548B1/en
Publication of WO2013011076A2 publication Critical patent/WO2013011076A2/en
Publication of WO2013011076A3 publication Critical patent/WO2013011076A3/en
Priority to ZA2014/00062A priority patent/ZA201400062B/en
Anticipated expiration legal-status Critical
Priority to MA36748A priority patent/MA35345B1/fr
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/241Tumor Necrosis Factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • Antibodies are heteromultimeric glycoproteins comprising at least two heavy and two light chains. Aside from IgM, intact antibodies are usually heterotetrameric glycoproteins of approximately 150Kda, composed of two identical light (L) chains and two identical heavy (H) chains. Each heavy chain has at one end a variable domain (VH) followed by a number of constant regions. Each light chain has a variable domain (VL) and a constant region at its other end; the constant region of the light chain is aligned with the first constant region of the heavy chain and the light chain variable domain is aligned with the variable domain of the heavy chain.
  • VH variable domain
  • VL variable domain
  • human antibodies can be assigned to five different classes, IgA, IgD, IgE, IgG and IgM.
  • IgG and IgA can be further subdivided into subclasses, lgG1 , lgG2, lgG3 and lgG4; and lgA1 and lgA2.
  • the variable domain of the antibody confers binding specificity upon the antibody with certain regions displaying particular variability called complementarity determining regions (CDRs).
  • CDRs complementarity determining regions
  • the more conserved portions of the variable region are called Framework regions (FR).
  • the variable domains of intact heavy and light chains each comprise four FR connected by three CDRs.
  • the constant regions are not directly involved in the binding of the antibody to the antigen but exhibit various effector functions such as participation in antibody dependent cell- mediated cytotoxicity (ADCC), phagocytosis via binding to Fey receptor, half-life/clearance rate via neonatal Fc receptor (FcRn) and complement dependent cytotoxicity via the C1q component of the complement cascade.
  • ADCC antibody dependent cell- mediated cytotoxicity
  • FcRn neonatal Fc receptor
  • complement dependent cytotoxicity via the C1q component of the complement cascade.
  • the nature of the structure of an IgG antibody is such that there are two antigen-binding sites, both of which are specific for the same epitope. They are therefore, monospecific.
  • FcRn also known as the neonatal Fc receptor
  • IgG molecules are endocytosed by endothelial cells, and if they bind to FcRn, are recycled out into circulation.
  • IgG molecules that do not bind to FcRn enter the cells and are targeted to the lysosomal pathway where they are degraded.
  • the neonatal FcRn receptor is believed to be involved in both antibody clearance and the transcytosis across tissues (see Junghans R.P (1997) Immunol. Res 16. 29-57 and Ghetie et al (2000) Annu.Rev.lmmunol. 18, 739-766).
  • WO 9734631 discloses a composition comprising a mutant IgG molecule having increased serum half-life and at least one amino acid substitution in the Fc-hinge region. Amino acid substitution at one or more of the amino acids selected from number 252, 254, 256, 309, 31 1 or 315 in the CH2 domain or 433 or 434 in the CH3 domain is disclosed.
  • WO 00/42072 discloses a polypeptide comprising a variant Fc region with altered FcRn binding affinity, which polypeptide comprises an amino acid modification at any one or more of amino acid positions 238, 252, 253, 254, 255, 256, 265, 272, 286, 288, 303, 305, 307, 309, 31 1 , 312, 317, 340, 356, 360, 362, 376, 378, 380, 386,388, 400, 413, 415, 424,433, 434,435, 436, 439, and 447 of the Fc region.
  • WO 02/060919 discloses a modified IgG comprising an IgG constant domain comprising amino acid modifications at one or more of positions 251 , 253, 255, 285-290, 308-314, 385-389, and 428-435.
  • WO 2004035752 discloses a modified antibody of class IgG wherein at least one amino acid residue from the heavy chain constant region selected from the group consisting of amino acid residues 250, 314, and 428 is different from that present in an unmodified class IgG antibody.
  • Dall'Acqua et al. (2002, J Immunol. ; 169:5171-80) described random mutagenesis and screening of human lgG1 hinge-Fc fragment phage display libraries against mouse FcRn. They disclosed random mutagenesis of positions 251 , 252, 254-256, 308, 309, 31 1 , 312, 314, 385-387, 389, 428, 433, 434, and 436.
  • WO2006130834 discloses modified IgG comprising an IgG comprising an IgG constant domain comprising amino acid modifications at one or more positions of 252, 254, 256, 433, 434 and 436. Therefore, modification of Fc domains of IgG antibodies has been discussed as a means of increasing the serum half- life of therapeutic antibodies. However, numerous such modifications have been suggested with varying and sometimes contradictory results in different antibodies.
  • antigen binding proteins as therapeutics requires injections with a prescribed frequency relating to the clearance and half-life characteristics of the protein.
  • Adalimumab is a monoclonal antibody against TNF-alpha which is used for treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease. It is produced by recombinant DNA technology using a mammalian cell expression system. It consists of 330 amino acids and has a molecular weight of approximately 148 kilodaltons. See United States Patent 6090382.
  • clearance for adalimumab is said to range from 1 1 to 15 ml/hour, the distribution volume (V ss ) ranges from 5 to 6 litres and the mean terminal phase half-life was approximately two weeks (Summary of Product Characteristics available from www.medicines.org.uk). These half life and clearance properties mean that currently adalimumab needs to be administered once every two weeks. In some patients depending on disease it may be necessary to administer a loading dose such as for example in psoriasis patients. This dosage may differ from the maintenance dose.
  • the invention relates to an antigen binding protein which specifically binds to TNF- alpha comprising CDRH1 (SEQ ID NO: 27), CDRH2 (SEQ ID NO: 28), CDRH3 (SEQ ID No: 29), CDRL1 (SEQ ID NO: 30), CDRL2 (SEQ ID NO: 31 ), and CDRL3 (SEQ ID NO: 32) or variants thereof wherein said variants may contain 1 , 2, 3 or 4 amino acid substitutions, insertions or deletions as compared to CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, or CDRL3; and a neonatal Fc receptor (FcRn) binding portion of a human lgG1 constant domain comprising one of more amino acid substitutions relative to the human lgG1 constant domain, wherein the antigen binding protein has an increased FcRn binding affinity at pH 6 and/ or increased half-life as compared to an IgG comprising the light chain sequence of SEQ ID No. 2 and
  • human lgG1 constant domain encompasses all allotypes and variants thereof known to a person skilled in the art.
  • the invention relates to an antigen binding protein which specifically binds to TNF- alpha comprising CDRH1 (SEQ ID NO: 27), CDRH2 (SEQ ID NO: 28), CDRH3 (SEQ ID No: 29), CDRL1 (SEQ ID NO: 30), CDRL2 (SEQ ID NO: 31 ), and CDRL3 (SEQ ID NO: 32); or variants thereof wherein said variants may contain 1 , 2, 3 or 4 amino acid substitutions, insertions or deletions as compared to CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, or CDRL3; and a neonatal Fc receptor (FcRn) binding portion of a human lgG1 constant domain comprising one of more amino acid substitutions relative to the human lgG1 constant domain, wherein the antigen binding protein has an increased half life as compared to an IgG comprising the light chain sequence of SEQ ID No.
  • CDRH1 SEQ ID NO: 27
  • CDRH2 S
  • the invention relates to an antigen binding protein which specifically binds to TNF- alpha comprising CDRH1 (SEQ ID NO: 27), CDRH2 (SEQ ID NO: 28), CDRH3 (SEQ ID No: 29), CDRL1 (SEQ ID NO: 30), CDRL2 (SEQ ID NO: 31 ), and CDRL3 (SEQ ID NO: 32) or variants thereof wherein said variants may contain 1 , 2, 3 or 4 amino acid substitutions, insertions or deletions as compared to CDRH 1 , CDRH2, CDRH3, CDRL1 , CDRL2, or CDRL3; and an FcRn binding portion of a human lgG1 constant domain comprising one of more amino acid substitutions relative to the human lgG1 constant domain, wherein the antigen binding protein has an affinity for FcRn of 2 fold, or 3 fold, or 4 fold or 5 fold, or 6 fold or 8 fold or greater than an anti-TNF antigen binding protein with the same CDR's without such
  • the invention relates to an antigen binding protein which is a variant of an IgG comprising the light chain sequence of SEQ ID No. 2 and the heavy chain sequence of SEQ ID No.12, wherein the antigen binding protein variant comprises one or more substitutions in the neonatal Fc receptor (FcRn) binding portion of the IgG constant domain to increase the half-life of the antigen binding protein variant compared with the IgG without such substitutions , wherein when the variant is administered to patients at a single dose of 40 mg at a four to eight weekly interval, the mean steady-state trough concentration in the patient population does not fall below 4 g/ml or does not fall below 5 ⁇ ig /ml between dosing intervals.
  • FcRn neonatal Fc receptor
  • the mean serum trough antibody concentration in the patient population does not fall below 6 ⁇ ig /ml between dosing intervals.
  • the mean serum trough antibody concentration in the patient population does not fall below 5 ⁇ ig /ml between dosing intervals when the variant is administered to patients at a single dose of 40 mg at an eight weekly interval.
  • the mean serum trough antibody concentration in the patient population does not fall below 4 ⁇ ig /ml between dosing intervals whilst still providing the optimal efficacy when the variant is administered to patients at a single dose of 40 mg at an eight weekly interval.
  • the mean serum trough antibody concentration in the patient population does not fall below 3 ⁇ ig /ml between dosing intervals whilst still providing the optimal efficacy when the variant is administered to patients at a single dose of 40 mg at an eight weekly interval.
  • the invention relates to an antigen binding protein as disclosed herein for treatment of a disease wherein the antigen binding protein can be administered to patients no more than once every four weeks to achieve comparable mean steady-state trough concentration as that achieved by the same dose of an IgG comprising light chain sequence of SEQ ID No. 2 and heavy chain sequence of SEQ ID No.12 administered once every two weeks.
  • the invention relates to a method of treating a patient with a disease, the method comprising administering an antigen binding protein according to the invention.
  • the invention relates to a nucleic acid sequence encoding the antigen binding protein according to the invention, or a part thereof such as a heavy or light chain. In one aspect, the invention relates to an expression vector encoding the antigen binding protein according to the invention, or a part thereof such as a heavy or light chain. In one aspect, the invention relates to a host cell comprising the nucleic acid sequence encoding the antigen binding protein according to the invention. In one aspect, the invention relates to an antigen binding protein according to the invention for use in the treatment of Psoriasis or rheumatoid arthritis. In one aspect, the invention relates to a kit comprising the antigen binding protein according to the invention, and optionally comprising methotrexate for concomitant delivery of antigen binding protein according to the invention and methotrexate.
  • the invention relates to an antigen binding protein as disclosed herein for treatment of Rheumatoid arthritis in an individual who is already being treated with methotrexate, and to an antigen binding protein in combination with methotrexate for treatment of Rheumatoid arthritis, wherein the combination is delivered simultaneously, substantially simultaneously, or sequentially.
  • the invention relates to an antigen binding protein as disclosed herein for treatment of Psoriasis in an individual who is already being treated with methotrexate, and to an antigen binding protein in combination with methotrexate for treatment of Psoriasis, wherein the combination is delivered simultaneously, substantially simultaneously, or sequentially.
  • Figure 5 Analysis of anti-TNFa antibodies to FcyRllla receptors (a) Binding to human FcvRllla (valine 158 variant) (b) Binding to human FcyRIIIA (phenylalanine 158 variant)
  • Figure 6 Average dose normalised plasma concentrations of BPC2604 in female cynomolgus monkeys and pascolizumab in male cynomolgus monkeys following a single intravenous (1 hr infusion)
  • the invention relates to novel antigen binding proteins binding specifically to TNF-alpha.
  • the invention relates to novel variants of anti-TNF antibodies such as adalimumab which show increased binding to the FcRn receptor and/ or increased half life as compared to adalimumab.
  • Adalimumab is an IgG monoclonal antibody comprising the light chain sequence of SEQ ID No. 2 and heavy chain sequence of SEQ ID No.12.
  • the inventors have found that specific modifications to adalimumab as described herein show particular improvements in FcRn binding as shown in the examples below.
  • Affinity matured variants of adalimumab also show improvement in anti-TNF-alpha binding and/or neutralisation activity.
  • novel antigen binding proteins of the invention have an increased binding to the FcRn receptor and/ or increased half life and/ or increased Mean Residence Time and/ or decreased Clearance. It is considered that binding to FcRn results in longer serum retention in vivo. In order to increase the retention of the Fc proteins in vivo, the increase in binding affinity is observed around pH 6. In one aspect, the present invention therefore provides an antigen binding protein with optimised binding to FcRn.
  • the half-life of the antigen binding protein of the present invention is increased 2 to 6 fold, such as 2 fold, 3 fold, 4 fold, 5 fold or 6 fold as compared to an IgG comprising the light chain sequence of SEQ ID No. 2 and heavy chain sequence of SEQ ID No.12.
  • the half- life of the antigen binding protein of the invention is increased 3 fold, 4 fold, or more compared to an IgG comprising the light chain sequence of SEQ ID No. 2 and heavy chain sequence of SEQ ID No.12.
  • the IgG is adalimumab having a half life of 10 days or in the range of 10 to 20 days then in one embodiment an antigen binding protein of the present invention shows a half life of about 40 to 80 days.
  • an antigen binding protein comprising a heavy chain sequence selected from SEQ ID NO:5 or SEQ ID NO:9 or SEQ ID NO: 15 or SEQ ID NO: 18. or SEQ ID NO:21. or SEQ ID NO:24 or SEQ ID NO:163, or SEQ ID NO:165, or SEQ ID NO: 167, or SEQ ID NO: 169.
  • the antigen binding protein of the invention administered no more than once every four weeks in patients, achieves mean steady-state trough concentrations between about 2 g/ml to about 7 g/ml.
  • the mean steady-state trough concentrations are between about 4 Mg/ml to about 7 g/ml and more preferably between about 5 pg/ml to about 6 pg/ml.
  • the antigen binding protein of the invention administered no more than once every 28 days in patients, achieves mean steady-state trough concentrations between about 2 g/ml to about 7 Mg/ml.
  • the mean steady-state trough concentrations are between about 4 g/ml to about 7 Mg/ml and more preferably between about 5 pg/ml to about 6 Mg/ml.
  • the antigen binding protein of the invention can be administered once every 4, 5, 6, 7 or 8 weeks to achieve comparable mean steady-state trough concentrations as those achieved by adalimumab, when administered once every two weeks at the same dose.
  • the antigen binding protein of the invention can be administered once every 7 or 8 weeks.
  • the antigen binding protein of the invention can be administered once every 25-80 days for example once every 40-60 days, or for example once every 28, 35, 42, 49 or 56 days to achieve comparable mean steady-state trough concentrations as those achieved by adalimumab, when administered once every 14 days at the same dose.
  • the antigen binding protein can be administered once every 49 to 60 day, for example every 56 days.
  • the antigen binding protein has a 2 fold, or 4 fold, or 6 fold, or 8 fold or greater affinity for human FcRn at pH 6 as assessed by ProteOn XPR36 protein interaction array system at 25°C wherein the antibodies are immobilised on the chip.
  • the antigen binding protein has an affinity for human FcRn between about 100 to about 500 KD(nM), such as between about 130 to about 360 KD(nM) or between about 140 to about 250KD(nM) or between about 140 to about 210KD(nM).
  • the clearance of the antigen binding protein is about 2 to about 10 ml/hr, preferably about 2 to about 5ml/hr or 2 to 4ml/hr or 2 to 3ml/hr, such as about 2, about 2.5, 3, 4 or 5 ml/hr.
  • the antigen binding protein of the invention shows a clearance rate which is 2 fold, 3 fold, 4 fold or 5 fold lower than adalimumab.
  • clearance for an antigen binding protein according to the invention is in the ranges specified above or 2 fold, 3 fold, 4 fold or 5 fold lower than adalimumab at a human dose of about 40 mg.
  • the antigen binding protein of the invention is a variant of adalimumab (IgG comprising the light chain sequence of SEQ ID No. 2 and the heavy chain sequence of SEQ ID No.12), the variant comprising one or more substitutions in the FcRn binding portion of the IgG constant domain to increase the half-life of the variant compared with adalimumab, wherein when the variant is administered to patients at a single dose of 40 mg at a four to eight weekly interval, preferably eight weekly interval, the mean steady-state trough antibody concentration in the patient population does not fall below 5 ⁇ ig /ml. In one embodiment the mean steady-state trough antibody concentration in the patient population does not fall below 6 ⁇ ig /ml, between dosing intervals.
  • adalimumab IgG comprising the light chain sequence of SEQ ID No. 2 and the heavy chain sequence of SEQ ID No.12
  • the variant comprising one or more substitutions in the FcRn binding portion of the I
  • the antigen binding protein comprises at least one amino acid modification in the Fc region of said antigen binding protein, wherein said modification is at one or more of positions 250, 252, 254, 256, 257, 259, 308, 428 or 434 of the Fc region as compared to same position in the adalimumab sequence, wherein the numbering of the amino acids in the Fc region is that of the EU index in Kabat.
  • the wild type human lgG1 has amino acid residues Val-Leu-His-Gln-Asp-Trp-Leu at positions 308- 314, amino acid residues Leu-Met- lle-Ser-Arg-Thr at positions 251-256, amino acid residues Met- His-Glu-Ala-Leu-His-Asn-HisTyr at positions 428-436, and amino acid residues Gly-Gln-Pro-Glu-Asn at positions 385-389. Residue numbering may differ for lgG2-4.
  • the antigen binding protein of the invention comprises one or more amino acid substitution relative to the human lgG1 constant domain comprising the sequence of SEQ ID No. 13.
  • the one or more amino acid substitution in the FcRn binding portion of the human lgG1 heavy chain constant domain is at amino acid residues 252, 254 and 256 numbered according to EU index of Kabat and the aa substitution at residue 252 is a substitution of met with tyr, phe, tryp or thr; the aa substitution at residue 254 is a substitution of ser with thr; and the aa substitution at residue 256 is a substitution of thr with ser, arg, glu, asp or thr.
  • the aa substitution at residue 252 is a substitution with tyr; the aa substitution at residue 254 is a substitution with thr and the substitution at residue 256 is a substitution with glu.
  • the lgG1 constant domain is as shown in SEQ ID No: 7.
  • the one or more amino acid substitutions in the FcRn binding portion of the human lgG1 constant domain is at amino acid residues 250 and 428 numbered according to EU index of Kabat and the aa substitution at residue 250 is a substitution of thr with glu or gin; the aa substitution at residue 428 is a substitution of met with leu or phe.
  • the aa substitution at residue 250 is a substitution with glu and the aa substitution at residue 428 is a substitution with leu.
  • the lgG1 constant domain is as shown in SEQ ID No: 16.
  • the one or more amino acid substitution in the FcRn binding portion of the human lgG1 constant domain is at amino acid residues 428 and/ or 434 numbered according to EU index of Kabat.
  • the aa substitution at residue 428 is a substitution of met with leu and the aa substitution at residue 434 is a substitution of asn with ser.
  • the lgG1 constant domain is as shown in SEQ ID No: 10.
  • the one or more amino acid substitution in the FcRn binding portion of the human lgG1 constant domain is at amino acid residues 259 or 308 numbered according to EU index of Kabat.
  • the substitution at residue 259 is a substitution of val with ile and the aa substitution at residue 308 is a substitution of val with phe.
  • the lgG1 constant domain is as shown in SEQ ID No: 19 or SEQ ID No: 22.
  • the one or more amino acid substitution in the FcRn binding portion of the human lgG1 heavy chain constant domain is at amino acid residues 257 and 434 numbered according to EU index of Kabat as shown in SEQ ID No: 25. In one embodiment, the one or more amino acid substitution in the FcRn binding portion of the human lgG1 heavy chain constant domain is at amino acid residues 433 and 434 numbered according to EU index of Kabat for example the residues are H433K and N434F
  • the lgG1 constant domain is as shown in SEQ ID No: 165 or SEQ ID No: 167.
  • the antigen binding protein comprises any of the lgG1 constant domain modifications listed in Table A.
  • the antigen binding protein is an antibody.
  • the antigen binding protein comprises a variable domain of SEQ ID NO: 6 and/or SEQ ID NO: 3 or a variant thereof which contains 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions, insertions or deletions and/or shares at least 90% identity across the length of SEQ ID NO: 6 or SEQ ID NO: 3.
  • the antigen binding protein comprises the heavy chain sequence as shown in SEQ ID No 5, 9 or 15 optionally with a light chain sequence as shown in SEQ ID No: 2.
  • the antigen binding protein comprises a variable heavy domain sequence as shown in SEQ ID NO: 78 or 80. In one embodiment, the antigen binding protein comprises a heavy chain sequence as shown in SEQ ID NO: 145 or SEQ ID NO: 146 optionally with a light chain variant as shown in SEQ ID Nos. 148, 150 or 152.
  • the antigen binding protein comprises the heavy chain sequence as as shown in SEQ ID No 18 or 21 optionally with a light chain sequence as shown in SEQ ID No: 2.
  • the antigen binding protein according to the invention comprises any of the variable domains specified in Table A.
  • the antigen binding protein according to the invention comprises the variable heavy domain having the sequence of cb1-3-VH, cb2-44-VH, cb1-39-VH, cb1-31-VH, cb2-1 1-VH, cb2-40-VH, cb2-35-VH, cb2-28-VH, cb2-38-VH, cb2-20-VH, cb1- 8-VL or cb1-43-VL as shown in Table A.
  • the antigen binding protein according to the invention comprises the variable light domain having the sequence of cb1-45-VL, cb1-4-VL, cb1-41-VL, cb1-37-VL, cb1-39-VL, cb1-33-VL, cb1-35-VL, cb1-31-VL, cb1 -29-VL, cb1-22-VL, cb1-23-VL, cb1-12-VL, cb1-10-VL, cb2-1-VL, cb2-1 1- VL, cb2-40-VL, cb2-35-VL, cb2-28-VL, cb2-20-VL, cb1-3-VL, cb2-6-VL or cb2-44-VL as shown in Table A.
