WO2013006842A2 - Immunogenic compositions and uses thereof - Google Patents

Immunogenic compositions and uses thereof Download PDF

Info

Publication number
WO2013006842A2
WO2013006842A2 PCT/US2012/045854 US2012045854W WO2013006842A2 WO 2013006842 A2 WO2013006842 A2 WO 2013006842A2 US 2012045854 W US2012045854 W US 2012045854W WO 2013006842 A2 WO2013006842 A2 WO 2013006842A2
Authority
WO
WIPO (PCT)
Prior art keywords
antigen
polypeptide
epitope
rna
composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/045854
Other languages
English (en)
French (fr)
Other versions
WO2013006842A3 (en
Inventor
Andrew Geall
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
Original Assignee
Novartis AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novartis AG filed Critical Novartis AG
Priority to EP18209088.6A priority Critical patent/EP3508219A1/en
Priority to JP2014519091A priority patent/JP2014520807A/ja
Priority to CA2841047A priority patent/CA2841047A1/en
Priority to EP12735421.5A priority patent/EP2729168A2/en
Priority to US14/130,869 priority patent/US11058762B2/en
Publication of WO2013006842A2 publication Critical patent/WO2013006842A2/en
Anticipated expiration legal-status Critical
Publication of WO2013006842A3 publication Critical patent/WO2013006842A3/en
Priority to US17/330,826 priority patent/US20210290755A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/155Paramyxoviridae, e.g. parainfluenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/245Herpetoviridae, e.g. herpes simplex virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55555Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55588Adjuvants of undefined constitution
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16111Cytomegalovirus, e.g. human herpesvirus 5
    • C12N2710/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/18011Paramyxoviridae
    • C12N2760/18511Pneumovirus, e.g. human respiratory syncytial virus
    • C12N2760/18534Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/36011Togaviridae
    • C12N2770/36111Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
    • C12N2770/36141Use of virus, viral particle or viral elements as a vector
    • C12N2770/36143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • Nucleic acid based vaccines are an attractive approach to vaccination.
  • intramuscular (IM) immunization of plasmid DNA encoding an antigen can induce cellular and humoral immune responses and protect against challenge.
  • DNA vaccines offer certain advantages over traditional vaccines using protein antigens, or attenuated pathogens.
  • DNA vaccines can be more effective in producing a properly folded antigen in its native conformation, and in generating a cellular immune response.
  • DNA vaccines also do not have some of the safety problems associated with killed or attenuated pathogens.
  • a killed viral preparation may contain residual live viruses, and an attenuated virus may mutate and revert to a pathogenic phenotype.
  • DNA vaccines are generally effective in generating cell mediated immunity (such as interferon- ⁇ secreting antigen-specific T-cells and antigen-specific cytotoxic T- cells), but less effective in generating antibodies against the encoded and expressed antigen.
  • WO 99/30733 discloses a method of enhancing immune response to a nucleic acid vaccine by simultaneous administration of the protein that is encoded by the nucleic acid.
  • the two components do not need to be administered in the same composition. Both components need to be administered during the induction phase of the immune response, with the protein preferably being masked or held back until after the nucleic acid has primed the immune system.
  • the vaccine comprised naked DNA and naked protein antigen in physical admixture.
  • the protein antigen was formulated for delayed release in a biodegradable polymer-alum formulation admixed with naked DNA.
  • WO 97/28818 discloses a vaccine that delivers a nucleic acid and a protein antigen to antigen presenting cells.
  • the nucleic acid may encode the same protein as the protein antigen.
  • the nucleic acid and protein are "complexed," e.g., by covalent conjugation.
  • the complex may be formulated as a synthetic virus-like particle. It is also suggested that liposomal systems may be used.
  • U.S. Pat. No. 7,604,803 discloses the co-delivery of nucleic acid and its encoded protein to the same cell using a liposomal system.
  • the DNA molecule and its encoded protein are entrapped within the same liposomal vehicle, such that the two entities arrive at antigen-presenting cells together, resulting in the processing and presentation of the protein form of the antigen, together with the expression of the DNA-encoded form of the antigen in the same cell.
  • WO 2009/156852 discloses a prime/boost approach to raise an immune response in a subject.
  • the method comprises: (i) administering at least one dose of a priming immunogenic composition to the subject, to elicit a primary immune response against a pathogen; and (ii) administering a boosting immunogenic composition to the subject, to elicit, within 21 days of its administration or sooner, a protective anamnestic immune response against the pathogen.
  • WO 2009/074861 discloses a vaccine comprising (i) a nucleic acid sequence encoding at least one influenza virus antigen coated onto carrier particles, and (ii) an assistor protein for sequential or concomitant administration.
  • the assistor protein and the antigen encoded by the nucleic acid molecule share at least one common epitope.
  • WO 2006/061643 discloses a prime-boost vaccination method using herpes viral vectors, in particular, a heterologous prime-boost regimen using two different non- replicating viral vectors, one of which is a herpes virus vector.
  • the two vectors share a common epitope that is associated with a target antigen or disease.
  • WO 2010/036948 discloses the use of a priming composition and a boosting composition to prime and boost an immune response.
  • the priming composition comprises a DNA plasmid that comprises a nucleic acid molecule encoding an influenza virus hemagglutinin (HA) or an epitope-bearing domain thereof.
  • the boosting composition comprises an influenza vaccine.
  • non-coding plasmid DNA has an immuno-adjuvant action when co-entrapped with peptides in liposomal vesicles (Gursel, M. et al. Vaccine (1999) 17: 1376-1383) and that DNA with CpG motifs has an adjuvant effect on naked DNA and peptide vaccines (Klinman, D. M. et al. Vaccine (1999) 17: 19-25).
  • RNA molecules encoding an antigen or a derivative thereof may also be used as vaccines.
  • RNA vaccines offer certain advantages as compared to DNA vaccines.
  • RNA-based vaccines are highly susceptible to degradation by nucleases when administered as a therapeutic or vaccine. Additionally, RNAs are not actively transported into cells. See, e.g., Vajdy, M., et al, Mucosal adjuvants and delivery systems for protein-, DNA- and RNA-based vaccines, Immunol Cell Biol, 2004. 82(6): p. 617-27.
  • TLRs Toll-like receptors
  • PAMPS pathogen-associated molecular patterns
  • Many TLRs have been identified in humans, mice, and other mammalian species.
  • DNA molecules such as bacterial or viral DNA
  • RNA molecules such as single stranded viral RNA
  • U.S. Pat. No. 7,862,829 discloses a method of producing an immune response by administering an antigen and an alphavirus-based adjuvant.
  • the method is based on the discovery that alphavirus, a (+)ssRNA virus, can act as an adjuvant to enhance an immune response against an antigen, even though the antigen is not presented on or expressed by the virus.
  • the alphavirus particles may be delivered by liposomal system.
  • This invention generally relates to immunogenic compositions that comprise an RNA component and a polypeptide component.
  • Immunogenic compositions that deliver antigenic epitopes in two different forms - a first epitope from a pathogen, in RNA-coded form; and a second epitope from the same pathogen, in polypeptide form - can enhance the immune response to the pathogen, as compared to immunization with RNA alone, or polypeptide alone.
  • the first epitope and the second epitope are the same epitope.
  • the invention also relates to a kit comprising an RNA-based priming composition and a polypeptide-based boosting composition for sequential administration.
  • the kit is suitable for, for example, a "RNA prime, protein boost" immunization regimen to generate an immune response to a pathogen.
  • the invention also relates to methods for treating or preventing an infectious disease, methods for inducing an immune response, or methods of vaccinating a subject, by co-delivery of an RNA molecule and a polypeptide molecule (co-administration).
  • the invention also relates to methods for treating or preventing an infectious disease, methods for inducing an immune response, or methods of vaccinating a subject, by sequential administration of an RNA molecule and a polypeptide molecule (prime-boost).
  • the invention provides an immunogenic composition comprising: (i) a self-replicating RNA molecule that encodes a first polypeptide antigen comprising a first epitope; and (ii) a second polypeptide antigen comprising a second epitope; wherein the first and second epitope are epitopes from the same pathogen.
  • the first and and second epitopes can be the same epitope.
  • the first and second epitopes can be different epitopes.
  • the first polypeptide antigen and the second polypeptide antigen are substantially the same.
  • the first polypeptide antigen can be a soluble or membrane anchored polypeptide and the second polypeptide antigen can be a soluble polypeptide.