  • the antigen binding protein according to the invention comprises a variable domain having the sequence of cb1-3VH, cb2-44VH or cb2-6VL as shown in Table A.
  • the antigen binding protein according to the invention comprises any of the variable domains specified in Table A. In one embodiment, the antigen binding protein according to the invention comprises the variable heavy domain having a sequence selected from SEQ ID NO: 170 or SEQ ID NO: 174 or SEQ ID NO:178
  • the antigen binding protein according to the invention comprises the variable light domain having a sequence selected from SEQ ID NO: 171 or SEQ ID NO: 175 or SEQ ID NO: 179
  • the antigen binding protein comprises any of the lgG1 constant domain modifications listed in Table A. Variants of all the above mentioned variable domains or heavy chain sequences or light chain sequences which contain 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions, insertions or deletions and/or share at least 90% identity across the length of any of these sequences are also within the scope of the invention.
  • the antigen binding protein of the invention comprises a variant of CDRH3 (SEQ ID No: 29) which variant has 1 , 2, 3 or 4 amino acid substitutions as compared to SEQ ID No: 29.
  • the variant CDRH3 may have the sequence as shown in any one of SEQ ID Nos. 40 to 49.
  • the antigen binding protein of the invention comprises a variant of CDRH1 (SEQ ID No: 27) which variant has 1 or 2 amino acid substitutions as compared to SEQ ID No: 27.
  • the variant CDRH1 may have the sequence as shown in any one of SEQ ID Nos. 33 to 38.
  • the antigen binding protein of the invention comprises a variant of CDRL1 (SEQ ID No: 30) which variant has 1 , 2 or 3 amino acid substitutions as compared to SEQ ID No: 30.
  • the variant CDRL1 may have the sequence as shown in any one of SEQ ID Nos. 50 to 61.
  • the antigen binding protein of the invention comprises a variant of CDRL2 (SEQ ID No: 31 ) which variant has 1 , 2 or 3 amino acid substitutions as compared to SEQ ID No: 31.
  • the variant CDRL2 may have the sequence as shown in any one of SEQ ID Nos. 62 to 72.
  • the antigen binding protein of the invention comprises a variant of CDRL3 (SEQ ID No: 32) which variant has 1 , 2 or 3 amino acid substitutions as compared to SEQ ID No: 32.
  • the variant CDRL3 may have the sequence as shown in any one of SEQ ID Nos. 73 to 76.
  • the invention relates to an antigen binding protein which specifically binds to TNF-alpha comprising one or more or all CDRs selected from: CDRH1 (SEQ ID NO: 27), CDRH2 (SEQ ID NO: 28), CDRH3 (SEQ ID No: 29), CDRL1 (SEQ ID NO: 30), CDRL2 (SEQ ID NO: 31 ), and CDRL3 (SEQ ID NO: 32); wherein any of the CDRs could be a variant CDR which contains 1 , 2, 3 or 4 amino acid substitutions, insertions or deletions as compared to CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, or CDRL3.
  • CDRH1 SEQ ID NO: 27
  • CDRH2 SEQ ID NO: 28
  • CDRH3 SEQ ID No: 29
  • CDRL1 SEQ ID NO: 30
  • CDRL2 SEQ ID NO: 31
  • CDRL3 CDRL3
  • the antigen binding protein of the invention comprises CDRH1 , CDRH3, CDRL1 , CDRL2 and CDRL3 wherein any of the CDRs could be a variant CDR which contains 1 , 2, 3 or 4 amino acid substitutions, insertions or deletions compared to CDRH1 , CDRH3, CDRL1 , CDRL2, or CDRL3.
  • the antigen binding protein of the invention comprises CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2 and CDRL3 wherein any of the CDRs could be a variant CDR which contains 1 , 2, 3 or 4 amino acid substitutions, insertions or deletions compared to CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, or CDRL3
  • the invention relates to a method of treating a human patient with a disease, the method comprising administering an antigen binding protein according to the invention.
  • the invention also relates to an antigen binding protein as disclosed herein for the treatment of disease in a human.
  • the invention also relates to use of an antigen binding protein as disclosed herein in the manufacture of a medicament for the treatment of disease, and an antigen binding protein as disclosed herein for use in treatment of disease.
  • the disease to be treated by the antigen binding protein of the invention is rheumatoid arthritis, polyarticular juvenile idiopathic arthritis, psoriatic arthritis, ankylosing spondylitis, Ulcerative colitis, spondyloarthropathy, Crohn's disease or Psoriasis.
  • the antigen binding protein of the invention is to be administered with methotrexate.
  • the methotrexate can be delivered before, after or at the same time, or substantially the same time, as the antigen binding protein.
  • the antigen binding protein of the invention is to be administered with methotrexate to a patient suffering from rheumatoid arthritis.
  • methotrexate is administered to patients receiving an antigen binding protein of the invention to reduce the immunogenic effect of the antigen binding protein.
  • the antigen binding protein of the invention is administered to patients already receiving methotrexate.
  • Methotrexate may be substituted by another acceptable compound which reduced the immune response to the antigen binding protein, for example corticosteroids.
  • the invention relates to a method of treating a patient with a disease, the method comprising administering an antigen binding protein of the invention.
  • the method comprises administering an antigen binding protein to the patient as a single 20, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75 or 80 mg dose no more than once every four weeks, preferably once every 5, 6, 7, or 8 weeks and most preferably once every 8 weeks.
  • the dose is 40 to 80 mg, for example 40mg.
  • the invention also provides a polynucleotide sequence encoding any amino acid sequence disclosed herein, including a heavy chain of any of the antigen binding constructs described herein, and a polynucleotide encoding a light chain of any of the antigen binding constructs described herein.
  • polynucleotides represent the coding sequence which corresponds to the equivalent polypeptide sequences, however it will be understood that such polynucleotide sequences could be cloned into an expression vector along with a start codon, an appropriate signal sequence and a stop codon.
  • the polynucleotide may be DNA or RNA.
  • the invention also provides a host cell, for example a recombinant, transformed or transfected cell, comprising one or more polynucleotides encoding a heavy chain and/or a light chain of any of the antigen binding constructs described herein.
  • a host cell for example a recombinant, transformed or transfected cell, comprising one or more polynucleotides encoding a heavy chain and/or a light chain of any of the antigen binding constructs described herein.
  • the invention further provides a pharmaceutical composition comprising an antigen binding construct as described herein a pharmaceutically acceptable carrier.
  • the invention further provides a method for the production of any of the antigen binding constructs described herein which method comprises the step of culturing a host cell comprising a first and second vector, said first vector comprising a polynucleotide encoding a heavy chain of any of the antigen binding constructs described herein and said second vector comprising a polynucleotide encoding a light chain of any of the antigen binding constructs described herein, in a serum- free / chemically defined / animal derived component free culture media.
  • a method may comprise culturing a host cell comprising a vector comprising a polynucleotide encoding a heavy chain of any of the antigen binding constructs described herein and a polynucleotide encoding a light chain of any of the antigen binding constructs described herein, suitably in a serum- free / chemically defined / animal derived component free culture media.
  • the invention includes a method of increasing the half-life of an antibody by modifying an Fc according to the modifications described herein.
  • the invention includes an antigen binding protein as described herein with enhanced FcRn binding and having one or more additional substitutions, deletions or insertions that modulate another property of the effector function.
  • the antigen binding protein of the invention is then examined for in vitro activity by use of an appropriate assay.
  • Presently conventional ELISA and Biacore assay formats are employed to assess qualitative and quantitative binding of the antigen binding construct to its target. Additionally, other in vitro assays may also be used to verify neutralizing efficacy prior to subsequent human clinical studies performed to evaluate the persistence of the antigen binding protein in the body despite the usual clearance mechanisms.
  • the dose and duration of treatment relates to the relative duration of the molecules of the present invention in the human circulation, and can be adjusted by one of skill in the art depending upon the condition being treated and the general health of the patient based on the information provided herein. It is envisaged that repeated dosing (e.g. once every 4 weeks, 5 weeks, 6 weeks, 7 weeks or 8 weeks) over an extended time period (e.g. four to six months) maybe required to achieve maximal therapeutic efficacy.
  • the mode of administration of the therapeutic agent of the invention may be any suitable route which delivers the agent to the host.
  • the antigen binding proteins, and pharmaceutical compositions of the invention are particularly useful for parenteral administration, i.e., subcutaneously (s.c), intrathecally, intraperitoneally, intramuscularly (i.m.), intravenously (i.v.), or intranasally.
  • parenteral administration i.e., subcutaneously (s.c), intrathecally, intraperitoneally, intramuscularly (i.m.), intravenously (i.v.), or intranasally.
  • the antigen binding proteins and pharmaceutical compositions of the invention are administered via a subcutaneous auto injector pen or a subcutaneous pre-filled syringe.
  • Antigen binding proteins of the invention may be prepared as pharmaceutical compositions containing an effective amount of the antigen binding protein of the invention as an active ingredient in a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier preferably an aqueous carrier.
  • a variety of aqueous carriers may be employed, e.g., 0.9% saline, 0.3% glycine, and the like. These solutions may be made sterile and generally free of particulate matter.
  • compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, etc.
  • concentration of the antigen binding protein of the invention in such pharmaceutical formulation can vary widely, i.e., from less than about 0.5%, usually at or at least about 1 % to as much as 15 or 20% by weight and will be selected primarily based on fluid volumes, viscosities, etc., according to the particular mode of administration selected. It has been reported that adalimumab is difficult to formulate at high concentrations.
  • WO2004016286 describes an adalimumab formulation comprising a citrate-phosphate buffer and other components including a polyol and a detergent.
  • the oral presentation "Humira® - from Development to Commercial Scale Production" presented on 25 October 2005 at the PDA Conference reports formulations comprising (i) citrate-phosphate buffer; (ii) acetate-phosphate buffer; and (iii) phosphate buffer.
  • the acetate-phosphate buffer tested displayed the worst stabilising effect upon adalimumab. Curtis et al. (2008) Current Medical Research and Opinion, Volume 27, p71-78, report the incidence of injection-site burning and stinging in patients with rheumatoid arthritis using injectable adalimumab.
  • WO20100129469 describes a high adalimumab concentration formulation that still comprises a citrate-phosphate buffer and other components including a polyol with no sodium chloride.
  • WO2012065072 describes an adalimumab formulation comprising a surfactant and a polyol with no buffer, thus potentially avoiding any citrate buffer effects upon injection.
  • a liquid formulation comprising a TNF-alpha antigen binding protein and an acetate buffer.
  • the TNF-alpha binding protein comprises a CDRH1 selected from SEQ ID NO:27 or SEQ ID NO:'s 33-38 and/or a CDRH2 of SEQ ID NO:28 and/or a CDRH3 selected from SEQ ID NO:29 or SEQ ID NO:'s 40-49 and/or a CDRL1 selected from SEQ ID NO:30 or SEQ ID NO:'s 50-61 and/or a CDRL2 selected from SEQ ID NO:31 or SEQ ID NO:'s 62-72 and/or a CDRL3 of SEQ ID NO:32 or SEQ ID NO:'s73-76.
  • the TNF-alpha antigen binding protein comprises CDRH1 of SEQ ID NO:27 and CDRH2 of SEQ ID NO:28 and CDRH3 of SEQ ID NO:29 and CDRL1 of SEQ ID NO:30 and CDRL2 selected from SEQ ID NO:31 and a CDRL3 of SEQ ID NO:32 or variants thereof.
  • the TNF-alpha antigen binding protein may be adalimumab.
  • the TNF-alpha antigen binding protein may be BPC1494.
  • the TNF-alpha antigen binding protein may be BPC 1496.
  • the TNF-alpha antigen binding proteins described herein are formulated in an acetate buffer.
  • the formulation may be in liquid form.
  • the formulation may further comprise one or more, a combination, or all of: a surfactant; a chelator; a salt; and an amino acid.
  • the TNF-alpha antigen binding proteins are formulated at high concentrations, for example at 50 mg/mL.
  • the formulation does not comprise a polyol.
  • the formulation does not comprise a further buffer component, for example citrate.
  • the formulations described herein solve the problem of providing TNF-alpha antigen binding proteins, in particular the TNF-alpha antigen binding proteins as described in Table A, at high concentrations in a stable formulation, and avoid the burning and stinging effects of citrate-based buffers.
  • the acetate buffer formulation further comprises a surfactant and a chelator.
  • the acetate buffer formulation further comprises a surfactant and a salt.
  • the acetate buffer formulation further comprises a surfactant and an amino acid.
  • the acetate buffer formulation further comprises a chelator and a salt.
  • the acetate buffer formulation further comprises a chelator and an amino acid.
  • the acetate buffer formulation further comprises a salt and an amino acid.
  • the acetate buffer formulation further comprises a surfactant, a chelator, and a salt. In another embodiment, the acetate buffer formulation further comprises a surfactant, a chelator, and an amino acid. In another embodiment, the acetate buffer formulation further comprises a surfactant, a salt, and an amino acid. In another embodiment, the acetate buffer formulation further comprises a chelator, a salt, and an amino acid. In one embodiment, the buffer is sodium acetate trihydrate. This may be at a concentration of 10 to 100 mM sodium acetate trihydrate (1.361 to 13.61 mg/ml_).
  • Sodium acetate trihydrate may be present in an amount of 20 to 80 mM, 30 to 70 mM, 40 to 60 mM, or about 40mM, about 45mM, about 50mM, about 55mM, or about 60mM. In one embodiment, sodium acetate trihydrate is at a concentration of about 50mM (6.80mg/ml_).
  • the acetate buffer may be the sole buffer.
  • the formulation may not comprise another buffer component, such as phosphate or citrate buffer.
  • Citrate buffer may be detrimental to the formulation for a number of reasons: (i) it may not be a good buffer because the values of the three dissociation constants are too close to permit distinction of the three proton receptor phases; (ii) citrate may act as a metal chelator and thus influence metal ion balance: (iii) citrate is a metabolite of the citric acid cycle and has the potential to influence cellular metabolism.
  • Suitable surfactants may include, e.g., polysorbates (for example, polysorbate 20 or 80), polyoxyethylene alkyl ethers such as Brij 35.RTM., poloxamers (for example poloxamer 188, Poloxamer 407), Tween 20, Tween 80, Cremophor A25, Sympatens ALM/230, and Mirj.
  • the surfactant is polysorbate 80.
  • the formulation may comprise a concentration of 0.01 to 0.1 % polysorbate 80 (0.1 to 1 mg/ml_).
  • Polysorbate 80 may be present in an amount of 0.01 to 0.05%, or 0.01 to 0.03%; or about 0.015%, about 0.02%, or about 0.025%.
  • polysorbate 80 is at a concentration of about 0.02% w/v (0.2mg/ml_).
  • a high concentration of polysorbate 80 for example more than 0.1 %, may be detrimental to the formulation because this surfactant may contain high levels of oxidants which may increase levels of oxidation upon storage of the formulation and therefore reduce shelf life.
  • Suitable chelating agents may include EDTA and metal complexes (e.g. Zn-protein complexes). In one embodiment, the chelating agents is EDTA.
  • the formulation may comprise a concentration of 0.02 to 0.2 mM EDTA (0.00748 to 0.0748mg/ml_).
  • EDTA may be present in an amount of 0.02 to 0.15 mM, 0.02 to 0.1 mM, 0.03 to 0.08 mM, or 0.04 to 0.06 mM; or about 0.03 mM, about 0.04 mM, about 0.05 mM, or about 0.06 mM. In one embodiment, EDTA is at a concentration of about 0.05mM (0.018mg/ml_).
  • Suitable salts may include any salt-forming counterions, such as sodium.
  • sodium chloride may be used, or anionic acetate instead of chloride as a counterion in a sodium salt may be used.
  • the salt is sodium chloride.
  • the formulation may comprise a concentration of 25 to 100 mM sodium chloride (1.461 to 5.84mg/ml_).
  • Sodium chloride may be present in an amount of 35 to 90 mM, 45 to 80 mM, 25 to 70 mM, or 45 to 60mM; or 45mM, 46mM, 47mM, 48mM, 49mM, 50mM, 51 mM, 52mM, 53mM, 54mM, 55mM.
  • sodium chloride is at a concentration of about 51 mM (2.98mg/ml_).
  • Suitable amino acids may include arginine.
  • the formulation may comprise a concentration of 0.5 to 5% arginine free base (5 to 50mg/ml_). Arginine free base may be present in an amount of In other embodiments, the arginine free base may be between 0.5 to 4.0%, 0.5 to 3.5%, 0.5 to 3.0%, 0.5 to 2.5%, or about 0.5%, about 0.75%, about 1 %, about 1.5%, about 2%, or about 3%. In one embodiment, arginine is at a concentration of about 1 % (10mg/ml_).
  • a polyol is a substance with multiple hydroxyl groups, and includes sugars (reducing and non- reducing sugars), sugar alcohols and sugar acids.
  • examples of polyols include fructose, mannose, maltose, lactose, arabinose, xylose, ribose, rhamnose, galactose, glucose, sucrose, trehalose, sorbose, melezitose, raffinose, mannitol, xylitol, erythritol, threitol, sorbitol, glycerol, L-gluconate and metallic salts thereof.
  • the formulation of the invention does not comprise a polyol.
  • the acetate buffer formulation further comprises one or more, a combination, or all of: polysorbate 80, EDTA, sodium chloride, and arginine free base.
  • the pH of the formulation may be adjusted to pH 5.0 to 7.0.
  • acetic acid is present (about 100 mM acetic acid) to adjust the formulation to about pH 5.5.
  • the pH may be adjusted to pH 5.0, 5.5, 6.0, 6.5 or 7.0.
  • NaOH or HCI is used to adjust the pH to 5.0, 5.5, 6.0, 6.5 or 7.0.
  • the TNF-alpha antigen binding proteins described herein may be formulated in the concentration range of 20 to 300 mg/mL.
  • the antigen binding protein is present in a concentration of 20-200 mg/mL or 50-100 mg/mL; or about 40 mg/mL or about 45 mg/mL or about 50 mg/mL or about 55 mg/mL or about 60 mg/mL or about 70 mg/mL or about 80 mg/mL or about 90 mg/mL, or about 100mg/mL.
  • the TNF-alpha antigen binding protein is at a concentration of about 50 mg/mL.
  • the TNF-alpha antigen binding protein may be adalimumab.
  • the TNF-alpha antigen binding protein may be BPC1494.
  • the TNF-alpha antigen binding protein may be BPC 1496.
  • the formulation is stable for at least 1 year, at least 18 months, or at least 2 years.
  • the formulation is stable at a temperature of about 5°C for at least 1 year, at least 18 months, or at least 2 years.
  • the formulation is stable at room temperature (about 25°C).
  • the formulation is stable at a temperature of about 25°C for at least 14 weeks, at least 2 weeks, at least 1 week, at least 6 days, at least 5 days, at least 4 days, at least 3 days, at least 2 days or at least 1 day.
  • the formulation is stable at a temperature of about 40°C.
  • the formulation is stable at a temperature of about 40°C for at least 9 weeks or at least 4 weeks.
  • the formulations are stable at room temperature (about 25°C). Therefore, there is minimal risk of aggregates or low molecular weight fragments forming in pre-filled devices for injection that may be left at room temperature for more than the recommended time.
  • Aggregates are potentially immunogenic (see The AAPS Journal 2006; 8 (3) Article 59 Themed Issue: Proceedings of the 2005 AAPS Biotec Open Forum on Aggregation of Protein Therapeutics, Guest Editor - Steve Shire, Effects of Protein Aggregates: An Immunologic Perspective) and low molecular weight fragments may illicit pre-existing autoantibodies (see J Immunol 2008; 181 :3183- 3192; Human Anti-lgG1 Hinge Autoantibodies Reconstitute the Effector Functions of Proteolytically Inactivated IgGsl ).
  • a stable liquid formulation is a formulation having less than about 10%, or less than about 5% of the TNF-alpha antigen binding protein being present as aggregate in the formulation.
  • the formulation may have a monomer content of at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%.
  • the formulation may have a monomer content of at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% at room temperature (about 25°C) after about 2 weeks.
  • the formulation may have a monomer content of at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% at room temperature (about 25°C) after about 1 week.
  • the formulation may have a monomer content of at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% at room temperature (about 25°C) after about 1 day.
  • a pharmaceutical composition of the invention for injection could be prepared to contain 1 mL sterile buffered water, and between about 1 mg to about 100 mg, e.g. about 30 mg to about 100 mg or more preferably, about 35 mg to about 80mg, such as 40, 50, 80 or 90 mg of an antigen binding construct of the invention.
  • parenterally administrable compositions are well known or will be apparent to those skilled in the art and are described in more detail in, for example, Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pennsylvania.
  • For the preparation of intravenously administrable antigen binding construct formulations of the invention see Lasmar U and Parkins D "The formulation of Biopharmaceutical products", Pharma.
  • the antigen binding protein of the invention is provided or administered at a dose of about 40 mg.
  • the antigen binding protein is suitable for subcutaneous delivery and is delivered subcutaneously. Other dosing or administration routes may also be used, as disclosed herein.
  • the antigen binding proteins according to any aspect of the invention shows increased Mean Residence Time as compared to an IgG comprising the light chain sequence of SEQ ID No. 2 and heavy chain sequence of SEQ ID No.12.
  • modified IgGs and molecules comprising an IgG constant domain or FcRn binding portion thereof can be characterized by various in vitro assays.
  • PCT publication WO 97/34631 by Ward discloses various methods in detail.
  • the modified IgG or fragments thereof and the wild type IgG can be radio-labeled and reacted with FcRn-expressing cells in vitro. The radioactivity of the cell-bound fractions can be then counted and compared.
  • the cells expressing FcRn to be used for this assay are may be endothelial cell lines including mouse pulmonary capillary endothelial cells (B10, D2.PCE) derived from lungs of B10. DBA/2 mice and SV40 transformed endothelial cells (SVEC) (Kim et al., J Immunol., 40: 457-465, 1994) derived from C3H/HeJ mice.
  • SVEC SV40 transformed endothelial cells
  • other types of cells which express sufficient number of FcRn including mammalian cells which express recombinant FcRn of a species of choice, can be also used.
  • the bound molecules can be then extracted with the detergent, and the percent release per unit number of cells can be calculated and compared.
  • Affinity of antigen binding proteins of the inventions for FcRn can be measured by surface plasmon resonance (SPR) measurement using, for example, a BIAcore 2000 (BIAcore Inc.) as described previously (Popov et al., Mol. Immunol., 33: 493-502, 1996; Karlsson et al., J Immunol. Methods, 145: 229-240, 1991 , both of which are incorporated by reference in their entireties).
  • SPR surface plasmon resonance
  • CM5 chip by Pharmacia g., CM5 chip by Pharmacia
  • the binding of modified IgG to the immobilized FcRn is measured at a certain flow rate to obtain sensorgrams using BIA evaluation 2.1 software, based on which on-and off-rates of the modified IgG, constant domains, or fragments thereof, to FcRn can be calculated.
  • Relative affinities of antigen binding proteins of the invention and unmodified IgG for FcRn can be also measured by a simple competition binding assay.
  • affinities of modified IgGs or fragments thereof, and the wild type IgG for FcRn can be also measured by a saturation study and the Scatchard analysis.
  • Transfer of modified IgG or fragments thereof across the cell by FcRn can be measured by in vitro transfer assay using radiolabeled IgG or fragments thereof and FcRn- expressing cells and comparing the radioactivity of the one side of the cell monolayer with that of the other side.
  • transfer can be measured in vivo by feeding 10-to 14-day old suckling mice with radiolabeled, modified IgG and periodically counting the radioactivity in blood samples which indicates the transfer of the IgG through the intestine to the circulation (or any other target tissue, e. g., the lungs).
  • the clearance curve thus obtained should be biphasic.
  • the clearance rate in ⁇ -phase is calculated and compared with that of the unmodified IgG.
  • Antigen binding proteins of the invention may be assayed for the ability to immunospecifically bind to an antigen. Such an assay may be performed in solution (e. g., Houghten, BiolTechniques, 13: 412- 421 , 1992), on beads (Lam, Nature, 354: 82-84, 1991 , on chips (Fodor, Nature, 364: 555-556, 1993), on bacteria (U. S. Patent No. 5,223,409), on spores (U. S. Patent Nos.
  • the antigen binding proteins of the invention may be assayed for immunospecific binding to an antigen and cross-reactivity with other antigens by any method known in the art.
  • Immunoassays which can be used to analyze immunospecific binding and cross-reactivity include, but are not limited to, competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few.
  • BIAcore kinetic analysis is used to determine the binding on and off rates of antibodies to an antigen.
  • BIAcore kinetic analysis comprises analyzing the binding and dissociation of an antigen from chips with immobilized antibodies on their surface.
  • Antigen binding protein includes reference to antibodies, antibody fragments and other protein constructs, which are capable of binding to TNF- alpha.
  • Antibody is used herein in the broadest sense and includes reference to molecules with an immunoglobulin-like domain and includes monoclonal, recombinant, polyclonal, chimeric, humanised, bispecific and heteroconjugate antibodies.
  • Human lgG1 heavy chain constant domain refers to human amino acid sequence for the lgG1 heavy chain constant domain that is found in nature, including allelic variations.
  • “Half-life (t1/2)” refers to the time required for the concentration of the antigen binding polypeptide to reach half of its original value.
  • the serum half-life of proteins can be measured by pharmacokinetic studies according to the method described by Kim et al. (Eur. J. of Immuno. 24: 542, 1994). According to this method, radiolabeled protein is injected intravenously into mice and its plasma concentration is periodically measured as a function of time, for example, at about 3 minutes to about 72 hours after the injection.
  • MRT Mobile Residence Time
  • Stepss is the concentration reached when the drug elimination rate becomes equal to drug administration rate as a result of continued drug administration. Css fluctuates between peak and trough levels and is measured in microgram/ml. "Mean steady-state trough concentration” refers to the mean of the trough level across the patient population at a given time.
  • Comparable mean steady-state trough concentration refers to mean steady-state trough concentration which is the same or within about 10% to 30% of the stated value. Comparable mean steady-state trough concentration for the antigen binding polypeptides of the invention may be considered to be those mean steady-state trough concentrations that are 0.8 to 1.25 times the mean steady-state trough concentration achieved with an IgG comprising the light chain sequence of SEQ ID No. 2 and the heavy chain sequence of SEQ ID No. 12.
  • Half lives and AUC can be determined from a curve of serum concentration of drug (for example the antigen binding polypeptide of the present invention) against time.
  • Half life may be determined through compartmental or non-compartmental analysis.
  • the WINNONLINTM analysis package (available from Pharsight Corp., Mountain View, CA94040, USA) can be used, for example, to model the curve.
  • "half life” refers to the terminal half life.
  • Specifically binds The term "specifically binds" as used throughout the present specification in relation to antigen binding proteins means that the antigen binding protein binds to TNF-alpha with no or insignificant binding to other unrelated proteins. The term however does not exclude the fact that the antigen binding proteins may also be cross-reactive with closely related molecules.
  • CDRs are defined as the complementarity determining region amino acid sequences of an antigen binding protein. These are the hypervariable regions of immunoglobulin heavy and light chains. There are three heavy chain and three light chain CDRs (or CDR regions) in the variable portion of an immunoglobulin. Thus, “CDRs” as used herein refers to all three heavy chain CDRs, all three light chain CDRs, all heavy and light chain CDRs, or at least two CDRs.
  • % identity of variants indicates the degree of identity between two nucleic acid or two amino acid sequences when optimally aligned and compared with appropriate insertions or deletions.
  • the variants described herein may have 90, 91 , 92, 93, 94, 95, 96, 97, 98, or 99% identity to the native CDR or variable domain sequences at the amino acid level.
  • the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.
  • such open ended terms also comprise within their scope a restricted or closed definition, for example such as “consisting essentially of", or “consisting of”.
  • compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
  • Example 1 Cloning of antibody expression vectors
  • the DNA expression constructs encoding the variable heavy (VH) and variable light (VL) domains of an anti-TNFa antibody were previously prepared de novo and included restriction sites for cloning into mammalian expression vectors.
  • Both heavy and light chain variable domain sequences were sequence optimised for expression in mammalian cells (for methodology see WO2009024567 and Kotsopoulou et al, J Biotechnol (2010) 146: 186-193). Information describing the heavy and light chain variable region sequences can be found in US patent US6090382. To generate the constructs used in this study, the variable heavy domain (VH) sequences were amplified using PCR.
  • the PCR primers contained Hindi II and Spel restriction sites to frame the VH domain containing the signal sequence for cloning into a pTT mammalian expression vectors containing the human ⁇ 1 constant region.
  • the VL domain sequence was amplified by PCR using primers containing Hindlll and BsiWI restriction sites to facilitate cloning into a pTT mammalian expression vector containing the human kappa constant region.
  • the heavy chain expression plasmid was given the code SJC322 and the light chain expression plasmid was given the plasmid code SJC321.
  • DNA expression constructs encoding alternative variable heavy and light chain regions of anti-TNFa antibodies with modifications in the CDR regions were prepared de novo by build up of overlapping oligonucleotides and similar molecular biology techniques to those described above.
  • the resulting plasmids encoding the heavy and light chains of variants cb1-3, cb2-6 and cb2-44 are described in Table 1.
  • a PCR fragment encoding the VH domain of an anti-TNFa antibody was generated using a previously constructed, codon optimised vector as a template. The resulting fragment was cloned using Hindlll and Spel into a pTT expression vector containing the modified human ⁇ 1 constant region described in the preceding paragraph.
  • the plasmid encoding the heavy chain of the anti-TNFa antibody with the M252Y/S254T/T256E modification was designated SJC324.
  • the plasmid encoding the heavy chain with the T250Q/M428L modification was designated SJC323.
  • Plasmid SJC326 encodes the anti-TNFa heavy chain containing the M428L/N434S modification in the human ⁇ 1 constant region.
  • Plasmid SJC328 encodes the anti-TNFa heavy chain containing the V308F modification in the human ⁇ 1 constant region.
  • Example 3 Expression of antibodies in HEK2936E cells using pTT5 episomal vectors
  • Expression plasmids encoding the heavy and light chains described above were transiently co- transfected into HEK 293 6E cells. Expressed antibody was purified from the supernatant by affinity chromatography using a 1 ml HiTrap Protein A column (GE Healthcare). Table 1 below shows the list of antibodies produced.
  • Some antibodies were also expressed in CHO cells using a different set of expression vectors. See Examples 13, 14 and 15 for a description of the molecular biology, expression and purification.
  • Example 4 Binding of antibodies to tumour necrosis factor alpha in a direct binding ELISA
  • a binding ELISA was carried out to test the binding of the expressed antibodies purified using protein A to recombinant tumour necrosis factor alpha (TNFa).
  • ELISA plates were coated with recombinant human TNFa at O.l g/ml and blocked with blocking solution (4% BSA.
  • Various dilutions of the purified antibody were added (diluted in 4% BSA in T Tris-buffered saline at pH8.0 containing 0.05% Tween 20) and the plate was incubated for 1 hour at room temperature before washing in deionised water.
  • Binding was detected by the addition of a peroxidase labelled anti human kappa light chain antibody (Sigma A7164) in blocking solution. The plate was incubated for 1 hour at room temperature before washing in deionised water. The plate was developed by addition of OPD substrate (Sigma P9187) and colour development stopped by addition of 2M HCI. Absorbance was measured at 490nm with a plate reader and the mean absorbance plotted against concentration. The results are shown in Figure 1 and confirm that all the antibodies have a similar profile.
  • This assay was used to test the neutralising ability of the antibodies to neutralise TNF-a and inhibit cell death. Briefly, L929 cells were seeded in a 96-well flat-bottomed plate at 10,000/well in 100 ⁇ RPMI 1640 (w/o phenol red) and incubated overnight at 37°C, 5% C0 2 . Cells were sensitised with 1.25Mg/ml actinomycin D for 1 hour. For the neutralising study, 0.001-60Mg/ml (0.0067- 400 nM) anti- TNF-a mAb was pre-incubated with approx. 2ng/ml (approximately 0.05nM) TNF-a in a 1 : 1 ratio for 1 hour at room temperature.
  • RPMI phosphatidylcholine
  • 20 ⁇ of antibody-antigen complex was added per well.
  • 10ul media alone was added to wells as a negative control. Plates were incubated at 18 hour at 37°C, 5% C0 2 .
  • cell viability was determined by a cell titer-Glo Luminescent assay kit according to manufacturer's instructions (Promega, Madison USA).
  • L929 assay the percentage cell viability of the unknowns was expressed as a percentage of the untreated group (taken as a 100%) and IC50 values were determined by Graphpad prism.
  • Table 2 IC 50 values for various anti-TNFa antibodies in an L929 neutralisation assay
  • Table 3 shows the IC50 values derived from the experiment. The results indicate that the improved anti-TNFa antibodies (BPC1499, BPC1500, BPC1501 ) show increased potency in this assay compared to BPC1492 and adalimumab. Table 3: IC 50 values for improved anti-TNFa antibodies in an L929 neutralisation assay
  • Example 6 Effect of antibodies on in vitro IL-6 release The neutralising ability of antibodies was determined by measuring their effect on inhibiting TNF-a mediated IL-6 release from whole blood cells. Briefly, 130 ⁇ _ of whole blood was added to each well and plates were incubated at 37°C in a humidified 5% C0 2 incubator for 1 hour. For the neutralising study, 0.001-30Mg/ml (0.0067- 200 nM) TNF-a mAb was pre-incubated with 10ng/ml (approx. 0.4 nM) TNF-alpha in a 1 : 1 ratio for 1 hour at 4°C. For control group, RPMI was used in place of the antibody.
  • the MSD signal for each sample was read using a MSD SECTOR® Imager 2400 and IL-6 release from the cells was quantified using a standard data analysis package in PRISM 4.00 software (GraphPad. San Diego, USA).
  • the percentage of IL-6 inhibition by each antibody was expressed as a percentage of the TNF-a alone treated group.
  • dose response curves were obtained for each antibody and IC50 values were determined.
  • Table 4 IC 50 values for various anti-TNF antibodies in a TNFa-induced IL-6 release assay Antibody IC freshness. value (nM)
  • the IC50 values are shown in Table 5. The results indicate that the improved anti-TNFa antibodies (BPC1499, BPC1500, BPC1501 ) show increased potency in this assay.
  • Table 5 IC 50 values for various improved anti-TNF antibodies in a TNFa-induced IL-6 release assay
  • Example 7 Accelerated stressor studies Prior to the study, antibodies to be tested were quantified on a spectrophotometer at OD280nm and diluted to 1.1 mg ml in PBS (pH7.4). An aliquot was removed and 10%v/v of 500mM sodium acetate was added to give a final concentration of1 mg/ml at pH5.5 and the sample inspected for precipitation. The remaining sample in PBS had 10% PBS v/v added to a final concentration of 1 mg/ml at pH7.4 and an aliquot of this sample was removed to provide a baseline aggregation level (as monitored by size exclusion chromatography).
  • the samples were then incubated at 37°C for two weeks in an incubator, after which the samples were re-quantified on a spectrophotometer at OD280nm and assessed (by size exclusion chromatography) for aggregation.
  • the samples were tested for human TNFa binding in a direct binding ELISA. The results are shown in Figure 2 and confirm that the binding activity of all antibodies tested is comparable following the accelerated stressor study.
  • Antibody samples were diluted to 1 mg/ml in a buffer containing 50mM Acetate and 150mM NaCI (pH6.0), snap-frozen in dry ice and then thawed at 4°C overnight. Binding of the antibodies to human TNFa was tested in comparison to an antibody which had not been snap-frozen.
  • ELISA plates were coated with recombinant human TNFa at I pg/ml and blocked with blocking solution (4% BSA in Tris buffered saline). Various concentrations were added to the coated plates and incubated for 1 hour at room temperature before washing in deionised water.
  • Binding was detected by the addition of a peroxidase labelled anti human kappa light chain antibody (Sigma A7164) in blocking solution. The plate was incubated for 1 hour at room temperature before washing in deionised water. The plate was developed by addition of OPD substrate (Sigma P9187) and colour development stopped by addition of 2M HCL. Absorbance was measured at 490nm with a plate reader and the mean absorbance plotted against concentration. The results are shown in Figure 4 and confirm that the binding activity of all antibodies tested is comparable following freeze-thaw.
  • ELISA plates were coated with recombinant human FcyRllla (V158 and F158 variants) at 1 g/ml and blocked with blocking solution (4% BSA in Tris buffered saline). Various concentrations were added to the coated plates and incubated for 1 hour at room temperature before washing in deionised water. Binding was detected by the addition of a peroxidase labelled anti human kappa light chain antibody (Sigma A7164) in blocking solution. The plate was incubated for 1 hour at room temperature before washing in deionised water. The plate was developed by addition of OPD substrate (Sigma P9187) and colour development stopped by addition of 2M HCI.
  • OPD substrate Sigma P9187
  • Antibodies for testing were immobilised to similar levels on a GLC biosensor chip (BioRad 176-501 1 ) by primary amine coupling.
  • Recombinant human and cynomolgus FcRn were used as analytes at 2048nM, 512nM, 128nM, 32nM, and 8nM, an injection of buffer alone (i.e. OnM) was used to double reference the binding curves.
  • Regeneration of the antibody surface following FcRn injection used HBS-N at pH9.0, the assay was run on the ProteOn XPR36 Protein Interaction Array System at 25°C and run in HBS-N pH7.4 and HBS-N pH6.0 with the FcRn diluted in appropriate buffer.
  • Example 12 PK studies in human FcRn transgenic mice.
  • BPC1494 and BPC1492 were administered intravenously (IV) at 1 mg/kg to two different strains of FcRn humanised mice and one strain deficient in FcRn (Petkova et al. Int. Immunol (2010) 18(12): 1759-1769). Plasma samples were analyzed for BPC1494 or BPC1492, as appropriate, using a validated Gyrolab fluorescent immunoassay.
  • the methods used biotinylated human TNF alpha as the capture antigen and an Alexa labelled anti- human IgG (Fc specific) antibody as the detection antibody.
  • LLQ lower limit of quantification
  • HLQ higher limit of quantification
  • Plasma concentrations below the lowest standards were considered to be not quantifiable.
  • PK analysis was performed by non-compartmental pharmacokinetic analysis using WinNonLin, version 6.1. All computations utilised the nominal blood sampling times.
  • the systemic exposure to BPC1494 and BPC1492 was determined by calculating the area under the plasma concentration time curve (AUC) from the start of dosing until the last quantifiable time point (AUC 0 -t) using the linear log trapezoidal calculation method. Further PK parameters could not be derived from the data due discrepancies in sample labelling.
  • Strain 1 mFcRn-/- hFcRn (32) Tg/Tg
  • the DNA encoding the expression cassettes for the heavy and light chains were excised from the vectors described in Example 3 using Hindlll and EcoRI and cloned into pEF vectors, where expression occurs from the hEF1 a promoter, using standard molecular biology techniques (for description of vectors see Kotsopoulou et al J. Biotechnol (2010) 146: 186-193).
  • Example 14 Expression of antibodies in CHO cells using pEF expression vectors
  • Expression plasmids encoding heavy and light chains were co-transfected into CHO DG44 cells and expressed at scale to produce antibody.
  • BPC1492 plasmids SJC329 and SJC330 were used.
  • BPC1494 plasmids SJC329 and SJC331 were used.
  • BPC1496 plasmids SJC329 and SJC332 were used.
  • the contents of the three cuvettes (300 ⁇ ) of electroporated cells were added to 10ml of warmed MR14 medium (including nucleosides and BSA) and incubated in a T75 flask for 48 hours. Following this period, the medium was changed to nucleoside-free-MR14 (MR14 containing only BSA)). Every 3-4 days, conditioned medium was removed and replaced with fresh selection medium. Once cells had undergone recovery, the medium was substituted to 2X MR14 and IgG expression was confirmed by nephlometry. 2L shake-flasks were seeded with 1 L of the IgG-expressing cells at 0.6X10 6 /ml and grown for 7 days. Cells were separated from supernatant by centrifugation and the supernatant was used for protein purification.
  • Example 15 Alternative method for expression of antibodies in CHO cells using pEF expression vectors
  • DHFR-null CHO DG44 cells were obtained from Dr. Chasin of Columbia University. These cells were subsequently adapted to a chemically defined medium. These adapted host cells were designated DG44-C and are cultured in proprietary chemically defined medium supplemented with Glutamax and HT-supplement.
  • DG44-C cells were transfected with plasmids encoding the heavy and light chains and DHFR and neoR respectively by electroporation (using the Amaxa nucleofector system). At 48 hours post transfection, selection was initiated by addition of G418 (at a final concentration of 400 g/ml) and removal of HT. When viability and cell counts increased sufficiently (in this case 2 months post transfection) methotrexate (MTX) was added at a final concentration of 5nM.
  • methotrexate methotrexate
  • Antibodies were purified at room temperature using a two step chromatographic procedure: Initial capture was performed using a 50ml MabSelect SuRe column (GE Healthcare) followed by Size Exclusion Chromatography (SEC) with a 1.5L Superdex 200 pg SEC (GE Healthcare). The conditioned media was loaded onto a pre-equilibrated MabSelect SuRe column at a flow rate of 9cm/h. Following washing to base line with equilibration buffer (50mm Tris pH 8.0, 2M NaCI) the column was washed with a low salt buffer buffer (50mM NaCI Tris pH 8.0, 150mM NaCI) until conductivity was stable. The column was then eluted with elution buffer (25mM Citrate pH 2.5).
  • equilibration buffer 50mm Tris pH 8.0, 2M NaCI
  • Antibodies prepared by this method were used for analytical comparability studies summarised in the following example.
  • Size exclusion chromatography was carried out to determine the aggregation levels of the protein.
  • the optimised method involved injection of the sample onto a TOSOH TSK G3000SWXL column which had been equilibrated in 100 mM sodium phosphate, 400 mM NaCI, pH 6.8. Absorbance was measured at both 280nm and 214nm. Reverse-phase HPLC separates proteins and their isoforms based on hydrophobicity. Protein was injected onto a PLRP-S 1000 °A 8 ⁇ column and eluted using a gradient produced by 50%Formic acid, and 95% Acetonitrile. Absorbance was measured at 280nm.
  • the purity of the molecule is reported as a percentage of the main peak area relative to the total peak area.
  • Different isoforms of the mAb were separated on the basis of their pi values using capillary isoelectric focussing (clEF). IEF separation was performed on a 10cm, UV280 transparent cartridge capillary.
  • the optimised method involved a solution containing 5% pH 3-10 ampholytes, 10mM NaOH, protein of interest and internal pi markers (7.05 and 9.5) which was loaded into the capillary by pressure injection.
  • the specific activity of antibodies was determined using MSD.