  • the first polypeptide antigen is a fusion polypeptide that further comprises a third epitope from a different pathogen.
  • the second polypeptide antigen is a fusion polypeptide that further comprises a third epitope from a different pathogen.
  • the first and second epitopes can be epitopes from the same subspecies of the pathogen.
  • the self-replicating RNA can be an alphavirus-derived RNA replicon.
  • the self-replicating RNA molecule can comprise one or more modified nucleotides.
  • the immunogenic composition further comprises a cationic lipid, a liposome, a cochleate, a virosome, an immune-stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, or a cationic nanoemulsion.
  • the RNA molecule is encapsulated in, bound to or adsorbed on a cationic lipid, a liposome, a cochleate, a virosome, an immune-stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, a cationic nanoemulsion or combinations thereof.
  • the pathogen is a virus
  • the first polypeptide antigen and second polypeptide antigen are viral antigens.
  • the viral antigens can be RSV-F antigens.
  • the RSV-F antigens comprise an amino acid sequence selected from SEQ ID NOs:25-40.
  • the viral antigens can be from Cytomegalovirus (CMV).
  • CMV antigens are independently selected from the group consisting of a gB antigen, a gH antigen, a gL antigen, a gM antigen, a gN antigen, a gO antigen, a UL128 antigen, a UL129 antigen, and a UL130 antigen.
  • the immunogenic composition further comprises an adjuvant.
  • the adjuvant can be MF59.
  • the invention also relates to pharmaceutical compositions that comprise an immunogenic composition as described herein and a pharmaceutically acceptable carrier and/or a pharmaceutically acceptable vehicle.
  • the invention also relates to methods for treating or preventing an infectious disease comprising administering to a subject in need thereof a therapeautically effective amount of a composition as described herein.
  • the invention also relates to methods of inducing an immune response in a subject comprising administering to a subject in need thereof a therapeutically effective amount of a composition as described herein.
  • the invention also relates to methods of vaccinating a subject, comprising administering to a subject in need thereof a composition as described herein.
  • kits comprising: (i) a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope from a pathogen; and (ii) a boosting composition comprising a second polypeptide antigen that comprises a second epitope from the pathogen.
  • the first and second polypeptide antigens can be substantially the same.
  • the first polypeptide antigen can be a soluble or membrane anchored polypeptide
  • the second polypeptide antigen can be a soluble polypeptide.
  • the first polypeptide antigen can be a fusion polypeptide.
  • the second polypeptide antigen can be a fusion polypeptide.
  • the self-replicating RNA can be an alphavirus -derived RNA replicon.
  • the self-replicating RNA molecule can comprise one or more modified nucleotides.
  • the priming composition of the kit further comprises a cationic lipid, a liposome, a cochleate, a virosome, an immune-stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, or a cationic nanoemulsion.
  • the RNA molecule of the kit is encapsulated in, bound to or adsorbed on a cationic lipid, a liposome, a cochleate, a virosome, an immune- stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, a cationic nanoemulsion or combinations thereof.
  • the pathogen of the kit is a virus
  • the first polypeptide antigen and second polypeptide antigen are viral antigens.
  • the viral antigens can be from respiratory syncytial virus (RSV).
  • the viral antigens can be a RSV-F antigen.
  • the RSV-F antigens comprise an amino acid sequence selected from SEQ ID NOs:25-40.
  • the viral antigens are from Cytomegalovirus (CMV).
  • CMV antigens are independently selected from the group consisting of a gB antigen, a gH antigen, a gL antigen, a gM antigen, a gN antigen, a gO antigen, a UL128 antigen, a UL129 antigen, and a UL130 antigen.
  • the priming composition of the kit, the boosting composition of the kit, or both comprise an adjuvant.
  • the adjuvant can be MF59.
  • the priming composition, the boosting composition, or both can comprise a pharmaceutically acceptable carrier and/or a pharmaceutically acceptable vehicle.
  • the invention also relates to methods for treating or preventing an infectious disease comprising: (i) administering to a subject in need thereof at least once a therapeutically effective amount of a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope from a pathogen; and subsequently administering the subject at least once a therapeutically effective amount of a boosting composition comprising a second polypeptide antigen that comprises a second epitope from said pathogen; wherein said first epitope and second epitope are the same epitope.
  • the invention also relates to methods for inducing an immune response in a subject comprising (i) administering to a subject in need thereof at least once a therapeutically effective amount of a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope from a pathogen; and subsequently administering the subject at least once a therapeutically effective amount of a boosting composition comprising a second polypeptide antigen that comprises a second epitope from said pathogen; wherein said first epitope and second epitope are the same epitope.
  • the invention also relates to methods for vaccinating a subject, comprising administering to a subject in need thereof at least once a therapeutically effective amount of a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope from a pathogen; and subsequently administering the subject at least once a therapeutically effective amount of a boosting composition comprising a second polypeptide antigen that comprises a second epitope from said pathogen; wherein said first epitope and second epitope are the same epitope.
  • a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope from a pathogen
  • a boosting composition comprising a second polypeptide antigen that comprises a second epitope from said pathogen
  • the first polypeptide antigen and the second amino acids are identical to each other.
  • polypeptide antigen are substantially the same.
  • the first polypeptide antigen can be a soluble or membrane anchored polypeptide and the second polypeptide antigen can be a soluble polypeptide.
  • the first polypeptide antigen is a fusion polypeptide that further comprises a third epitope from a different pathogen.
  • the second polypeptide antigen is a fusion polypeptide that further comprises a third epitope from a different pathogen.
  • the first and second epitopes can be epitopes from the same subspecies of the pathogen.
  • the self-replicating RNA can be an alphavirus-derived RNA replicon.
  • the self-replicating RNA molecule can comprise one or more modified nucleotides.
  • the immunogenic composition further comprises a cationic lipid, a liposome, a cochleate, a virosome, an immune-stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, or a cationic nanoemulsion.
  • the RNA molecule is encapsulated in, bound to or adsorbed on a cationic lipid, a liposome, a cochleate, a virosome, an immune-stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, a cationic nanoemulsion or combinations thereof.
  • the pathogen is a virus
  • the first polypeptide antigen and second polypeptide antigen are viral antigens.
  • the viral antigens can be RSV-F antigens.
  • the RSV-F antigens comprise an amino acid sequence selected from SEQ ID NOs:25-40.
  • the viral antigens can be from Cytomegalovirus (CMV).
  • CMV antigens are independently selected from the group consisting of a gB antigen, a gH antigen, a gL antigen, a gM antigen, a gN antigen, a gO antigen, a UL128 antigen, a UL129 antigen, and a UL130 antigen.
  • the immunogenic composition further comprises an adjuvant.
  • the adjuvant can be MF59.
  • the invention also relates to pharmaceutical compositions that comprise an immunogenic composition as described herein and a pharmaceutically acceptable carrier and/or a pharmaceutically acceptable vehicle.
  • Figure 2 is a graph showing the percentage of cytokine positive antigen- specifc CD4 T cells at 4wp3 (day 69) after immunization using the dose immunization regimen described in Figure 1 and Example VI, Table VI- 1. Splenocytes were restimulated in vitro with gHsol/gL protein.
  • Figure 3 is a graph showing the percentage of cytokine positive antigen- specific CD8 T cells at 4wp3 (day 69) after immunization using the dose immunization regimen described in Figure 1 and Example VI, Table VI- 1. Splenocytes were restimulated in vitro with gH peptide pool 2.
  • Figure 4 is a graph showing self amplifying RNA and subunit, alone or in combination, elicit high neutralizing antibody titers.
  • the self amplifying RNA was encapsulated in LNPs.
  • Self amplifying RNA and subunit dose was ⁇ ⁇ , mixed dose was 1+1 ⁇ g.
  • Neutralizing assay VR1814 infection of ARPE-19 cells in presence of complement.
  • Figures 5A and 5B are graphs showing CD4+ T cell responses to the vaccinations using purified gH/gL and pentameric subunits at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • Figures 6A and 6B are graphs showing CD4+ T cell responses to the vaccinations using purified pentameric complex at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • Figures 7A and 7B are graphs showing CD8+ T cell responses to the vaccinations using purified pentameric complex at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • Figures 7A and 7B are graphs showing CD8+ T cell responses to the vaccinations using purified pentameric complex at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • Figures 8A and 8B are graphs showing CD8+ T cell responses to the vaccinations using gH peptide pool 2 at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • Figure 9 is a graph showing high neutralizing antibody titers in Balb/c mice that were administered RSV-F-RNA vaccine prime, followed by RSV-F subunit vaccine boost. Mice were administered the vaccine intramuscularly on days 0, 21 and 44, and bleeds were taken on days 35 and 57.