  • 96-well plates were coated with 50 ⁇ _ per well TNFa diluted to 1 ⁇ g/mL in PBS. The plate was incubated on the bench top at ambient temperature without shaking for 2 hours. The coating solution was removed and the plate was blocked with 50 ⁇ _ per well of 1 % BSA in PBS, with 0.05% Polysorbate 20. The plate was incubated for 1 hour at 24°C with shaking at 400 rpm and then washed 4 times with wash buffer. The antibodies were diluted in 0.1 % BSA in PBS with 0.05% Polysorbate 20 and 30 ⁇ of each sample was added to the plate.
  • the plate was incubated for 1 hour at 24°C with shaking at 400 rpm. The plate was then washed 4 times with wash buffer. Anti-human IgG sulfotag was diluted 1 in 5000 in assay buffer. 30 ⁇ _ was added to each well of the plate and then incubated for 1.5 hour at 24°C, with shaking at 400 rpm. The plate was then washed 4 times with wash buffer. The 4x MSD Read Buffer concentrate was diluted to 1x using deionised water. 100 ⁇ _ was then added per well of the plate. The plate was then read using the MSD Sector Imager instrument. From the signals obtained from the assay, specific activities of the molecules were calculated.
  • Deamidation is a common post-translational modification that can occur to asparagine and glutamine residues, but is most commonly observed with asparagine residues, particularly when adjacent to a glycine residue.
  • adalimumab, BPC1494 and BPC1496 were exposed to a stress study. The stress was carried out by incubation in 1 % ammonium bicarbonate at pH 9.0, for 48 hrs, conditions which have previously been shown to cause deamidation.
  • the stressed samples were incubated alongside a control (in PBS) and were compared to this as well as an unstressed reference and analysed using c-IEF, SEC and Binding ELISA. Forced deamidation was also done on all samples in the presence and absence of EDTA. It has been shown previously that forced deamidation conditions cause fragmentation in addition to deamidation. EDTA prevents and or minimizes the fragmentation.
  • Oxidation analysis Oxidation of various residues can occur throughout the processing and storage of proteins; however the most commonly oxidised residue is methionine, which was the focus of this screen. Oxidation susceptibility of these residues was examined through exposure to stress conditions by incubation in 5mM and 50 mM H 2 0 2 for 30minut.es and evaluated using RP-HPLC, SEC and ELISA.
  • Antibodies BPC1499, 1500 and 1501 were assessed for binding activity by ELISA as described in Example 4. Using two different antigen coating concentrations (0.1 and 1.0 pg/ml), the antibodies did not show any difference in their binding profile when compared with BPC1492. Under the conditions tested, it appears that the ELISA does not discriminate between antibodies with different reported binding activities. The same antibodies were assessed using methodologies described in Examples 18, 5 and 6 which are considered more sensitive assays. In these assays, antibodies BPC1499, 1500 and 1501 show improved binding affinity and improved potency when compared with BPC1492.
  • Example 18 Biacore Analysis of TNF alpha binding using a Capture surface
  • Protein A and anti-human IgG were coupled on separate flow cells on a CM3 biosensor chip. These surfaces were used to capture the antibodies for binding analysis. Recombinant human and cynomolgus TNF alpha were used as analytes at 64nM, 21.33nM, 7.1 1 nM, 2.37nM, 0.79nM, an injection of buffer alone (i.e. OnM) used to double reference the binding curves. Regeneration of the capture surface was carried out using 100mM phosphoric acid and 3M MgCI 2 . The run was carried out on the Biacore T100 machine at 37°C using HBS-EP as running buffer. The constructs BPC1494 and BPC1496 showed reduced binding to Protein A and the anti-human IgG surface making these surfaces unsuitable for generating kinetics for those molecules.
  • Biotinylated TNF alpha was mixed with biotinylated BSA at a 1 :49 ratio, at a final total protein concentration of 20 g/ml (i.e. 0.4 g biotinylated TNF alpha and 19.6 g biotinylated BSA).
  • This mixture was captured on a NLC biosensor chip (a single flowcell) (Biorad 176-5021 ).
  • the chip surface was conditioned with 10mM glycine pH3.0 till a stable signal was achieved.
  • the antibodies to be tested were used as analytes at 256nM, 64nM, 16nM, 4nM and 1 nM and OnM. The binding curves were referenced against a flowcell coated with biotinylated BSA alone.
  • This data is one set of two experiments which were carried out (second set not shown).
  • the KD ranking of the data is representative of both data sets.
  • Example 20 Construction of alternative antibodies which bind to human TNFa
  • the DNA expression constructs encoding additional variable heavy regions with modifications in the CDR regions were prepared de novo by build up of overlapping oligonucleotides and similar molecular biology techniques to those described in Example 1. Examples of DNA sequences encoding the variable heavy domains of these variant antibodies are given in SED IQ NO: 81 , 83, 85, 87, 89, 91 , 93 and 95.
  • the DNA expression constructs encoding additional variable light domain regions with modifications in the CDR regions (as described in Rajpal et al.
  • Example 21 Construction of expression vectors for BPC2604 (Pascolizumab-YTE)
  • the pTT-based DNA expression constructs encoding the heavy chain of pascolizumab was engineered to include the following changes M252Y/S254T/T256E (EU index numbering) using the Quikchange protocol (Promega).
  • Example 22 Expression/purification of Pasco and Pasco-YTE vectors
  • Expression plasmids encoding the heavy and light chains of BPC2604 were transiently co-transfected into HEK 293 6E cells. Expressed antibody was purified from the bulk supernatant using a two step purification carried out by affinity chromatography and SEC using a 5ml MabSelectSure column and Superdex 200 column on an AKTA Xpress.
  • Example 23 BIAcore analysis of Pasco vs. Pasco YTE for FcRn binding Antibodies were immobilised on a GLM chip (20 g/ml in acetate pH4.5) by primary amine coupling. Human, cynomolgus, rat and mouse FcRn receptors used at 2048, 512, 128, 32 and 8nM. OnM used for double referencing. Assay were carried out in HBS-EP pH7.4 and HBS-EP pH6.0 (FcRn receptor diluted in appropriate running buffer for each pH. The surface was regenerated for FcRn binding with 200mM Tris pH9.0. Data was fitted to an equilibrium model, with R-max set to highest R-max obtained of any construct. The results are shown in Table 1 1 below and confirm that the YTE- modified pascolizumab (BPC2604) shows improved binding to FcRn at pH6.0 compared to pascolizumab.
  • Figure 6 shows the average dose normalised plasma concentrations of pascolizumab- YTE (BPC2604)J in female cynomolgus monkeys and pascolizumab in male cynomolgus monkeys following a single intravenous (1 hr infusion) administration at a target dose of 1 mg/kg.
  • the data for BPC2604 and pascolizumab were generated in separate studies.
  • Plasma antibody concentrations for pascolizumab and BPC2604 were assessed by chemi-luminescence ELISA using IL-4 as the capture reagent and anti-human IgG (Fc specific)-HRP conjugate as the detection reagent.
  • the validated range for the assay was 50-5000 ng/mL.
  • Both compounds had similar Cmax but BPC2604 had a 3-fold lower plasma clearance resulting in 3-fold increase in AUC and 2-fold increase in half-life (T1 ⁇ 2).
  • Formulation 'A' (citrate-phosphate buffer) is the marketed adalimumab formulation made up of 6.16 mg/ml Sodium chloride + 0.30 mg/ml Sodium citrate monobasic + 1.30 mg/mL Citric acid monohydrate + 12 mg/ml Mannitol + 0.86mg/ml_ Monobasic sodium phosphate dihydrate + 1.53mg/ml_ Dibasic sodium phosphate dihydrate + 1.0 mg/ml PS80 at pH 5.2.
  • Formulation 'B' (acetate buffer) is composed of 6.81 mg/mL (50mM) Sodium Acetate trihydrate + 10mg/ml_ (1 % w/v) Arginine + 0.0186mg/ml_ (0.05mM) EDTA + 2.98mg/ml_ (51 mM) Sodium Chloride + 0.2mg/ml_ (0.02% w/v) Polysorbate 80, adjusted to pH 5.5 using HCI or NaOH.
  • TNF-alpha variant BPC1494 material used in this study was made in a Chinese Hamster Ovary (CHO DG44) cell line and purified using a two step process involving mAb Select Sure followed by Superdex column 200pg.
  • Adalimumab (Product code NDC 0074-3799-02, Lot number 91073LX40) manufactured by Abbott Laboratories was used.
  • Adalimumab was re-formulated into Formulation 'B' by overnight dialysis at 5°C using a 10KDa Slide - A - Lyzer cassette (Product Number 66830, Lot Number LJ150514); produced by Thermo Scientific (Rockford, IL ;USA). This experiment was carried out at a different time point to the other three formulations. Both Adalimumab in Formulations 'A' and 'B' were diluted to 5mg/mL using their respective formulation buffers. The TNF-alpha variant BPC1494 molecule was also formulated in Formulations A and B at ⁇ 5mg/mL.
  • This method separates soluble protein molecules in the solution based on size and not molecular weight.
  • small molecules will penetrate every small pore of the stationary phase and hence will elute later.
  • the chromatogram obtained enables the determination of percentage area of aggregates, monomer and low molecular weight (MW) fragments.
  • MW molecular weight
  • Increased stability corresponds to a high percentage of monomeric species (Mono) together with a low percentage of Total Aggregates (TA) and Total Low Molecular weight Fragments (TLMWF).
  • TNF-alpha variant BPC1494 was relatively more stable in formulation 'B' compared to formulation A after storage at 25 ° C and 40 ° C for 14 weeks. Furthermore, TNF-alpha variant BPC1494 was relatively more stable, or at least as stable as adalimumab in formulation A. The results for adalimumab in formulation B are all within 5% TA and/or TLMWF. Therefore, formulation B has advantages over formulation A for both TNF-alpha variant BPC1494 and adalimumab.
  • Table 12 shows that after storage at 25 ° C for 8 weeks, TNF-alpha variant BPC1494 in formulation A has 2.3% TLMWF while formulation B produced only 1.5%. Furthermore, TNF-alpha variant BPC1494 in formulation B was relatively more stable than adalimumab in formulation A (1.8% TLMWF). Similarly, at the 14 week time point at 25 ° C, 3.15% TLMWF was observed for TNF-alpha variant BPC1494 in formulation 'A' compared to 2.3% TLMWF in formulation ' ⁇ '. Furthermore, TNF- alpha variant BPC1494 in 'B' was relatively more stable than adalimumab in formulation A (3.4% TLMWF).
  • results for Total Aggregate show that at 14 weeks at 25 ° C, the TNF-alpha variant BPC1494 was relatively more stable in 'B' (0.3%) than in 'A' (0.5%); and relatively more stable than adalimumab in formulation A (0.4%).
  • Capillary Iso-Electric Focusing c-IEF
  • %AMI % area of main isoform
  • adalimumab is relatively more stable in formulation 'B' than in formulation 'A' (see Week 4 data). For example, increased changes in charge heterogeneity (i.e. increase in number of peaks) were observed for adalimumab incubated for up to 4 weeks at 40°C in formulation 'A' compared to formulation 'B' (8 peaks and 6 peaks respectively). TNF-alpha variant BPC1494 showed a more consistent charge heterogeneity of 5 peaks at all timepoints and temperatures.
  • formulation 'B' can serve as an alternative to formulation ⁇ in a clinical setting without compromising the stability of the protein and potentially eliminating the pain associated with the marketed adalimumab formulation (A).
  • this data shows that not only does the acetate formulation (B) improve the stability of the TNF-alpha variant BPC1494 compared to the citrate-phosphate formulation (A); but the acetate formulation is comparable or slightly better than the citrate-phosphate formulation when stabilising adalimumab.
  • Table 12 SEC-HPLC of adalimumab and TNF-alpha variant BPC1494 in Formulation 'A' and 'B' at 5 ° C, 25 C and 40 ° C.
  • TLMWF Total Low Molecular Weight Fragment; Mono: Monomer; TA: Total Aggregate.
  • N 2
  • NT Not Tested; pi R: Pi Range; pMI: pi of Main Isoform; % AMI: % Area Main Isoform; NoP: Number of Peaks.
  • adalimumab and TNF-alpha variant BPC1494 at 5mg/ml_ in formulation 'B' can serve as an alternative to formulation ⁇ .
  • This example is focused on comparing the stability of adalimumab in its marketed formulation 'A' compared to formulation 'B' and other TNF-alpha variants at 50mg/ml.
  • TNF-alpha variant BPC1494 Two samples of TNF-alpha variant BPC1494 were analysed, one expressed in CHO DG44 cells and one expressed in CHOK1 cells. A second TNF-alpha variant BPC1496 was made in a CHO-DG44 cell line. All three samples were expressed and purified using mAb Select Sure. In contrast to Example 25, no Superdex column step was carried out. Adalimumab (Product code N 00515-01 , Lot number 02136XH12) manufactured by Abbott Laboratories, as in Example 25.
  • Adalimumab was formulated in formulations 'A' (as purchased) and 'B' (by buffer exchange) as described above in Example 25, and the TNF-alpha variants (BPC1494 and 1496) were formulated in 'B', all at ⁇ 50mg/mL (total of 5 samples).
  • the samples were filtered with MillexGV 0.22um filter under clean laminar flow conditions before being transferred into labelled pre- sterilized glass vials and incubated at 5 ° C and 40 ° C for up to 9 weeks. At selected time-points, samples were taken and analysed using SEC-HPLC (Table 14), clEF (Table 15). Other assays as described below were also carried out.
  • Protein concentration was measured using a nanodrop spectrometer, which is indicative of protein stability. There was no significant difference in the results after 9 weeks storage at 5 ° C and 40 ° C.
  • table 13 shows that after 9 week storage, the percentage change in total low molecular weight fragment (TLMWF) in formulation 'B' was between 3.82-4.96% compared to 6.08% in formulation TV. Similarly, the monomer percentage change in formulation 'A' was greater for adalimumab than for 'B' (7.54 and 4.52% respectively).
  • the TNF-alpha variants in 'B' were all relatively at least as stable or more stable as adalimumab in formulation 'A' (% change at Week 9). The results at week 4 for all samples are within the 5% TA and/or TLMWF allowance for a commercial product. Therefore, 'B' has advantages over 'A' for both TNF-alpha variants and adalimumab at 50 mg/ml.
  • the TNF-alpha variant BCP1496 showed a low TLMWF value of 3.86 at Week 9 at 40°C.
  • Formulation B shows a reduced % change of %AMI at week 9 for adalimumab as compared to Formulation A ( 23.53 and 27.57 respectively).
  • the TNF-alpha variants in 'B' are more stable in terms of charge heterogeneity (i.e. increase in number of peaks) than adalimumab (in both 'A' and 'B'). For example, at Week 9 there were 5 and 6 peaks for each of the variants; and 6 and 9 peaks for adalimumab, at 5°C and 40°C respectively.
  • the relatively higher % change in %AMI at week 9 for the TNF-alpha variant BCP1496 (CHO DG44) of 38.13 may be due to the relatively high initial %AMI of 75.03.
  • the biological activity of adalimumab and the TNF-alpha variants in the two formulations was assessed by Biacore. Over the 9 week period of storage at 5 ° C and 40 ° C, the samples showed the same %binding within assay variability.
  • formulation 'B' can serve as an alternative to formulation 'A' in a clinical setting without compromising the stability of the antibody at 50mg/mL dosage strength.
  • Table 14 SEC-HPLC of adalimumab and TNF-alpha variants BPC1494 and 1496 in Formulations 'A' and 'B' at 5 ° C, 25 C and 40 C.
  • TLMWF Total Lo Molecular Weight Fragment; Mono - Monomer; TA - Total Aggregate.
  • N 2
  • TNF-alpha variant BPC14 4 (CHO D 44
  • TNF-alpha variant BPC 1494 (CHOK 1 ) in fnrmiilatinn ' ⁇ '
  • NT Not Tested; pi R - Pi Range; pMI - pi of Main Isoform; % AMI - % Area Main Isoform; NoP - Number of Peaks.
  • Example 27 Plasma concentrations of BPC1494 following subcutaneous administration in the male cynomolgus monkey
  • BPC1494 was administered sub-cutaneously weekly or biweekly for 4 weeks at 30 or 100 mg/kg to male cynomolgus monkeys.
  • group 2 the animals were administered 2x 30mg/kg doses on day 1 (approximately 1 hour apart) followed by a single 30 mg/kg dose on days 8, 15 and 22.
  • group 3 the animals were administered with 2x 30mg/kg doses on day 1 (approximately 1 hour apart) followed by a single 30 mg/kg dose on day 15.
  • mice were administered with 2x 100mg/kg doses on day 1 (approximately 1 hour apart) followed by a single 100 mg/kg dose on day 15. Plasma samples were taken at intervals throughout the dosing and recovery phases of the study.
  • the method used 10 pg/ml biotinylated recombinant human TNF-alpha as the capture antigen and a 1 :100 dilution of AlexaFluor 647-labelled anti-human IgG (Fc specific) antibody as the detection antibody (G18-145).
  • Gyrolab Workstation Version 5.2.0 Gyrolab Companion version 1.0
  • SMS2000 version 2.3 PK analysis was performed by non-compartmental pharmacokinetic analysis using WinNonlin Enterprise Pheonix version 6.1.
  • Pharmacokinetic data is presented in Table 16 with parameters determined from last dose received on Week 4 to the time point (t) 840 hours post dosing for 30 mg/kg/week dose group (2) and last dose received on Week 3 to the time point (t)1008 hours post dosing for 30 & 100 mg/kg/biweekly dose groups (3 and 4).
  • CI_F and Vz_F are estimates due to elimination phase following multiple doses and steady state not yet achieved. Parameter estimates have been calculated from i) using AUC0- 168 or 336, ii) extrapolation of data from week 1 based on half-life and iii) using total dose over the defined sampling with AUCO-inf
  • Protein L was immobilised on a GLM chip (BioRad, Cat No: 176-5012) by primary amine coupling. This surface was then used to capture the humanised antibodies, human and cyno FcRn (both in- house materials) was then used as analytes at 2048nM, 512nM, 128nM, 32nM, and 8nM, an injection of buffer alone (i.e. OnM) used to double reference the binding curves. Regeneration of the protein L surface was carried out using Glycine-HCI pH1.5.
  • the assay was run at 25°C and run in HBS-EP pH7.4 and HBS-EP pH6.0 with human or cynomolgus FcRn diluted in appropriate buffer. Affinities were calculated using the Equilibrium model, inherent to the ProteOn analysis software, using a "Global R-max" for binding at pH6.0 and the R-max from binding at pH6.0 for affinity calculation at pH7.4. Since the binding curves did not reach saturation at pH7.4, the values obtained are unlikely to be true affinities however were used to rank the binding of the antibodies tested.
  • VL Anti-TNF antibody variable domain
  • VH Anti-TNF antibody heavy variable domain
  • Anti-TNF antibody heavy chain wild-type lgG1 ) 1 1 12 lgG1 constant domain (wild-type) - 13
  • SEQ ID NO: 2 Protein sequence of the anti-TNF antibody light chain
  • SEQ ID NO: 4 Polynucleotide sequence of the anti-TNF antibody heavy chain plus M252Y/S254T/T256E modification
  • SEQ ID NO: 7 Protein sequence of the lgG1 constant domain plus M252Y/S254T/T256E modification
  • SEQ ID NO: 8 Polynucleotide sequence of the anti-TNF antibody heavy chain plus M428L/N434S modification
  • SEQ ID NO: 1 Polynucleotide sequence of the anti-TNF antibody heavy chain (wild-type lgG1 ) GAGGTGCAGCTGGTGGAGTCTGGCGGCGGACTGGTGCAGCCCGGCAGAAGCCTGAGACT
  • SEQ ID NO: 12 Protein sequence of the anti-TNF antibody heavy chain (wild-type lgG1 )
  • SEQ ID NO: 16 Protein sequence of the lgG1 constant domain plus T250Q/M428L modification
  • SEQ ID NO: 18 Protein sequence of the anti-TNF antibody heavy chain plus V308F modification
  • SEQ ID NO: 23 Polynucleotide sequence of the anti-TNF antibody heavy chain plus P257L and N434Y variant
  • SEQ ID NO: 24 Protein sequence of the anti-TNF antibody heavy chain plus P257L and N434Y modification EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYAD
  • SEQ ID NO: 25 Protein sequence of the lgG1 constant domains plus P257L and N434Y modification
  • SEQ ID NO: 26 Signal peptide sequence
  • SEQ ID NO: 78 Protein sequence of anti-TNF antibody variable heavy domain variant cb1-3-VH (aka cb2-6-VH)
  • SEQ ID NO: 80 Protein sequence of anti-TNF antibody variable heavy domain variant cb2-44-VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDDHALHWVRQAPGKGLEWVSAITWNSGHIDYADS VEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVRYLSTASSLDYWGQGTLVTVSS
  • SEQ ID NO: 82 Protein sequence of anti-TNF antibody variable heavy domain variant cb1-39-VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDHYALHWVRQAPGKGLEWVSAITWNSGHIDYADS VEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSS
  • SEQ ID NO: 84 Protein sequence of anti-TNF antibody variable heavy domain variant cb1-31-VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYAD SVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVHYLSTASQLHHWGQGTLVTVSS
  • SEQ ID NO: 85 Polynucleotide sequence of anti-TNF antibody variable heavy domain variant cb2-1 1-VH
  • SEQ ID NO: 86 Protein sequence of anti-TNF antibody variable heavy domain variant cb2-1 1-VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDHYAMHWVRQAPGKGLEWVSAITWNSGHIDYAD SVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVQYLSTASSLQSWGQGTLVTVSS SEQ ID NO: 87 Polynucleotide sequence of anti-TNF antibody variable heavy domain variant cb2-40-VH
  • SEQ ID NO: 88 Protein sequence of anti-TNF antibody variable heavy domain variant cb2-40-VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDQYAMHWVRQAPGKGLEWVSAITWNSGHIDYAD SVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVKYLSTASSLHYWGQGTLVTVSS
  • SEQ ID NO: 90 Protein sequence of anti-TNF antibody variable heavy domain variant cb2-35-VH
  • SEQ ID NO: 94 Protein sequence of anti-TNF antibody variable heavy domain variant cb2-38-VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDQHAMHWVRQAPGKGLEWVSAITWNSGHIDYAD SVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSS
  • SEQ ID NO: 96 Protein sequence of anti-TNF antibody variable heavy domain variant cb2-20-VH EVQLVESGGGLVQPGRSLRLSCAASGFTFDQYAMHWVRQAPGKGLEWVSAITWNSGHIDYAD SVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVKYLSTASNLESWGQGTLVTVSS
  • SEQ ID NO: 104 Protein sequence of anti-TNF antibody variable light domain variant cb1-4-VL
  • GSGTDFTLTISSLQPEDVATYYCQRYDRPPYTFGQGTKVEIKRT SEQ ID NO: 105
  • SEQ ID NO: 1 Protein sequence of anti-TNF antibody variable light domain variant cb1-39-VL
  • SEQ ID NO: 1 11 Polynucleotide sequence of anti-TNF antibody variable light domain variant cb1- 33-VL GATATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCTCTGTGGGCGATAGAGTGACCA
  • SEQ ID NO: 1 12 Protein sequence of anti-TNF antibody variable light domain variant cb1-33-VL
  • SEQ ID NO: 1 13 Polynucleotide sequence of anti-TNF antibody variable light domain variant cb1- 35-VL
  • SEQ ID NO: 1 Protein sequence of anti-TNF antibody variable light domain variant cb1-35-VL DIQMTQSPSSLSASVGDRVTITCHASRRLRNYLAWYQQKPGKAPKLLIYAASSLQPGVPSRFSG SGSGTDFTLTISSLQPEDVATYYCQRYDRPPYTFGQGTKVEIKRT
  • SEQ ID NO: 1 15 Polynucleotide sequence of anti-TNF antibody variable light domain variant cb1- 31 -VL
  • SEQ ID NO: 1 Protein sequence of anti-TNF antibody variable light domain variant cb1-31-VL
  • SEQ ID NO: 1 17 Polynucleotide sequence of anti-TNF antibody variable light domain variant cb1- 29-VL GATATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCTCTGTGGGCGATAGAGTGACCA
  • SEQ ID NO: 1 Protein sequence of anti-TNF antibody variable light domain variant cb1-29-VL
  • SEQ ID NO: 1 19 Polynucleotide sequence of anti-TNF antibody variable light domain variant cb1-
  • SEQ ID NO: 124 Protein sequence of anti-TNF antibody variable light domain variant cb1-12-VL DIQMTQSPSSLSASVGDRVTITCHASRKLRNYLAWYQQKPGKAPKLLIYAASSLQQGVPSRFSG SGSGTDFTLTISSLQPEDVATYYCQRYDRPPYTFGQGTKVEIKRT