  • Figure 10 is a graph showing the F-specific IgG2a:IgGl ratio in Balb/c mice that were administered the RSV-F-RNA vaccine. The F-RNA vaccine is potent at setting a Thl immune response, that is maintained after a F subunit vaccine boost. Mice were administered vaccinations intramuscularly on days 0, 21 and 44, and bleeds were taken on days 35 and 57. The spleens of the mice were harvested on day 57.
  • FIGS 11 A-l 1C are graphs showing the effect of adjuvant on subunit boost. Even though a very low dose of RNA (300 pg) does not induce a measurable RSV-specific antibody response in BALB/c mice (A), it is sufficient to set a Thl -biased phenotype after a subunit vaccine boost (IgG2a-biased, no significant IL-5) (B and C). Subunit vaccine adjuvant (none, alum or MF59) has little impact on the magnitude of the neutralizing antibody titer induced by RNA vaccine prime, subunit vaccine boost.
  • RNA molecules are self- adjuvanting.
  • RNA molecules formulated in liposomes
  • IFN-a IFN-a
  • IP-10 IFN-a
  • IL-6 IFN-a
  • KC CXCL1
  • IL-5 IFN-a
  • IL-13 IFN-a
  • MCP-1 KC
  • ⁇ - ⁇ IL-5
  • IL-13 IFN-a
  • MCP-1 KC
  • ⁇ - ⁇ RNA vaccines.
  • the cytokines can enhance the host immune response to the protein antigen that was encoded by the RNA molecule.
  • Vaccination strategies that combine an RNA molecule and a polypeptide molecule (e.g., administering an immunogenic composition that has an RNA component and a protein component; or sequential administration regimens such as "RNA prime, protein boost") provide several benefits.
  • the polypeptide molecule can enhance total antibody titers in the host, while the RNA molecule can enhance the production of antibodies that recognize an antigen in its native structure.
  • the combination can induce an antibody response with an enhanced ratio of functional antibodies (e.g., neutralizing antibodies) to total antibodies.
  • RNA molecules promote type 1 T helper responses (Thl, IFN- ⁇ 111 , IL-4 lG ), whereas protein molecules promote type 2 T helper responses.
  • RNA molecules may be delivered to cells using delivery systems such as liposomes or oil-in- water emulsions. Liposomes and oil-in-water emulsions are also known to have adjuvant activities. Thus, the adjuvant activity of the RNA together with adjuvant activity of the delivery system can act synergistically to enhance the immune response to an antigen.
  • multivalency may be achieved by combining a polypeptide antigen with an RNA that encodes a different antigen from the same pathogen.
  • the invention relates to immunogenic compositions that comprise an RNA component and a polypeptide component.
  • Immunogenic compositions that deliver antigenic epitopes in two different forms - a first epitope from a pathogen, in RNA- coded form; and a second epitope from the same pathogen, in polypeptide form - can enhance the immune response to the pathogen.
  • the first epitope and the second epitope are the same epitope (i.e., the first antigen, in RNA-coded form, and the second antigen, in polypeptide form, share at least one common epitope).
  • the RNA component of the immunogenic composition can encode a protein that is substantially the same as the polypeptide component of the immunogenic composition (e.g., the amino acid sequence encoded by the RNA molecule and the polypeptide component of the immunogenic composition share at least about 90% sequence identity across the length of the shorter antigen).
  • the two antigens have the same epitope, such as the same immunodominant epitope(s).
  • immunogenic compositions that comprise (i) a self-replicating RNA molecule that encodes a viral antigen, and (ii) the viral antigen in polypeptide form.
  • Viral antigens that were used in these studies include HIV gpl40 and RSV-F antigens. The results demonstrated that coadministering an RNA molecule that encodes a viral antigen, together with the viral antigen in polypeptide form, potentiated the immune response to the antigen, resulting in higher antibody titers as compared to administering the RNA molecule alone.
  • the immunogenic compositions described herein can be formulated as a vaccine to induce or enhance the host immune response to a pathogen. Also provided herein are methods of using the immunogenic compositions of the invention to induce or enhance an immune response in a subject in need thereof.
  • the invention in another aspect, relates to a kit comprising: (i) a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope, and (ii) a boosting composition comprising a second polypeptide antigen that comprises a second epitope; wherein said first epitope and second epitope are the same epitope (i.e., the first antigen, in RNA-coded form, and the second antigen, in polypeptide form, share at least one common epitope).
  • the kit may be used for sequential administration of the priming and the boosting compositions.
  • the invention relates to a method for treating or preventing an infectious disease, a method for inducing an immune response in a subject, or a method of vaccinating a subject, comprising: (i) administering to a subject in need thereof at least once a therapeutically effective amount of a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope, and (ii) subsequently administering the subject at least once a therapeutically effective amount of a boosting composition comprising a second polypeptide antigen that comprises a second epitope; wherein said first epitope and second epitope are the same epitope (i.e., the first antigen, in RNA-coded form, and the second antigen, in polypeptide form, share at least one common epitope).
  • RNA prime, protein boost vaccination strategies As described herein, the inventors have evaluated RNA prime, protein boost vaccination strategies. These studies demonstrate several benefits of the RNA prime, protein boost strategy, as compared to a protein prime, protein boost strategy, including, for example, increased antibody titers, a more balanced IgGi:IgG 2a subtype profile, induction of T H 1 type, CD4+ T cell-mediated immune response that was similar to that of viral particles, and reduced production of non-neutralizing antibodies.
  • the RNA molecule in the priming composition encodes a protein that is substantially the same as the polypeptide molecule in the boosting composition (e.g., the amino acid sequence encoded by the RNA molecule in the priming composition and the polypeptide in the boosting composition share at least about 90% sequence identity across the length of the shorter antigen).
  • the two antigens have the same epitope, such as the same immunodominant epitope(s).
  • the priming and boosting compositions described herein can be formulated as a vaccine to induce or enhance the immune response to a pathogen. Also provided herein are methods of using the priming and boosting compositions of the invention to induce or enhance an immune response in a subject in need thereof.
  • the invention also relates to immunogenic compositions, pharmaceutical compositions, or kits as described herein for use in therapy, and to the use of immunogenic compositions, pharmaceutical compositions, or kits as described herein for the manufacture of a medicament for enhancing or generating an immune response.
  • the invention provides an immunogenic composition comprising an RNA component and a polypeptide component.
  • the immunogenic composition comprises: (i) a self-replicating RNA molecule that encodes a first polypeptide antigen comprising a first epitope (the RNA component); and (ii) a second polypeptide antigen comprising a second epitope (the polypeptide component); wherein said first epitope and second epitope are epitopes from the same pathogen.
  • the first epitope and second epitope can be the same epitope, or different epitopes if desired.
  • the first epitope and second epitope can be from the same polypeptide of the pathogen, or different polypeptides of the pathogen.
  • the first epitope and second epitope can also be epitopes which are highly conserved between different strains or subspecies of the pathogen, such as those epitopes with limited or no mutational variations.
  • the first epitope and the second epitope can be different epitopes from the same pathogen (e.g., the first epitope is from RSV F and the second epitope is from RSV G).
  • the first polypeptide antigen and the second polypeptide antigen are derived from the same protein from the pathogen.
  • the RNA molecule may encode a first polypeptide antigen comprising a full-length protein from a pathogen (e.g. , a viral protein), or an antigenic portion thereof, optionally fused with a heterologous sequence that may facilitate the expression, production, purification or detection of the viral protein encoded by the RNA.
  • the second polypeptide antigen may be a recombinant protein comprising the full-length protein, or an antigenic portion thereof, optionally fused with a heterologous sequence (e.g., His-tag) that may facilitate the expression, production, purification or detection of the second polypeptide antigen.
  • a heterologous sequence e.g., His-tag
  • the first polypeptide antigen, the second polypeptide antigen, or both may comprise a mutation variant of a protein from a pathogen (e.g., a viral protein having amino acid substitution(s), addition(s), or deletion(s)).
  • a pathogen e.g., a viral protein having amino acid substitution(s), addition(s), or deletion(s)
  • the amino acid sequence identity between the first polypeptide antigen and the second polypeptide antigen is at least about 40%, least about 50%, least about 60%, least about 65%, least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%.