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Rheumatology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Pain & Pain Management (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/EP2012/064129 2011-07-19 2012-07-19 Antigen-binding proteins with increased fcrn binding Ceased WO2013011076A2 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
EP12738101.0A EP2734548B1 (en) 2011-07-19 2012-07-19 Tnf-alpha-antigen-binding proteins against with increased fcrn binding for use in therapy
ES12738101.0T ES2600854T3 (es) 2011-07-19 2012-07-19 Proteínas de unión a antígeno de TNF-alfa con unión a FcRn incrementada para su uso en terapia
AU2012285786A AU2012285786B2 (en) 2011-07-19 2012-07-19 TNF -alpha antigen- binding proteins with increased FcRn binding
NZ618897A NZ618897B2 (en) 2011-07-19 2012-07-19 Tnf-alpha antigen-binding proteins with increased fcrn binding
PH1/2014/500167A PH12014500167A1 (en) 2011-07-19 2012-07-19 Tnf-alpha antigen-binding proteins with increased fcrn binding
BR112014000341A BR112014000341A2 (pt) 2011-07-19 2012-07-19 proteína de ligação ao antígeno, método para tratamento de um paciente com uma doença, uso de uma proteína de ligação ao antígeno, ácido nucleico, e, célula hospedeira
MX2014000739A MX2014000739A (es) 2011-07-19 2012-07-19 Proteinas de union a antigeno de tnf-alfa con union a fcrn incrementada.
CA2841105A CA2841105A1 (en) 2011-07-19 2012-07-19 Antigen-binding proteins with increased fcrn binding
JP2014520658A JP2014524748A (ja) 2011-07-19 2012-07-19 FcRn結合の増加したTNF−α抗原結合タンパク質
US13/988,400 US20130243764A1 (en) 2011-07-19 2012-07-19 Antigen-binding proteins with increased fcrn binding
KR1020147004161A KR20140054085A (ko) 2011-07-19 2012-07-19 증가된 fcrn 결합을 갖는 tnf-알파 항원-결합 단백질
CN201280034887.5A CN103748110A (zh) 2011-07-19 2012-07-19 具有增加的FcRn结合的抗原结合蛋白
EA201391789A EA201391789A1 (ru) 2011-07-19 2012-07-19 TNF-АЛЬФА АНТИГЕНСВЯЗЫВАЮЩИЕ БЕЛКИ, ОБЛАДАЮЩИЕ ПОВЫШЕННЫМ СВЯЗЫВАНИЕМ FcRn
ZA2014/00062A ZA201400062B (en) 2011-07-19 2014-01-06 Tnf-alpha antigen-binding proteins with increased fcrn binding
MA36748A MA35345B1 (fr) 2011-07-19 2014-02-12 Proteines de liaisons a un antigene ayant une liaison accrue a fcrn