  • the first polypeptide antigen and the second polypeptide antigen are the same antigen.
  • the first polypeptide antigen and the polypeptide second antigen share at least 1, at least 2, at least 3, at least 4, or at least 5 common B-cell or T-cell epitopes. In certain embodiments, the first polypeptide antigen and the second polypeptide antigen have at least one common immunodominant epitope. In certain embodiments, the first polypeptide antigen and the second polypeptide antigen have the same immunodominant epitope(s), or the same primary immunodominant epitope.
  • the first polypeptide antigen is a soluble or membrane anchored polypeptide
  • the second polypeptide antigen is a soluble polypeptide.
  • the wild type viral protein is a transmembrane surface protein
  • the RNA molecule may comprise the full-length coding sequence to produce the first (membrane-anchored) antigen, while the transmembrane region of the viral protein may be deleted to produce the second polypeptide antigen (which is soluble).
  • the first antigen or the second antigen is a fusion polypeptide further comprising a third epitope.
  • the third epitope may be from a different pathogen, or from a different antigen of the same pathogen.
  • Antigens suitable for inclusion in the immunogenic compositions described herein may be derived from any pathogen (e.g., a bacterial pathogen, a viral pathogen, a fungal pathogen, a protozoan pathogen, or a multi-cellular parasitic pathogen), allergen or tumor.
  • pathogen e.g., a bacterial pathogen, a viral pathogen, a fungal pathogen, a protozoan pathogen, or a multi-cellular parasitic pathogen
  • the first and second antigens are derived from a viral pathogen.
  • viral pathogens include, e.g., respiratory syncytial virus (RSV), hepatitis B virus (HBV), hepatitis C virus (HCV), Dengue virus, herpes simplex virus (HSV; e.g., HSV-I, HSV-II), molluscum contagiosum virus, vaccinia virus, variola virus, lentivirus, human immunodeficiency virus (HIV), human papilloma virus (HPV), cytomegalovirus (CMV), varicella zoster virus (VZV), rhino virus, enterovirus, adenovirus, coronavirus (e.g., SARS), influenza virus (flu), para-influenza virus, mumps virus, measles virus, papovavirus, hepadnavirus, flavivirus, retrovirus, arenavirus (e.g., Lymp
  • the first and second antigens are derived from a virus which infects fish, such as: infectious salmon anemia virus (ISAV), salmon pancreatic disease virus (SPDV), infectious pancreatic necrosis virus (IPNV), channel catfish virus (CCV), fish lymphocystis disease virus (FLDV), infectious hematopoietic necrosis virus (IHNV), koi herpesvirus, salmon picorna-like virus (also known as picorna-like virus of atlantic salmon), landlocked salmon virus (LSV), atlantic salmon rotavirus (ASR), trout strawberry disease virus (TSD), coho salmon tumor virus (CSTV), or viral hemorrhagic septicemia virus (VHSV).
  • infectious salmon anemia virus ISAV
  • SPDV salmon pancreatic disease virus
  • IPNV infectious pancreatic necrosis virus
  • CCV channel catfish virus
  • FLDV fish lymphocystis disease virus
  • IHNV infectious hematopoietic necrosis virus
  • the first and second antigens are derived from a parasite from the Plasmodium genus, such as P. falciparum, P.vivax, P.malariae or P. ovale. Thus the invention may be used for immunising against malaria.
  • the first and second antigens are derived from a parasite from the Caligidae family, particularly those from the Lepeophtheirus and Caligus genera e.g. sea lice such as Lepeophtheirus salmonis or Caligus rogercresseyi.
  • first and second antigens are derived from a bacterial pathogen.
  • Exemplary bacterial pathogens include, e.g., Neisseria spp, including N. gonorrhea and N. meningitides; Streptococcus spp, including S. pneumoniae, S. pyogenes, S. agalactiae, S. mutans; Haemophilus spp, including H. influenzae type B, non typeable H. influenzae, H. ducreyi; Moraxella spp, including M. catarrhalis, also known as Branhamella catarrhalis; Bordetella spp, including B. pertussis, B. parapertussis and B. bronchiseptica;
  • Neisseria spp including N. gonorrhea and N. meningitides
  • Streptococcus spp including S. pneumoniae, S. pyogenes, S. agalactiae, S. mutans
  • Haemophilus spp including H. influenza
  • Mycobacterium spp. including M. tuberculosis, M. bovis, M. leprae, M. avium, M.
  • paratuberculosis M. smegmatis
  • Legionella spp including L. pneumophila
  • Escherichia spp including enterotoxic E. coli, enterohemorragic E. coli, enteropathogenic E. coli
  • Vibrio spp including V. cholera, Shigella spp, including S. sonnei, S. dysenteriae, S. flexnerii
  • Yersinia spp including Y. enterocolitica, Y. pestis, Y. pseudotuberculosis, Campylobacter spp, including C. jejuni and C. coli
  • Salmonella spp including S. typhi, S. paratyphi, S.
  • choleraesuis S. enteritidis
  • Listeria spp. including L. monocytogenes
  • Helicobacter spp including H pylori
  • Pseudomonas spp including P. aeruginosa
  • Staphylococcus spp. including S. aureus, S. epidermidis
  • Enterococcus spp. including E. faecalis, E. faecium
  • Clostridium spp. including C. tetani, C. botulinum, C. difficile
  • Bacillus spp. including B. anthracis
  • Corynebacterium spp. including C. diphtheriae
  • Borrelia spp. including B.
  • Ehrlichia spp. including E. equi and the agent of the Human Granulocytic Ehrlichiosis; Rickettsia spp, including R. rickettsii; Chlamydia spp., including C. trachomatis, C. neumoniae, C. psittaci; Leptsira spp., including L. interrogans; Treponema spp., including T. pallidum, T. denticola, T. hyodysenteriae.
  • first and second antigens are derived from a fungal pathogen (e.g., a yeast or mold pathogen).
  • exemplary fungal pathogens include, e.g., Aspergillus fumigatus, A. flavus, A. niger, A. terreus, A. nidulans, Coccidioides immitis, Coccidioides posadasii, Cryptococcus neoformans, Histoplasma capsulatum, Candida albicans, and Pneumocystis jirovecii.
  • first and second antigens are derived from a protozoan pathogen.
  • exemplary protozoan pathogens include, e.g., Toxoplasma gondii and Strongyloides stercoralis.
  • the first and second antigens are derived from a multicellular parasitic pathogen.
  • exemplary multicellular parasitic pathogens include, e.g., trematodes (flukes), cestodes (tapeworms), nematodes (roundworms), and arthropods.
  • the first and second antigens are derived from an allergen, such as pollen allergens (tree-, herb, weed-, and grass pollen allergens); insect or arachnid allergens (inhalant, saliva and venom allergens, e.g.
  • mite allergens cockroach and midges allergens, hymenopthera venom allergens); animal hair and dandruff allergens (from e.g. dog, cat, horse, rat, mouse, etc.); and food allergens (e.g. a gliadin).
  • Important pollen allergens from trees, grasses and herbs are such originating from the taxonomic orders of Fagales, Oleales, Pinales and platanaceae including, but not limited to, birch (Betula), alder (Alnus), hazel (Corylus), hornbeam (Carpinus) and olive (Olea), cedar (Cryptomeria and Juniperus), plane tree (Platanus), the order of Poales including grasses of the genera Lolium, Phleum, Poa, Cynodon, Dactylis, Holcus, Phalaris, Secale, and Sorghum, the orders of Asterales and Urticales including herbs of the genera Ambrosia, Artemisia, and Parietaria.
  • Other important inhalation allergens are those from house dust mites of the genus
  • Dermatophagoides and Euroglyphus storage mite e.g. Lepidoglyphys, Glycyphagus and Tyrophagus, those from cockroaches, midges and fleas e.g. Blatella, Periplaneta, Chironomus and Ctenocepphalides, and those from mammals such as cat, dog and horse, venom allergens including such originating from stinging or biting insects such as those from the taxonomic order of Hymenoptera including bees (Apidae), wasps (Vespidea), and ants (Formicoidae).
  • the first and second antigens are derived from a tumor antigen selected from: (a) cancer-testis antigens such as NY-ESO-1, SSX2, SCP1 as well as RAGE, BAGE, GAGE and MAGE family polypeptides, for example, GAGE-1, GAGE-2, MAGE-1, MAGE-2, MAGE-3, MAGE-4, MAGE-5, MAGE-6, and MAGE- 12 (which can be used, for example, to address melanoma, lung, head and neck, NSCLC, breast,
  • cancer-testis antigens such as NY-ESO-1, SSX2, SCP1 as well as RAGE, BAGE, GAGE and MAGE family polypeptides, for example, GAGE-1, GAGE-2, MAGE-1, MAGE-2, MAGE-3, MAGE-4, MAGE-5, MAGE-6, and MAGE- 12 (which can be used, for example, to address melanoma, lung, head and neck, NSCLC, breast,
  • mutated antigens for example, p53 (associated with various solid tumors, e.g., colorectal, lung, head and neck cancer), p21/Ras (associated with, e.g., melanoma, pancreatic cancer and colorectal cancer), CDK4 (associated with, e.g., melanoma), MUMl (associated with, e.g., melanoma), caspase-8 (associated with, e.g., head and neck cancer), CIA 0205 (associated with, e.g., bladder cancer), HLA-A2-R1701, beta catenin (associated with, e.g., melanoma), TCR (associated with, e.g., T-cell non-Hodgkins lymphoma), BCR-abl (associated with, e.g., chronic myelogenous leukemia), triosephosphate isomerase, KIA 0205, CDC-
  • tumor immunogens include, but are not limited to, pi 5, Hom/Mel-40, H-Ras, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, EBNA, human papillomavirus (HPV) antigens, including E6 and E7, hepatitis B and C virus antigens, human T-cell lymphotropic virus antigens, TSP-180, pl85erbB2, pl80erbB-3, c-met, mn-23Hl, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, pl6, TAGE, PSCA, CT7, 43-9F, 5T4, 791 Tgp72, beta-HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29 ⁇ BCAA), CA 195, CA 242, CA-50, CAM43, CD68 ⁇ KP1, CO-029,
  • the pathogen is RSV.
  • RSV is an enveloped non-segmented negative-strand RNA virus in the family Paramyxoviridae, genus Pneumovirus.
  • paramyxoviruses such as RSV, like other enveloped viruses such as influenza virus and HIV, require fusion of the viral membrane with a host cell's membrane.
  • the conserved fusion protein (RSV-F glycoprotein) fuses the viral and cellular membranes by coupling irreversible protein refolding with juxtaposition of the membranes. In current models based on paramyxovirus studies, the RSV-F protein initially folds into a metastable "pre-fusion" conformation.
  • pre-fusion conformation undergoes refolding and conformational changes to its stable "post-fusion” conformation. See, also, Swanson et al, PNAS USA 108(23):9619-9624 (2011) regarding pre-fusion and post-fusion RSV-F structures.
  • the first and second antigens are from RSV.
  • the first and second antigens can independently be derived from the RSV surface glycoproteins Fusion (F), Glycoprotein (G), Small Hydrophobic protein (SH), the matrix proteins M and M2, the nucleocapsid proteins N, P and L, and the nonstructural proteins NS 1 and NS2.
  • the first and second antigens are each an RSV-F antigen.
  • the F glycoprotein of RSV is a type I single-pass integral membrane protein having four general domains: N-terminal ER-translocating signal sequence (SS), ectodomain (ED), transmembrane domain (TM), and a cytoplasmic tail (CT).
  • SS N-terminal ER-translocating signal sequence
  • ED ectodomain
  • TM transmembrane domain
  • CT cytoplasmic tail
  • the RSV-F glycoprotein is translated from mRNA into an approximately 574 amino acid protein designated F 0 .
  • Post-translational processing of Fo includes removal of an N-terminal signal peptide by a signal peptidase in the endoplasmic reticulum.
  • F 0 is also cleaved at two sites (approximately 109/110 and approximately 136/137) by cellular proteases (in particular furin) in the trans-Golgi.
  • Fi contains a hydrophobic fusion peptide at its N-terminus and also two amphipathic heptad-repeat regions (HRA and HRB). HRA is near the fusion peptide and HRB is near the transmembrane domain.
  • HRA is near the fusion peptide and HRB is near the transmembrane domain.
  • Three F1-F2 heterodimers are assembled as homotrimers of F1-F2 in the virion.
  • compositions described herein, either in RNA enconded form or as polypeptides include RSV-F glycoprotein and RSV-F glycoprotein variants.
  • Suitable RSV-F glycoprotein variants include, for example, full length F protein and truncated variants such as soluble ecto- domains, each optionally containing one or more mutations, such as furin-cleavage mutations, trypsin-cleavage mutations, fusion peptide mutations (e.g., deletions in whole or in part), mutations that stabilize the HRB trimer, and mutations that destabilize the HRA trimer.
  • WO201 1/008974 which disclose exemplary RSV-F antigens that can be used, in RNA form or as polypeptides, in the immunogenic compositions: (i) page 15, line 20 through page 16, line 27, which describes RSV-F, its amino acid sequence and domain structure; (ii) page 16, line 28 through page 18, line 1 1, which describes soluble ectodomains of RSV-F; (iii) page 18, line 14 through page 20, line 15, which describes furin-cleavage mutations, trypsin- cleavage mutations, fusion peptide mutations; (iv) page 20, line 16 through page 21, line 8, and page 26, line 29 through page 30, line 14, which describe optional oligomerization sequences; (v) page 20, lines 9-24, which describe introduced protease cleavage sites; (vi) and page 30, line 18 through page 32, line 18, which describe mutations that stabilize the HRB trimer, destabilize the HRA trimer and other mutations that can be included.
  • sequence of amino acid residue 100- 150 of the RSV-F glycoprotein such as SEQ ID NO: l or SEQ ID NO:2 disclosed in
  • WO201 1/008974 or the soluble ecto domains thereof, is:
  • ASAIAS SEQ ID NO: 36
  • sequence of the RSV-F antigen comprises:
  • sequences presented above contain a signal peptide and a HIS tag.
  • the RSV-F protein used in the invention can contain any of the amino acid sequences shown above, with or without the signal peptide and/or HIS tag.
  • RSV F antigens examples include SEQ ID NOS: 6, 8 and 10 as disclosed in WO2009/079796 at pages 58-60, which are incorporated herein by reference.
  • the RSV-F polypeptide suitable for inclusion in the immunogenic compositions described herein may be in any desired form and conformation, including any desired mixture of forms and conformations.
  • the RSV-F polypeptide can be a monomer, or can be a trimer comprising three monomer polypeptides. Trimers can be
  • the immunogenic compositions may comprise RSV-F polypeptides that are monomers, trimers, a combination of monomers and trimers (e.g., in dynamic equilibrium), rosettes of trimers, and any combination of the foregoing.
  • RSV-F forms and conformations of RSV-F, including monomers, trimers, a combination of monomers and trimers (e.g., in dynamic equilibrium), rosettes of trimers, cleaved and uncleaved forms, and pre-fusion and post-fusion forms are well known in the art, and are disclosed for example in WO201 1/008974, the disclosure of which is incorporated herein by reference in its entirety.
  • the pathogen is CMV
  • the first and second antigens are independently derived from CMV.
  • the first and second antigens are derived from a capsid protein, an envelope glycoprotein (such as gB, gH, gL, gM, gN), or a tegument protein.
  • the first and second antigens are derived from one or more of the following proteins: pp65, IE1, gB, gD, gH, gL, gM, gN, gO, UL128, UL129, gUL130, UL150, UL131, UL33, UL78, US27, US28, RL5A, RL6, RLIO, RLl l, RL12, RL13, UL1, UL2, UL4, UL5, UL6, UL7, UL8, UL9, UL10, UL1 1, UL14, UL15A, UL16, UL17, UL18, UL22A, UL38, UL40, UL41A, UL42, UL116, UL119, UL120, UL121, UL124, UL132, UL147A, UL148, UL142, UL144, UL141, UL140, UL135, UL136,
  • the CMV antigen may also be a fusion polypeptide of one or more
  • CMV proteins such as pp65/IEl (Reap et ah, Vaccine (2007) 25:7441-7449), gH/gL
  • Suitable CMV antigens include gB, gH, gL, gO, and can be from any
  • CMV proteins can be from Merlin, AD 169, VR1814, Towne, Toledo, TR, PH, TB40, or Fix strains of CMV.
  • Exemplary sequences of CMV proteins that may be used for the invention are shown in Table 1.
  • CMV gM FL Full length gM polynucleotide
  • CMV gM FL Full length gM polypeptide
  • CMV gN FL Full length gN polynucleotide
  • CMV gN FL Full length gN polypeptide (CMV gN FL) SEQ ID NO: 16
  • the first antigen, the second antigen, or both may be a gB antigen.