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1112429.4 2011-07-19
GBGB1112429.4A GB201112429D0 (en) 2011-07-19 2011-07-19 Antigen-binding proteins with increased FcRn binding

Publications (2)

Publication Number Publication Date
WO2013011076A2 true WO2013011076A2 (en) 2013-01-24
WO2013011076A3 WO2013011076A3 (en) 2013-04-04

Family

ID=44586854

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2012/064129 Ceased WO2013011076A2 (en) 2011-07-19 2012-07-19 Antigen-binding proteins with increased fcrn binding

Country Status (22)

Country Link
US (1) US20130243764A1 (https=)
EP (2) EP2734548B1 (https=)
JP (1) JP2014524748A (https=)
KR (1) KR20140054085A (https=)
CN (1) CN103748110A (https=)
AU (1) AU2012285786B2 (https=)
BR (1) BR112014000341A2 (https=)
CA (1) CA2841105A1 (https=)
CL (1) CL2014000134A1 (https=)
CO (1) CO6862106A2 (https=)
CR (1) CR20140029A (https=)
DO (1) DOP2014000007A (https=)
EA (1) EA201391789A1 (https=)
ES (1) ES2600854T3 (https=)
GB (1) GB201112429D0 (https=)
MA (1) MA35345B1 (https=)
MX (1) MX2014000739A (https=)
PE (1) PE20141660A1 (https=)
PH (1) PH12014500167A1 (https=)
SG (1) SG10201601154QA (https=)
WO (1) WO2013011076A2 (https=)
ZA (1) ZA201400062B (https=)

Cited By (54)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013158275A1 (en) * 2012-04-20 2013-10-24 Abbvie Inc. Cell culture methods to reduce acidic species
FR2999431A1 (fr) * 2012-12-17 2014-06-20 Lfb Biotechnologies Utilisation d'anticorps monoclonaux pour le traitement de l'inflammation et d'infections bacteriennes
WO2014096672A1 (fr) * 2012-12-17 2014-06-26 Laboratoire Francais Du Fractionnement Et Des Biotechnologies Utilisation d'anticorps monoclonaux pour le traitement de l'inflammation et d'infections bacteriennes
WO2014158231A1 (en) * 2013-03-14 2014-10-02 Abbvie Inc. Low acidic species compositions and methods for producing and using the same
US8921526B2 (en) 2013-03-14 2014-12-30 Abbvie, Inc. Mutated anti-TNFα antibodies and methods of their use
WO2015007912A1 (en) * 2013-07-19 2015-01-22 Hexal Ag Methods and formulations which allow the modulation of immune responses related to the administration of a biopharmaceutical drug
US8946395B1 (en) 2013-10-18 2015-02-03 Abbvie Inc. Purification of proteins using hydrophobic interaction chromatography
US9017687B1 (en) 2013-10-18 2015-04-28 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same using displacement chromatography
EP2863951A1 (en) * 2012-06-12 2015-04-29 Boehringer Ingelheim International GmbH Pharmaceutical formulation for a therapeutic antibody
US9062106B2 (en) 2011-04-27 2015-06-23 Abbvie Inc. Methods for controlling the galactosylation profile of recombinantly-expressed proteins
US9067990B2 (en) 2013-03-14 2015-06-30 Abbvie, Inc. Protein purification using displacement chromatography
US9085618B2 (en) 2013-10-18 2015-07-21 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same
US9150645B2 (en) 2012-04-20 2015-10-06 Abbvie, Inc. Cell culture methods to reduce acidic species
US9181572B2 (en) 2012-04-20 2015-11-10 Abbvie, Inc. Methods to modulate lysine variant distribution
US9181337B2 (en) 2013-10-18 2015-11-10 Abbvie, Inc. Modulated lysine variant species compositions and methods for producing and using the same
US9193787B2 (en) 2012-04-20 2015-11-24 Abbvie Inc. Human antibodies that bind human TNF-alpha and methods of preparing the same
EP2946765A1 (en) * 2014-05-23 2015-11-25 Ares Trading S.A. Liquid pharmaceutical composition
US9206390B2 (en) 2012-09-02 2015-12-08 Abbvie, Inc. Methods to control protein heterogeneity
US9234033B2 (en) 2012-09-02 2016-01-12 Abbvie, Inc. Methods to control protein heterogeneity
US9249182B2 (en) 2012-05-24 2016-02-02 Abbvie, Inc. Purification of antibodies using hydrophobic interaction chromatography
WO2016066688A1 (en) * 2014-10-28 2016-05-06 Richter Gedeon Nyrt. Pharmaceutical anti-tnf-alpha antibody formulation
WO2016120413A1 (en) * 2015-01-28 2016-08-04 Mabxience S.A. Pharmaceutical formulations for anti-tnf-alpha antibodies
JP2016535085A (ja) * 2013-10-16 2016-11-10 オンコバイオロジクス,インコーポレイティド 抗体安定性を増強する緩衝液製剤
US9499614B2 (en) 2013-03-14 2016-11-22 Abbvie Inc. Methods for modulating protein glycosylation profiles of recombinant protein therapeutics using monosaccharides and oligosaccharides
WO2016189491A1 (en) * 2015-05-28 2016-12-01 Glaxosmithkline Intellectual Property Development Limited Novel formulation
US9546212B2 (en) 2001-06-08 2017-01-17 Abbvie Biotechnology Ltd. Methods of administering anti-TNFα antibodies
US9550826B2 (en) 2013-11-15 2017-01-24 Abbvie Inc. Glycoengineered binding protein compositions
US9598667B2 (en) 2013-10-04 2017-03-21 Abbvie Inc. Use of metal ions for modulation of protein glycosylation profiles of recombinant proteins
JP2017528132A (ja) * 2014-09-03 2017-09-28 ベーリンガー・インゲルハイム・インターナショナル・ゲーエムベーハー Il−23a及びtnf−アルファを標的とする化合物ならびにその使用
WO2018073387A1 (en) * 2016-10-20 2018-04-26 Sanofi Anti-chikv antibodies and uses thereof
EP2822591B1 (en) 2012-03-07 2018-05-02 Cadila Healthcare Limited Pharmaceutical formulations of tnf-alpha antibodies
EP3372242A1 (en) * 2017-03-06 2018-09-12 Ares Trading S.A. Liquid pharmaceutical composition
US10155039B2 (en) 2012-09-07 2018-12-18 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
WO2019147973A1 (en) * 2018-01-26 2019-08-01 Genzyme Corporation Fc variants with enhanced binding to fcrn and prolonged half-life
US10426833B2 (en) 2014-05-23 2019-10-01 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
US10493152B2 (en) 2014-05-23 2019-12-03 Fresenius Kabi Deutschland Gmbh Adalimumab formulations
EP3569224A4 (en) * 2017-01-11 2019-12-25 Celltrion Inc. STABLE LIQUID FORMULA
US10570198B2 (en) 2010-10-22 2020-02-25 Novartis Ag Stable and soluble antibodies
US10696735B2 (en) 2015-01-21 2020-06-30 Outlook Therapeutics, Inc. Modulation of charge variants in a monoclonal antibody composition
US11071782B2 (en) 2016-04-20 2021-07-27 Coherus Biosciences, Inc. Method of filling a container with no headspace
US11091542B2 (en) 2015-12-18 2021-08-17 UCB Biopharma SRL Antibody molecules which bind TNF alpha
US11229702B1 (en) 2015-10-28 2022-01-25 Coherus Biosciences, Inc. High concentration formulations of adalimumab
US11285210B2 (en) 2016-02-03 2022-03-29 Outlook Therapeutics, Inc. Buffer formulations for enhanced antibody stability
US11319383B2 (en) 2016-03-14 2022-05-03 Universitetet | Oslo Engineered immunoglobulins with altered FcRn binding
US11534403B2 (en) 2017-03-06 2022-12-27 Arecor Limited Liquid pharmaceutical composition
US11608357B2 (en) 2018-08-28 2023-03-21 Arecor Limited Stabilized antibody protein solutions
RU2795592C2 (ru) * 2018-01-26 2023-05-05 Джензим Корпорейшн Варианты fc с повышенным связыванием с fcrn и пролонгированным периодом полувыведения
US11858980B2 (en) 2016-08-02 2024-01-02 Visterra, Inc. Engineered polypeptides and uses thereof
US12168697B2 (en) 2015-12-25 2024-12-17 Chugai Seiyaku Kabushiki Kaisha Bispecific antibodies which bind blood coagulation factor VIII and have enhanced activity, and methods of use thereof for treating bleeding and associated conditions
US12421322B2 (en) 2017-11-01 2025-09-23 Chugai Seiyaku Kabushiki Kaisha Antibody variant and isoform with lowered biological activity
US12460014B2 (en) 2016-04-28 2025-11-04 Chugai Seiyaku Kabushiki Kaisha Antibody-containing preparation
US12522668B2 (en) 2017-09-29 2026-01-13 Chugai Seiyaku Kabushiki Kaisha Multispecific antigen-binding molecules having blood coagulation factor VIII (FVIII) cofactor function-substituting activity and pharmaceutical formulations containing such a molecule as an active ingredient
US12545743B2 (en) 2016-07-29 2026-02-10 Chugai Seiyaku Kabushiki Kaisha Bispecific antibody exhibiting increased alternative FVIII-cofactor-function activity
US12600798B2 (en) 2017-03-31 2026-04-14 Public University Corporation Nara Medical University Medicinal composition usable for preventing and/or treating blood coagulation factor IX abnormality, comprising multispecific antigen binding molecule replacing function of blood coagulation factor VIII