  • a gB antigen can be full length gB protein or can omit one or more regions of the protein. Alternatively, fragments of a gB protein can be used.
  • gB amino acids are numbered according to the full-length gB amino acid sequence (CMV gB FL) shown in SEQ ID NO: 2, which is 907 amino acids long.
  • Suitable regions of a gB protein which can be excluded from the full-length protein or included as fragments include: the signal sequence (amino acids 1-24), a gB-DLD disintegrin-like domain (amino acids 57-146), a furin cleavage site (amino acids 459-460), a heptad repeat region (679-693), a membrane spanning domain (amino acids 751-771), and a cytoplasmic domain from amino acids 771- 906.
  • a gB antigen includes amino acids 67-86 (Neutralizing Epitope AD2) and/or amino acids 532-635 (Immunodominant Epitope AD1).
  • gB antigens include "gB sol 692,” which includes the first 692 amino acids of gB, and "gB sol 750,” which includes the first 750 amino acids of gB.
  • the signal sequence, amino acids 1-24, can be present or absent from gB sol 692 and gB sol 750 as desired.
  • the gB antigen is a gB fragment of 10 amino acids or longer.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 550, 575, 600, 625, 650, 675, 700, 725, 750, 775, 800, 825, 850, or 875 amino acids.
  • the invention may also use a gB antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 2 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 2).
  • gB antigens comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 2 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 2).
  • the first antigen, the second antigen, or both may be a gH antigen.
  • a gH antigen can be a full-length gH protein (CMV gH FL, SEQ ID NO: 8, for example, which is a 743 amino acid protein).
  • gH has a membrane spanning domain and a cytoplasmic domain starting at position 716 to position 743. Removing amino acids from 717 to 743 provides a soluble gH (e.g., CMV gH sol, SEQ ID NO: 10).
  • the gH antigen is a gH fragment of 10 amino acids or longer.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 550, 575, 600, 625, 650, 675, 700, or 725 amino acids.
  • the invention may also use a gH antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 8 or 10 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 8 or 10).
  • gL Antigens comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 8 or 10 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 8 or 10).
  • the first antigen, the second antigen, or both may be a gL antigen.
  • a gL antigen can be a full-length gL protein (CMV gL FL, SEQ ID NO: 12, for example, which is a 278 amino acid protein).
  • CMV gL FL full-length gL protein
  • SEQ ID NO: 12 for example, which is a 278 amino acid protein
  • a gL fragment can be used.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 225, or 250 amino acids.
  • the invention may also use a gL antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 12 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 12).
  • gO Antigens comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 12 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 12).
  • the first antigen, the second antigen, or both may be a gO antigen.
  • a gO antigen can be a full-length gO protein (CMV gO FL, SEQ ID NO: 18, for example, which is a 472 amino acid protein).
  • the gO antigen can be a gO fragment of 10 amino acids or longer.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, or 450 amino acids.
  • the invention may also use a gO antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 18 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 18).
  • gO antigens comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 18 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 18).
  • the first antigen, the second antigen, or both may be a gM antigen.
  • a gM antigen can be a full-length gM protein (CMV gM FL, SEQ ID NO: 14, for example, which is a 371 amino acid protein).
  • the gM antigen can be a gM fragment of 10 amino acids or longer.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, or 350 amino acids.
  • the invention may also use a gM antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 14 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 14).
  • gM antigens comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 14 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 14).
  • the first antigen, the second antigen, or both may be a gN antigen.
  • a gN antigen can be a full-length gN protein (CMV gN FL, SEQ ID NO: 16, for example, which is a 135 amino acid protein).
  • the gN antigen can be a gN fragment of 10 amino acids or longer.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, or 125 amino acids.
  • the invention may also use a gN antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 16 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 16).
  • a gN antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 16 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 16).
  • the first antigen, the second antigen, or both may be a UL128 antigen.
  • a UL128 antigen can be a full-length UL128 protein (CMV UL128 FL, SEQ ID NO:20, for example, which is a 171 amino acid protein).
  • the UL128 antigen can be a UL128 fragment of 10 amino acids or longer.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, or 150 amino acids.
  • the invention may also use a UL128 antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 20 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 20).
  • the first antigen, the second antigen, or both may be a UL130 antigen.
  • a UL130 antigen can be a full-length UL130 protein (CMV UL130 FL, SEQ ID NO:22, for example, which is a 214 amino acid protein).
  • the UL130 antigen can be a UL130 fragment of 10 amino acids or longer.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, or 200 amino acids.
  • the invention may also use a UL130 antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 22 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 22).
  • the first antigen, the second antigen, or both may be a UL131 antigen.
  • a UL131 antigen can be a full-length UL131 protein (CMV UL131, SEQ ID NO:24, for example, which is a 129 amino acid protein).
  • the UL131 antigen can be a UL131 fragment of 10 amino acids or longer.
  • the number of amino acids in the fragment can comprise 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, or 200 amino acids.
  • the invention may also use a UL131 antigen comprising an amino acid sequence that is at least 75% identical to SEQ ID NO: 24 (e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 24).
  • the CMV antigen may be a fusion polypeptide.
  • the antigen may comprise a first domain and a second domain, wherein (i) the first domain comprises a first CMV antigen and (ii) the second domain comprises a second CMV antigen.
  • the first CMV antigen and the second CMV antigen are independently selected from a gB, gH, gL, gO, gM, gN, UL128, UL130, or UL131 antigen described above.
  • Two or more CMV antigens may also be co-delivered in the form of a complex, or in a form that can form a complex in vivo (e.g., gH/gL complex, gM/gN complex, gH/gL/UL128/UL130/UL131 pentameric compelx).
  • a complex in vivo e.g., gH/gL complex, gM/gN complex, gH/gL/UL128/UL130/UL131 pentameric compelx.
  • immunogenic composition may comprise an RNA molecule that encode two or more separate proteins, e.g, gH and gL.
  • the immunogenic composition may also comprise two or more polypeptide antigens, e.g., gH and gL.
  • the immunogenic composition described herein comprises an RNA component and a polypeptide component.
  • the RNA is a self-replicating RNA.
  • the composition can contain more than one RNA molecule encoding an antigen, e.g., two, three, five, ten or more RNA molecules.
  • one RNA molecule may also encode more than one antigen, e.g., a bicistronic, or tricistronic RNA molecule that encodes different or identical antigens.
  • RNA molecule may be codon optimized or deoptimized for expression in a desired host, such as a human cell.
  • the sequence of the RNA molecule may be modified if desired, for example to increase the efficacy of expression or replication of the RNA, or to provide additional stability or resistance to degradation.
  • the RNA sequence can be modified with respect to its codon usage, for example, to increase translation efficacy and half-life of the RNA.
  • a poly A tail e.g., of about 30 adenosine residues or more
  • the 5' end of the RNA may be capped with a modified ribonucleotide with the structure m7G (5') ppp (5') N (cap 0 structure) or a derivative thereof, which can be incorporated during RNA synthesis or can be enzymatically engineered after RNA transcription (e.g., by using Vaccinia Virus Capping Enzyme (VCE) consisting of mRNA triphosphatase, guanylyl- transferase and guanine-7- methytransferase, which catalyzes the construction of N7-monomethylated cap 0 structures).
  • VCE Vaccinia Virus Capping Enzyme
  • Cap 0 structure plays an important role in maintaining the stability and translational efficacy of the RNA molecule.
  • the 5' cap of the RNA molecule may be further modified by a 2 '-0- Methyltransferase which results in the generation of a cap 1 structure (m7Gppp [m2 '- ⁇ ] N), which may further increases translation efficacy.
  • the RNA molecule can comprise one or more modified nucleotides in addition to any 5 ' cap structure.
  • modified nucleoside modifications found on mammalian RNA. See, e.g., Limbach et ah, Nucleic Acids Research, 22(12):2183-2196 (1994).
  • the preparation of nucleotides and modified nucleotides and nucleosides are well-known in the art, e.g. from US Patent Numbers
  • Modified nucleobases which can be incorporated into modified nucleosides and nucleotides and be present in the RNA molecules include: m5C (5- methylcytidine), m5U (5-methyluridine), m6A (N6-methyladenosine), s2U (2-thiouridine), Um (2'-0-methyluridine), mlA (1-methyladenosine); m2A (2-methyladenosine); Am (2-1-0- methyladenosine); ms2m6A (2-methylthio-N6-methyladenosine); i6A (N6- isopentenyladenosine); ms2i6A (2-methylthio-N6isopentenyladenosine); io6A (N6-(cis- hydroxyisopentenyl)adenosine); ms2io6A (2-methylthio-N6-(cis-hydroxyisopentenyl)adenos
  • the RNA molecule can contain phosphoramidate, phosphorothioate, and/or methylphosphonate linkages.
  • the RNA molecule does not include modified nucleotides, e.g., does not include modified nucleobases, and all of the nucleotides in the RNA molecule are conventional standard ribonucleotides A, U, G and C, with the exception of an optional 5' cap that may include, for example, 7-methylguanosine.
  • modified nucleotides e.g., does not include modified nucleobases
  • all of the nucleotides in the RNA molecule are conventional standard ribonucleotides A, U, G and C, with the exception of an optional 5' cap that may include, for example, 7-methylguanosine.
  • the RNA may include a 5' cap comprising a 7'-methylguanosine, and the first 1, 2 or 3 5' ribonucleotides may be methylated at the 2' position of the ribose.
  • the cationic oil in water emulsion contains a self- replicating RNA molecule.
  • the self-replicating RNA molecule is derived from or based on an RNA virus or a retrovirus.
  • the self- replicating RNA molecule is derived from or based on an alphavirus.
  • Self-replicating RNA molecules are well known in the art and can be produced by using replication elements derived from, e.g., alphaviruses, and substituting the structural viral proteins with a nucleotide sequence encoding a protein of interest.
  • Cells transfected with self-replicating RNA briefly produce of antigen before undergoing apoptotic death. This death is a likely result of requisite double-stranded (ds) RNA intermediates, which also have been shown to super-activate Dendritic Cells.
  • ds double-stranded
  • the enhanced immunogenicity of self-replicating RNA may be a result of the production of proinflammatory dsRNA, which mimics an RNA-virus infection of host cells.
  • the cell's machinery is used by self-replicating RNA molecules to generate an exponential increase of encoded gene products, such as proteins or antigens, which can accumulate in the cells or be secreted from the cells.
  • Encodingd gene products such as proteins or antigens
  • Overexpression of proteins or antigens by self-replicating RNA molecules takes advantage of the
  • immunostimulatory adjuvant effects including stimulation of toll-like receptors (TLR) 3, 7 and 8 and non TLR pathways (e.g, RIG-1, MD-5) by the products of RNA replication and amplification, and translation which induces apoptosis of the transfected cell.
  • TLR toll-like receptors
  • RIG-1 non TLR pathways
  • the self-replicating RNA generally contains at least one or more genes selected from the group consisting of viral replicases, viral proteases, viral helicases and other nonstructural viral proteins, and also comprise 5'- and 3'-end cz ' s-active replication sequences, and if desired, a heterologous sequences that encode a desired amino acid sequences (e.g., an antigen of interest).
  • a subgenomic promoter that directs expression of the heterologous sequence can be included in the self-replicating RNA.
  • the heterologous sequence e.g., an antigen of interest
  • the self-replicating RNA molecule is not encapsulated in a virus-like particle.
  • Self-replicating RNA molecules of the invention can be designed so that the self-replicating RNA molecule cannot induce production of infectious viral particles. This can be achieved, for example, by omitting one or more viral genes encoding structural proteins that are necessary for the production of viral particles in the self- replicating RNA.
  • the self-replicating RNA molecule is based on an alpha virus, such as Sinebis virus (SIN), Semliki forest virus and Venezuelan equine encephalitis virus (VEE), one or more genes encoding viral structural proteins, such as capsid and/or envelope glycoproteins, can be omitted.
  • an alpha virus such as Sinebis virus (SIN), Semliki forest virus and Venezuelan equine encephalitis virus (VEE)
  • Sindbis virus SIN
  • Semliki forest virus Semliki forest virus
  • VEE Venezuelan equine encephalitis virus
  • self-replicating RNA molecules of the invention can also be designed to induce production of infectious viral particles that are attenuated or virulent, or to produce viral particles that are capable of a single round of subsequent infection.
  • RNA molecules When delivered to a vertebrate cell, a self-replicating RNA molecule can lead to the production of multiple daughter RNAs by transcription from itself (or from an antisense copy of itself).
  • the self-replicating RNA can be directly translated after delivery to a cell, and this translation provides a RNA-dependent RNA polymerase which then produces transcripts from the delivered RNA.
  • the delivered RNA leads to the production of multiple daughter RNAs.
  • These transcripts are antisense relative to the delivered RNA and may be translated themselves to provide in situ expression of a gene product, or may be transcribed to provide further transcripts with the same sense as the delivered RNA which are translated to provide in situ expression of the gene product.
  • Alphaviruses comprise a set of genetically, structurally, and serologically related arthropod-borne viruses of the Togaviridae family. Twenty-six known viruses and virus subtypes have been classified within the alphavirus genus, including, Sindbis virus, Semliki Forest virus, Ross River virus, and Venezuelan equine encephalitis virus.
  • the self-replicating RNA of the invention may incorporate a RNA replicase derived from semliki forest virus (SFV), Sindbis virus (SIN), Venezuelan equine encephalitis virus (VEE), Ross-River virus (RRV), or other viruses belonging to the alphavirus family.
  • SFV semliki forest virus
  • SI Sindbis virus
  • VEE Venezuelan equine encephalitis virus
  • RRV Ross-River virus
  • alphavirus-based "replicon" expression vectors can be used in the invention.
  • Replicon vectors may be utilized in several formats, including DNA, RNA, and recombinant replicon particles.
  • Such replicon vectors have been derived from alphaviruses that include, for example, Sindbis virus (Xiong et al. (1989) Science 243 : 1 188-1 191;
  • Alphaviruses-derived replicons are generally quite similar in overall characteristics (e.g., structure, replication), individual alphaviruses may exhibit some particular property (e.g., receptor binding, interferon sensitivity, and disease profile) that is unique. Therefore, chimeric alphavirus replicons made from divergent virus families may also be useful.
  • Alphavirus-based replicons are (+)-stranded replicons that can be translated after delivery to a cell to give of a replicase (or replicase-transcriptase).
  • the replicase is translated as a polyprotein which auto-cleaves to provide a replication complex which creates genomic (-)-strand copies of the +-strand delivered RNA.
  • These (-)-strand transcripts can themselves be transcribed to give further copies of the (+)-stranded parent RNA and also to give a subgenomic transcript which encodes the desired gene product. Translation of the subgenomic transcript thus leads to in situ expression of the desired gene product by the infected cell.
  • Suitable alphavirus replicons can use a replicase from a Sindbis virus, a semliki forest virus, an eastern equine encephalitis virus, a Venezuelan equine encephalitis virus, etc.
  • a preferred self-replicating RNA molecule thus encodes (i) a RNA-dependent RNA polymerase which can transcribe RNA from the self-replicating RNA molecule and (ii) a polypeptide antigen.
  • the polymerase can be an alphavirus replicase e.g. comprising alphavirus protein nsP4.
  • an alphavirus based self- replicating RNA molecule of the invention does not encode alphavirus structural proteins.
  • the self-replicating RNA can lead to the production of genomic RNA copies of itself in a cell, but not to the production of RNA-containing alphavirus virions.
  • the inability to produce these virions means that, unlike a wild-type alphavirus, the self-replicating RNA molecule cannot perpetuate itself in infectious form.
  • alphavirus structural proteins which are necessary for perpetuation in wild-type viruses are absent from self-replicating RNAs of the invention and their place is taken by gene(s) encoding the desired gene product, such that the subgenomic transcript encodes the desired gene product rather than the structural alphavirus virion proteins.
  • a self-replicating RNA molecule useful with the invention may have two open reading frames.
  • the first (5') open reading frame encodes a replicase; the second (3') open reading frame encodes a polypeptide antigen.
  • the RNA may have additional (downstream) open reading frames e.g. that encode another desired gene products.
  • a self-replicating RNA molecule can have a 5' sequence which is compatible with the encoded replicase.
  • the self-replicating RNA molecule is derived from or based on a virus other than an alphavirus, preferably, a positive-stranded RNA virus, and more preferably a picornavirus, flavivirus, rubivirus, pestivirus, hepacivirus, calicivirus, or coronavirus.
  • a virus other than an alphavirus preferably, a positive-stranded RNA virus, and more preferably a picornavirus, flavivirus, rubivirus, pestivirus, hepacivirus, calicivirus, or coronavirus.