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112015017619A2 (pt) * 2013-01-24 2017-11-21 Glaxosmithkline Ip Dev Ltd formulação líquida, uso de uma formulação, e, kit
JP6974500B2 (ja) * 2017-01-13 2021-12-01 ハンクス バイオファーマシューティクス,インコーポレイテッド FcRnに対するIgG様抗体の結合親和性を増加し、その血清半減期を延長させる方法
US11059892B2 (en) * 2017-08-11 2021-07-13 Research Development Foundation Engineered antibody Fc variants for enhanced serum half life
KR20190024572A (ko) * 2017-08-30 2019-03-08 (주)셀트리온 TNFα 관련 질환을 치료하기 위한 피하 투여 요법
KR20210137499A (ko) * 2019-03-05 2021-11-17 더 스테이트 오브 이스라엘, 미니스트리 오브 애그리컬처 & 루럴 디벨로프먼트, 애그리컬처럴 리서치 오거니제이션, (에이.알.오.), 볼카니 센터 게놈-편집 조류
CN115770292A (zh) * 2021-09-08 2023-03-10 珠海市丽珠单抗生物技术有限公司 新型冠状病毒SARS-CoV-2的协同免疫及其用途
CN115770291A (zh) * 2021-09-08 2023-03-10 珠海市丽珠单抗生物技术有限公司 新型冠状病毒SARS-CoV-2疫苗加强免疫及其应用
EP4434517A4 (en) * 2021-11-30 2025-06-25 Jiangsu Hengrui Pharmaceuticals Co., Ltd. Anti-sost antibody pharmaceutical composition and use thereof

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
US6090382A (en) 1996-02-09 2000-07-18 Basf Aktiengesellschaft Human antibodies that bind human TNFα
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2004016286A2 (en) 2002-08-16 2004-02-26 Abbott Biotechnology Ltd. Pharmaceutical anti-tnf-alpha antibody formulation
WO2004035752A2 (en) 2002-10-15 2004-04-29 Protein Design Labs, Inc. ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS
WO2006130834A2 (en) 2005-05-31 2006-12-07 Board Of Regents, The University Of Texas System IGGl ANTIBODIES WITH MUTATED FC PORTION FOR INCREASED BINDING TO FCRN RECEPTOR AND USES THEREOF
WO2009024567A1 (en) 2007-08-20 2009-02-26 Glaxo Group Limited Production method
WO2010012946A2 (fr) 2008-07-29 2010-02-04 Arkema France Fabrication de polyethylene greffe a partir de matieres renouvelables, polyethylene obtenu et utilisations
WO2012065072A2 (en) 2010-11-11 2012-05-18 Abbott Biotechnology Ltd. IMPROVED HIGH CONCENTRATION ANTI-TNFα ANTIBODY LIQUID FORMULATIONS

Family Cites Families (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX336813B (es) * 1996-02-09 2016-02-02 Abbvie Biotechnology Ltd Anticuerpos humanos que ligan el tnfa humano.
US7658921B2 (en) * 2000-12-12 2010-02-09 Medimmune, Llc Molecules with extended half-lives, compositions and uses thereof
US8367805B2 (en) * 2004-11-12 2013-02-05 Xencor, Inc. Fc variants with altered binding to FcRn
ES2442258T3 (es) * 2006-10-27 2014-02-10 Abbvie Biotechnology Ltd Anticuerpos cristalinos anti-hTNF alfa
US20090148905A1 (en) * 2007-11-30 2009-06-11 Claire Ashman Antigen-binding constructs
US8420081B2 (en) * 2007-11-30 2013-04-16 Abbvie, Inc. Antibody formulations and methods of making same
WO2009073805A2 (en) * 2007-12-04 2009-06-11 Verdezyne, Inc. Aglycosylated therapeutic antibodies and therapeutic antibody-encoding nucleotide sequences
HRP20150279T1 (hr) * 2007-12-26 2015-05-08 Xencor, Inc. Fc inaäśice s promijenjenim vezanjem na fcrn
EP2225276B1 (en) * 2007-12-31 2014-04-23 Bayer Intellectual Property GmbH Antibodies to tnf alpha
CA2738243C (en) * 2008-10-29 2020-09-29 Wyeth Llc Formulations of single domain antigen binding molecules
CA2753287A1 (en) * 2009-02-24 2010-09-02 Glaxo Group Limited Antigen-binding constructs
TWI541021B (zh) * 2009-03-05 2016-07-11 艾伯維有限公司 Il-17結合蛋白
US20100278822A1 (en) 2009-05-04 2010-11-04 Abbott Biotechnology, Ltd. Stable high protein concentration formulations of human anti-tnf-alpha-antibodies
SG176202A1 (en) * 2009-05-28 2011-12-29 Glaxo Group Ltd Combination of a tnf-alpha antagonist and a vegf antagonist for use in the treatment or prevention of diseases of the eye.
WO2011074965A1 (en) * 2009-12-17 2011-06-23 Stichting Sanquin Bloedvoorziening Methods and means for counteracting an activity of an fc domain

Patent Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5403484A (en) 1988-09-02 1995-04-04 Protein Engineering Corporation Viruses expressing chimeric binding proteins
US5571698A (en) 1988-09-02 1996-11-05 Protein Engineering Corporation Directed evolution of novel binding proteins
US6090382A (en) 1996-02-09 2000-07-18 Basf Aktiengesellschaft Human antibodies that bind human TNFα
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2004016286A2 (en) 2002-08-16 2004-02-26 Abbott Biotechnology Ltd. Pharmaceutical anti-tnf-alpha antibody formulation
WO2004035752A2 (en) 2002-10-15 2004-04-29 Protein Design Labs, Inc. ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS
WO2006130834A2 (en) 2005-05-31 2006-12-07 Board Of Regents, The University Of Texas System IGGl ANTIBODIES WITH MUTATED FC PORTION FOR INCREASED BINDING TO FCRN RECEPTOR AND USES THEREOF
WO2009024567A1 (en) 2007-08-20 2009-02-26 Glaxo Group Limited Production method
WO2010012946A2 (fr) 2008-07-29 2010-02-04 Arkema France Fabrication de polyethylene greffe a partir de matieres renouvelables, polyethylene obtenu et utilisations
WO2012065072A2 (en) 2010-11-11 2012-05-18 Abbott Biotechnology Ltd. IMPROVED HIGH CONCENTRATION ANTI-TNFα ANTIBODY LIQUID FORMULATIONS

Non-Patent Citations (41)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", vol. 1, 1994, JOHN WILEY & SONS, INC.
"Remington's Pharmaceutical Science", MACK PUBLISHING COMPANY
"Stability of Protein Pharmaceuticals Part A and B", 1992, PLENUM PRESS
AKERS,M.J.: "Excipient-Drug interactions in Parenteral Formulations", J.PHARM SCI, vol. 91, 2002, pages 2283 - 2300, XP001130297, DOI: doi:10.1002/jps.10154
BASIC AND CLINICAL PHARMACOLOGY & TOXICOLOGY, vol. 98, 2006, pages 218 - 221
CULL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 1865 - 1869
CURTIS ET AL., CURRENT MEDICAL RESEARCH AND OPINION, vol. 27, 2008, pages 71 - 78
CWIRLA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 6378 - 6382
DALL'ACQUA ET AL., J IMMUNOL., vol. 169, 2002, pages 5171 - 80
DEVLIN, SCIENCE, vol. 249, 1990, pages 404 - 406
FELICI, J : MOL. BIOL., vol. 222, 1991, pages 301 - 310
FODOR, NATURE, vol. 364, 1993, pages 555 - 556
GHETIE ET AL., ANNU.REV.LMMUNOL., vol. 18, 2000, pages 739 - 766
HOUGHTEN, BIOLTECHNIQUES, vol. 13, 1992, pages 412 - 421
IMAMURA, K ET AL.: "Effects of types of sugar on stabilization of Protein in the dried state", J PHARM SCI, vol. 92, 2003, pages 266 - 274
J IMMUNOL, vol. 181, 2008, pages 3183 - 3192
JOHNSON, R: "Mannitol-sucrose mixtures-versatile formulations for protein lyophilization", J. PHARM. SCI, vol. 91, 2002, pages 914 - 922, XP002502335, DOI: doi:10.1002/jps.10094
JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 97, 2008, pages 3051 - 3066
JUNGHANS R.P, IMMUNOL.RES, vol. 16, 1997, pages 29 - 57
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1987, NATIONAL INSTITUTES OF HEALTH
KARLSSON ET AL., J IMMUNOL. METHODS, vol. 145, 1991, pages 229 - 240
KENNETH, A ET AL.: "Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists"
KIM ET AL., EUR. J. OF IMMUNO., vol. 24, 1994, pages 542
KIM ET AL., EUR. R IMMUNOL., vol. 24, 1994, pages 2429 - 2434
KIM ET AL., J IMMUNOL., vol. 40, 1994, pages 457 - 465
KOTSOPOULOU ET AL., J BIOTECHNOL, vol. 146, 2010, pages 186 - 193
KOTSOPOULOU ET AL., J. BIOTECHNOL, vol. 146, 2010, pages 186 - 193
KOTSOPOULOU ET AL., J. BIOTECHNOL, vol. 164, no. 4, 2010, pages 186 - 193
LAM, NATURE, vol. 354, 1991, pages 82 - 84
LASMAR U; PARKINS D: "The formulation of Biopharmaceutical products", PHARMA. SCI.TECH.TODAY, vol. 3, 3 April 2000 (2000-04-03), pages 129 - 137, XP055048909, DOI: doi:10.1016/S1461-5347(00)00248-0
LZUTSU, KKOJIMA, S.: "Excipient crystalinity and its protein- structure-stabilizing effect during freeze-drying", J PHARM. PHARMACOL, vol. 54, 2002, pages 1033 - 1039
M GIBALDI; D PERRON: "Pharmacokinetics", 1982, MARCEL DEKKER
PETERS ET AL., PHARMACOKINETIC ANALYSIS: A PRACTICAL APPROACH, 1996
PETKOVA ET AL., INT. IMMUNOL, vol. 18, no. 12, 2010, pages 1759 - 1769
POPOV ET AL., MOL. IMMUNOL., vol. 33, 1996, pages 493 - 502
RAJPAL ET AL., PNAS, vol. 102, no. 24, 2005, pages 8466 - 8471
ROWLAND; TOZER: "Clinical Pharmacokinetics: Concepts and Applications", 1995
SCOTT; SMITH, SCIENCE, vol. 249, 1990, pages 386 - 390
SHIELDS ET AL., J BIOL CHEM, vol. 276, 2001, pages 6591 - 604
THE AAPS JOURNAL, vol. 8, no. 3, 2006
WANG, W: "Instability, stabilisation and formulation of liquid protein pharmaceuticals", INT. J. PHARM, vol. 185, 1999, pages 129 - 188

Cited By (126)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9546212B2 (en) 2001-06-08 2017-01-17 Abbvie Biotechnology Ltd. Methods of administering anti-TNFα antibodies
US10570198B2 (en) 2010-10-22 2020-02-25 Novartis Ag Stable and soluble antibodies
US9090688B2 (en) 2011-04-27 2015-07-28 Abbvie Inc. Methods for controlling the galactosylation profile of recombinantly-expressed proteins
US9255143B2 (en) 2011-04-27 2016-02-09 Abbvie Inc. Methods for controlling the galactosylation profile of recombinantly-expressed proteins
US9365645B1 (en) 2011-04-27 2016-06-14 Abbvie, Inc. Methods for controlling the galactosylation profile of recombinantly-expressed proteins
US9505834B2 (en) 2011-04-27 2016-11-29 Abbvie Inc. Methods for controlling the galactosylation profile of recombinantly-expressed proteins
US9062106B2 (en) 2011-04-27 2015-06-23 Abbvie Inc. Methods for controlling the galactosylation profile of recombinantly-expressed proteins
EP3412310B1 (en) * 2012-03-07 2022-09-07 Cadila Healthcare Limited Pharmaceutical formulations of tnf-alpha antibodies
EP3912639A1 (en) * 2012-03-07 2021-11-24 Cadila Healthcare Limited Pharmaceutical formulations of tnf-alpha antibodies
EP3412310A1 (en) 2012-03-07 2018-12-12 Cadila Healthcare Limited Pharmaceutical formulations of tnf-alpha antibodies
EP2822591B1 (en) 2012-03-07 2018-05-02 Cadila Healthcare Limited Pharmaceutical formulations of tnf-alpha antibodies
US9957318B2 (en) 2012-04-20 2018-05-01 Abbvie Inc. Protein purification methods to reduce acidic species
US9505833B2 (en) 2012-04-20 2016-11-29 Abbvie Inc. Human antibodies that bind human TNF-alpha and methods of preparing the same
US9346879B2 (en) 2012-04-20 2016-05-24 Abbvie Inc. Protein purification methods to reduce acidic species
US9150645B2 (en) 2012-04-20 2015-10-06 Abbvie, Inc. Cell culture methods to reduce acidic species
US9181572B2 (en) 2012-04-20 2015-11-10 Abbvie, Inc. Methods to modulate lysine variant distribution
US9708400B2 (en) 2012-04-20 2017-07-18 Abbvie, Inc. Methods to modulate lysine variant distribution
US9193787B2 (en) 2012-04-20 2015-11-24 Abbvie Inc. Human antibodies that bind human TNF-alpha and methods of preparing the same
US9359434B2 (en) 2012-04-20 2016-06-07 Abbvie, Inc. Cell culture methods to reduce acidic species
WO2013158275A1 (en) * 2012-04-20 2013-10-24 Abbvie Inc. Cell culture methods to reduce acidic species
US9683033B2 (en) 2012-04-20 2017-06-20 Abbvie, Inc. Cell culture methods to reduce acidic species
US9334319B2 (en) 2012-04-20 2016-05-10 Abbvie Inc. Low acidic species compositions
US9249182B2 (en) 2012-05-24 2016-02-02 Abbvie, Inc. Purification of antibodies using hydrophobic interaction chromatography
EP2863951A1 (en) * 2012-06-12 2015-04-29 Boehringer Ingelheim International GmbH Pharmaceutical formulation for a therapeutic antibody
JP2015519382A (ja) * 2012-06-12 2015-07-09 ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング 治療用抗体のための医薬処方物
US9206390B2 (en) 2012-09-02 2015-12-08 Abbvie, Inc. Methods to control protein heterogeneity
US9234033B2 (en) 2012-09-02 2016-01-12 Abbvie, Inc. Methods to control protein heterogeneity
US9512214B2 (en) 2012-09-02 2016-12-06 Abbvie, Inc. Methods to control protein heterogeneity
US9290568B2 (en) 2012-09-02 2016-03-22 Abbvie, Inc. Methods to control protein heterogeneity
US10159732B2 (en) 2012-09-07 2018-12-25 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10772959B2 (en) 2012-09-07 2020-09-15 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10688183B2 (en) 2012-09-07 2020-06-23 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10286071B2 (en) 2012-09-07 2019-05-14 Coherus Biosciences, Inc. Syringe containing stable aqueous formulations of adalimumab
US10286072B2 (en) 2012-09-07 2019-05-14 Coherus Biosciences, Inc. Methods of manufacturing stable aqueous formulations of adalimumab
US10716852B2 (en) 2012-09-07 2020-07-21 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10207000B2 (en) 2012-09-07 2019-02-19 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10195275B2 (en) 2012-09-07 2019-02-05 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10716853B2 (en) 2012-09-07 2020-07-21 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10159733B2 (en) 2012-09-07 2018-12-25 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10155039B2 (en) 2012-09-07 2018-12-18 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10716854B2 (en) 2012-09-07 2020-07-21 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10799585B2 (en) 2012-09-07 2020-10-13 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10786566B2 (en) 2012-09-07 2020-09-29 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10780163B2 (en) 2012-09-07 2020-09-22 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10722579B2 (en) 2012-09-07 2020-07-28 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
US10772960B2 (en) 2012-09-07 2020-09-15 Coherus Biosciences, Inc. Stable aqueous formulations of adalimumab
EP3514175A1 (fr) * 2012-12-17 2019-07-24 Laboratoire Français du Fractionnement et des Biotechnologies Utilisation d'anticorps monoclonaux pour le traitement de l'inflammation et d'infections bacteriennes
WO2014096672A1 (fr) * 2012-12-17 2014-06-26 Laboratoire Francais Du Fractionnement Et Des Biotechnologies Utilisation d'anticorps monoclonaux pour le traitement de l'inflammation et d'infections bacteriennes
FR2999431A1 (fr) * 2012-12-17 2014-06-20 Lfb Biotechnologies Utilisation d'anticorps monoclonaux pour le traitement de l'inflammation et d'infections bacteriennes
US9067990B2 (en) 2013-03-14 2015-06-30 Abbvie, Inc. Protein purification using displacement chromatography
US8921526B2 (en) 2013-03-14 2014-12-30 Abbvie, Inc. Mutated anti-TNFα antibodies and methods of their use
US9708399B2 (en) 2013-03-14 2017-07-18 Abbvie, Inc. Protein purification using displacement chromatography
WO2014158231A1 (en) * 2013-03-14 2014-10-02 Abbvie Inc. Low acidic species compositions and methods for producing and using the same
US9499614B2 (en) 2013-03-14 2016-11-22 Abbvie Inc. Methods for modulating protein glycosylation profiles of recombinant protein therapeutics using monosaccharides and oligosaccharides
CN105377237A (zh) * 2013-07-19 2016-03-02 德国赫素制药集团 使免疫反应的调节与生物药品的给药相关的方法和制剂
CN105377237B (zh) * 2013-07-19 2019-04-19 德国赫素制药集团 使免疫反应的调节与生物药品的给药相关的方法和制剂
RU2662558C2 (ru) * 2013-07-19 2018-07-26 Хексаль Аг Способы и композиции, которые обеспечивают модуляцию иммунных ответов, связанных с введением биофармацевтического лекарственного средства
WO2015007912A1 (en) * 2013-07-19 2015-01-22 Hexal Ag Methods and formulations which allow the modulation of immune responses related to the administration of a biopharmaceutical drug
US9598667B2 (en) 2013-10-04 2017-03-21 Abbvie Inc. Use of metal ions for modulation of protein glycosylation profiles of recombinant proteins
JP2019123718A (ja) * 2013-10-16 2019-07-25 アウトルック セラピューティクス,インコーポレイティド 抗体安定性を増強する緩衝液製剤
US10376582B2 (en) 2013-10-16 2019-08-13 Outlook Therapeutics, Inc. Buffer formulations for enhanced antibody stability
JP2016535085A (ja) * 2013-10-16 2016-11-10 オンコバイオロジクス,インコーポレイティド 抗体安定性を増強する緩衝液製剤
US9181337B2 (en) 2013-10-18 2015-11-10 Abbvie, Inc. Modulated lysine variant species compositions and methods for producing and using the same
US9499616B2 (en) 2013-10-18 2016-11-22 Abbvie Inc. Modulated lysine variant species compositions and methods for producing and using the same
US9200069B2 (en) 2013-10-18 2015-12-01 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same
US9522953B2 (en) 2013-10-18 2016-12-20 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same
US8946395B1 (en) 2013-10-18 2015-02-03 Abbvie Inc. Purification of proteins using hydrophobic interaction chromatography
US9200070B2 (en) 2013-10-18 2015-12-01 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same
US9266949B2 (en) 2013-10-18 2016-02-23 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same
US9017687B1 (en) 2013-10-18 2015-04-28 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same using displacement chromatography
US9688752B2 (en) 2013-10-18 2017-06-27 Abbvie Inc. Low acidic species compositions and methods for producing and using the same using displacement chromatography
US9315574B2 (en) 2013-10-18 2016-04-19 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same
US9085618B2 (en) 2013-10-18 2015-07-21 Abbvie, Inc. Low acidic species compositions and methods for producing and using the same
US9550826B2 (en) 2013-11-15 2017-01-24 Abbvie Inc. Glycoengineered binding protein compositions
AU2018220051B2 (en) * 2014-05-23 2020-06-04 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
US10772961B2 (en) 2014-05-23 2020-09-15 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
US10493152B2 (en) 2014-05-23 2019-12-03 Fresenius Kabi Deutschland Gmbh Adalimumab formulations
US12109267B2 (en) 2014-05-23 2024-10-08 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
US10426832B2 (en) 2014-05-23 2019-10-01 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
US11752209B2 (en) 2014-05-23 2023-09-12 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
US11752208B2 (en) 2014-05-23 2023-09-12 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
US11712471B2 (en) 2014-05-23 2023-08-01 Fresenius Kabi Deustschland GmbH Liquid pharmaceutical composition
EP3476386A1 (en) * 2014-05-23 2019-05-01 Fresenius Kabi Deutschland GmbH Liquid pharmaceutical composition
US11707524B2 (en) 2014-05-23 2023-07-25 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
EP3050557A1 (en) * 2014-05-23 2016-08-03 Ares Trading S.A. Liquid pharmaceutical composition
WO2015177057A1 (en) * 2014-05-23 2015-11-26 Ares Trading S.A. Liquid pharmaceutical composition
US10729769B2 (en) 2014-05-23 2020-08-04 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
US10426833B2 (en) 2014-05-23 2019-10-01 Fresenius Kabi Deutschland Gmbh Liquid pharmaceutical composition
EP2946765A1 (en) * 2014-05-23 2015-11-25 Ares Trading S.A. Liquid pharmaceutical composition
JP2020124205A (ja) * 2014-09-03 2020-08-20 ベーリンガー・インゲルハイム・インターナショナル・ゲーエムベーハー Il−23a及びtnf−アルファを標的とする化合物ならびにその使用
JP7072600B2 (ja) 2014-09-03 2022-05-20 ベーリンガー・インゲルハイム・インターナショナル・ゲーエムベーハー Il-23a及びtnf-アルファを標的とする化合物ならびにその使用
US10793629B2 (en) 2014-09-03 2020-10-06 Boehringer Ingelheim International Gmbh Compound targeting IL-23A and TNF-alpha and uses thereof
JP2017528132A (ja) * 2014-09-03 2017-09-28 ベーリンガー・インゲルハイム・インターナショナル・ゲーエムベーハー Il−23a及びtnf−アルファを標的とする化合物ならびにその使用
US11680096B2 (en) 2014-09-03 2023-06-20 Boehringer Ingelheim International Gmbh Compound targeting IL-23A and TNF-alpha and uses thereof
EP3428189A1 (en) * 2014-10-28 2019-01-16 Richter Gedeon Nyrt. Pharmaceutical anti-tnf-alpha antibody formulation
WO2016066688A1 (en) * 2014-10-28 2016-05-06 Richter Gedeon Nyrt. Pharmaceutical anti-tnf-alpha antibody formulation
US10696735B2 (en) 2015-01-21 2020-06-30 Outlook Therapeutics, Inc. Modulation of charge variants in a monoclonal antibody composition
WO2016120413A1 (en) * 2015-01-28 2016-08-04 Mabxience S.A. Pharmaceutical formulations for anti-tnf-alpha antibodies
WO2016189491A1 (en) * 2015-05-28 2016-12-01 Glaxosmithkline Intellectual Property Development Limited Novel formulation
US11229702B1 (en) 2015-10-28 2022-01-25 Coherus Biosciences, Inc. High concentration formulations of adalimumab
US11091542B2 (en) 2015-12-18 2021-08-17 UCB Biopharma SRL Antibody molecules which bind TNF alpha
US12168697B2 (en) 2015-12-25 2024-12-17 Chugai Seiyaku Kabushiki Kaisha Bispecific antibodies which bind blood coagulation factor VIII and have enhanced activity, and methods of use thereof for treating bleeding and associated conditions
US11285210B2 (en) 2016-02-03 2022-03-29 Outlook Therapeutics, Inc. Buffer formulations for enhanced antibody stability
US11319383B2 (en) 2016-03-14 2022-05-03 Universitetet | Oslo Engineered immunoglobulins with altered FcRn binding
US11071782B2 (en) 2016-04-20 2021-07-27 Coherus Biosciences, Inc. Method of filling a container with no headspace
US11576971B2 (en) 2016-04-20 2023-02-14 Coherus Biosciences, Inc. Method of filling a container with no headspace
US12460014B2 (en) 2016-04-28 2025-11-04 Chugai Seiyaku Kabushiki Kaisha Antibody-containing preparation
US12545743B2 (en) 2016-07-29 2026-02-10 Chugai Seiyaku Kabushiki Kaisha Bispecific antibody exhibiting increased alternative FVIII-cofactor-function activity
US11858980B2 (en) 2016-08-02 2024-01-02 Visterra, Inc. Engineered polypeptides and uses thereof
IL266082B2 (en) * 2016-10-20 2024-07-01 Sanofi Sa Anti-chikv antibodies and uses thereof
IL266082B1 (en) * 2016-10-20 2024-03-01 Sanofi Sa Anti-chikv antibodies and uses thereof
WO2018073387A1 (en) * 2016-10-20 2018-04-26 Sanofi Anti-chikv antibodies and uses thereof
US12227560B2 (en) 2016-10-20 2025-02-18 Sanofi Anti-CHIKV antibodies and uses thereof
US11286295B2 (en) 2016-10-20 2022-03-29 Sanofi Anti-CHIKV monoclonal antibodies directed against the E2 structural protein
EP3569224A4 (en) * 2017-01-11 2019-12-25 Celltrion Inc. STABLE LIQUID FORMULA
AU2018207367B2 (en) * 2017-01-11 2024-02-15 Celltrion Inc. Stable Liquid Formula
US11534403B2 (en) 2017-03-06 2022-12-27 Arecor Limited Liquid pharmaceutical composition
WO2018162500A1 (en) * 2017-03-06 2018-09-13 Ares Trading S.A. Liquid pharmaceutical composition
US11534402B2 (en) 2017-03-06 2022-12-27 Arecor Limited Liquid pharmaceutical composition
EP3372242A1 (en) * 2017-03-06 2018-09-12 Ares Trading S.A. Liquid pharmaceutical composition
US12600798B2 (en) 2017-03-31 2026-04-14 Public University Corporation Nara Medical University Medicinal composition usable for preventing and/or treating blood coagulation factor IX abnormality, comprising multispecific antigen binding molecule replacing function of blood coagulation factor VIII
US12522668B2 (en) 2017-09-29 2026-01-13 Chugai Seiyaku Kabushiki Kaisha Multispecific antigen-binding molecules having blood coagulation factor VIII (FVIII) cofactor function-substituting activity and pharmaceutical formulations containing such a molecule as an active ingredient
US12421322B2 (en) 2017-11-01 2025-09-23 Chugai Seiyaku Kabushiki Kaisha Antibody variant and isoform with lowered biological activity
RU2795592C2 (ru) * 2018-01-26 2023-05-05 Джензим Корпорейшн Варианты fc с повышенным связыванием с fcrn и пролонгированным периодом полувыведения
WO2019147973A1 (en) * 2018-01-26 2019-08-01 Genzyme Corporation Fc variants with enhanced binding to fcrn and prolonged half-life
US11608357B2 (en) 2018-08-28 2023-03-21 Arecor Limited Stabilized antibody protein solutions

Also Published As

Publication number Publication date
SG10201601154QA (en) 2016-03-30
EP3009450A1 (en) 2016-04-20
NZ618897A (en) 2016-02-26
EP2734548A2 (en) 2014-05-28
EA201391789A1 (ru) 2014-06-30
GB201112429D0 (en) 2011-08-31
ZA201400062B (en) 2017-08-30
MX2014000739A (es) 2014-02-19
DOP2014000007A (es) 2014-04-30
AU2012285786B2 (en) 2016-05-12
EP2734548B1 (en) 2016-08-17
CN103748110A (zh) 2014-04-23
CO6862106A2 (es) 2014-02-10
CR20140029A (es) 2014-03-05
BR112014000341A2 (pt) 2017-02-14
JP2014524748A (ja) 2014-09-25
KR20140054085A (ko) 2014-05-08
US20130243764A1 (en) 2013-09-19
AU2012285786A1 (en) 2014-02-06
PE20141660A1 (es) 2014-11-21
MA35345B1 (fr) 2014-08-01
WO2013011076A3 (en) 2013-04-04
CA2841105A1 (en) 2013-01-24
PH12014500167A1 (en) 2019-03-22
CL2014000134A1 (es) 2014-07-25
ES2600854T3 (es) 2017-02-13

Similar Documents

Publication Publication Date Title
AU2012285786B2 (en) TNF -alpha antigen- binding proteins with increased FcRn binding
AU2014209994B2 (en) TNF-alpha antigen-binding proteins
TWI844034B (zh) 抗IL17a抗體的水性藥物組合物及其用途
KR20170044751A (ko) Il-23a 및 tnf-알파를 표적으로 하는 화합물 및 이의 용도
KR20200083598A (ko) 이뮤노글로불린-유사 전사체 3 (ilt3)에 대해 특이적인 항체 및 그의 용도
US20130280256A1 (en) Anti-baff-anti-il-17 bispecific antibodies
WO2020157305A1 (en) Multispecific antibodies having specificity for tnfa and il-17a, antibodies targeting il-17a, and methods of use thereof
CN113507938B (zh) 包含抗il-5抗体的药物组合物及其用途
JP2004536605A (ja) インターロイキン1β抗体
JP2025542239A (ja) 自己免疫疾患の治療
CN111956606A (zh) 包含高浓度抗人白介素23单克隆抗体的低粘度液体制剂
JP2025519612A (ja) Igf1r抗体
NZ618897B2 (en) Tnf-alpha antigen-binding proteins with increased fcrn binding
EP4461749A1 (en) Pharmaceutical composition comprising anti-fxi/fxia antibody and use thereof
RU2824390C2 (ru) Фармацевтическая композиция, содержащая антитело против il-5, и ее применение
WO2026058155A1 (en) Antibodies targeting il-31
HK1225956A1 (en) Methods of treating immune disorders with single domain antibodies against tnf-alpha
HK1190418A (en) Methods of treating immune disorders with single domain antibodies against tnf-alpha

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12738101

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 13988400

Country of ref document: US

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: DZP2013000790

Country of ref document: DZ

WWE Wipo information: entry into national phase

Ref document number: 201391789

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 2841105

Country of ref document: CA

REEP Request for entry into the european phase

Ref document number: 2012738101

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 000086-2014

Country of ref document: PE

Ref document number: 2012738101

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2014520658

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014000134

Country of ref document: CL

Ref document number: MX/A/2014/000739

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: CR2014-000029

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: 14011137

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2012285786

Country of ref document: AU

Date of ref document: 20120719

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20147004161

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: A201314726

Country of ref document: UA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014000341

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014000341

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140107