  • Suitable wild-type alphavirus sequences are well-known and are available from sequence depositories, such as the American Type Culture Collection, Rockville, Md.
  • alphaviruses include Aura (ATCC VR-368), Bebaru virus (ATCC VR-600, ATCC VR-1240), Cabassou (ATCC VR-922), Chikungunya virus (ATCC VR-64, ATCC VR-1241), Eastern equine encephalomyelitis virus (ATCC VR-65, ATCC VR-1242), Fort Morgan (ATCC VR-924), Getah virus (ATCC VR-369, ATCC VR- 1243), Kyzylagach (ATCC VR-927), Mayaro (ATCC VR-66), Mayaro virus (ATCC VR- 1277), Middleburg (ATCC VR-370), Mucambo virus (ATCC VR-580, ATCC VR-1244), Ndumu (ATCC VR-371), Pixuna virus (ATCC VR-372, ATCC VR-1245), Ross River virus (ATCC VR-373, ATCC VR-1246), Semliki Forest (ATCC VR-67, ATCC VR-1247), Sindbis virus (ATCC VR-68, ATCC
  • the self-replicating RNA molecules of the invention are larger than other types of RNA (e.g. mRNA).
  • the self-replicating RNA molecules of the invention contain at least about 4kb.
  • the self-replicating RNA can contain at least about 5kb, at least about 6kb, at least about 7kb, at least about 8kb, at least about 9kb, at least about lOkb, at least about 1 lkb, at least about 12kb or more than 12kb.
  • the self-replicating RNA is about 4kb to about 12kb, about 5kb to about 12kb, about 6kb to about 12kb, about 7kb to about 12kb, about 8kb to about 12kb, about 9kb to about 12kb, about lOkb to about 12kb, about 1 lkb to about 12kb, about 5kb to about 1 lkb, about 5kb to about lOkb, about 5kb to about 9kb, about 5kb to about 8kb, about 5kb to about 7kb, about 5kb to about 6kb, about 6kb to about 12kb, about 6kb to about 1 lkb, about 6kb to about lOkb, about 6kb to about 9kb, about 6kb to about 8kb, about 6kb to about 7kb, about 7kb to about 1 lkb, about 6kb to about lOkb, about 6kb to about 9kb
  • the self-replicating RNA molecules of the invention may comprise one or more modified nucleotides (e.g., pseudouridine, N6-methyladenosine, 5- methylcytidine, 5-methyluridine).
  • modified nucleotides e.g., pseudouridine, N6-methyladenosine, 5- methylcytidine, 5-methyluridine.
  • the self-replicating RNA molecule may encode a single polypeptide antigen or, optionally, two or more of polypeptide antigens linked together in a way that each of the sequences retains its identity (e.g., linked in series) when expressed as an amino acid sequence.
  • the polypeptides generated from the self-replicating RNA may then be produced as a fusion polypeptide or engineered in such a manner to result in separate polypeptide or peptide sequences.
  • the self-replicating RNA of the invention may encode one or more polypeptide antigens that contain a range of epitopes.
  • epitopes capable of eliciting either a helper T-cell response or a cytotoxic T-cell response or both.
  • the self-replicating RNA molecules described herein may be engineered to express multiple nucleotide sequences, from two or more open reading frames, thereby allowing co-expression of proteins, such as a two or more antigens together with cytokines or other immunomodulators, which can enhance the generation of an immune response.
  • proteins such as a two or more antigens together with cytokines or other immunomodulators, which can enhance the generation of an immune response.
  • Such a self-replicating RNA molecule might be particularly useful, for example, in the production of various gene products (e.g., proteins) at the same time, for example, as a bivalent or multivalent vaccine.
  • the self-replicating RNA molecules of the invention can be prepared using any suitable method. Several suitable methods are known in the art for producing RNA molecules that contain modified nucleotides. For example, a self-replicating RNA molecule that contains modified nucleotides can be prepared by transcribing (e.g., in vitro
  • RNA-dependent RNA polymerase such as T7 phage RNA polymerase, SP6 phage RNA polymerase, T3 phage RNA polymerase, and the like, or mutants of these polymerases which allow efficient incorporation of modified nucleotides into RNA molecules.
  • the transcription reaction will contain nucleotides and modified nucleotides, and other components that support the activity of the selected polymerase, such as a suitable buffer, and suitable salts.
  • nucleotide analogs into a self-replicating RNA may be engineered, for example, to alter the stability of such RNA molecules, to increase resistance against RNases, to establish replication after introduction into appropriate host cells ("infectivity" of the RNA), and/or to induce or reduce innate and adaptive immune responses.
  • Suitable synthetic methods can be used alone, or in combination with one or more other methods (e.g. , recombinant DNA or RNA technology), to produce a self- replicating RNA molecule of the invention.
  • Suitable methods for de novo synthesis are well- known in the art and can be adapted for particular applications. Exemplary methods include, for example, chemical synthesis using suitable protecting groups such as CEM (Masuda et al., (2007) Nucleic Acids Symposium Series 57:3-4), the ⁇ -cyanoethyl phosphoramidite method (Beaucage S L et al. (1981) Tetrahedron Lett 22: 1859); nucleoside H-phosphonate method (Garegg P et al.
  • Nucleic acid synthesis can also be performed using suitable recombinant methods that are well-known and conventional in the art, including cloning, processing, and/or expression of polynucleotides and gene products encoded by such polynucleotides. DNA shuffling by random fragmentation and PCR reassembly of gene fragments and synthetic polynucleotides are examples of known techniques that can be used to design and engineer polynucleotide sequences.
  • Site-directed mutagenesis can be used to alter nucleic acids and the encoded proteins, for example, to insert new restriction sites, alter glycosylation patterns, change codon preference, produce splice variants, introduce mutations and the like. Suitable methods for transcription, translation and expression of nucleic acid sequences are known and conventional in the art. (See generally, Current Protocols in Molecular Biology, Vol. 2, Ed. Ausubel, et al., Greene Publish. Assoc. & Wiley Interscience, Ch. 13, 1988; Glover, DNA Cloning, Vol. II, IRL Press, Wash., D.C., Ch.
  • a self-replicating RNA can be digested to monophosphates (e.g., using nuclease PI) and dephosphorylated (e.g., using a suitable phosphatase such as CIAP), and the resulting nucleosides analyzed by reversed phase HPLC (e.g., usings a YMC Pack ODS-AQ column (5 micron, 4.6 X 250 mm) and elute using a gradient, 30% B (0-5 min) to 100 % B (5 - 13 min) and at 100 % B (13-40) min, flow Rate (0.7 ml/min), UV detection (wavelength: 260 nm), column temperature (30°C).
  • monophosphates e.g., using nuclease PI
  • dephosphorylated e.g., using a suitable phosphatase such as CIAP
  • reversed phase HPLC e.g., usings a YMC Pack ODS-AQ column (5 micron, 4.6 X
  • the self-replicating RNA molecules of the invention may include one or more modified nucleotides so that the self-replicating RNA molecule will have less immunomodulatory activity upon introduction or entry into a host cell (e.g., a human cell) in comparison to the corresponding self-replicating RNA molecule that does not contain modified nucleotides.
  • a host cell e.g., a human cell
  • the self-replicating RNA molecules can be screened or analyzed to confirm their therapeutic and prophylactic properties using various in vitro or in vivo testing methods that are known to those of skill in the art.
  • vaccines comprising self-replicating RNA molecule can be tested for their effect on induction of proliferation or effector function of the particular lymphocyte type of interest, e.g., B cells, T cells, T cell lines, and T cell clones.
  • lymphocyte type of interest e.g., B cells, T cells, T cell lines, and T cell clones.
  • spleen cells from immunized mice can be isolated and the capacity of cytotoxic T lymphocytes to lyse autologous target cells that contain a self replicating RNA molecule that encodes a polypeptide antigen.
  • T helper cell differentiation can be analyzed by measuring proliferation or production of TH 1 (IL-2 and IFN- ⁇ ) and /or TH2 (IL-4 and IL-5) cytokines by ELISA or directly in CD4+ T cells by cytoplasmic cytokine staining and flow cytometry.
  • TH 1 IL-2 and IFN- ⁇
  • TH2 IL-4 and IL-5
  • Self-replicating RNA molecules that encode a polypeptide antigen can also be tested for ability to induce humoral immune responses, as evidenced, for example, by induction of B cell production of antibodies specific for an antigen of interest.
  • These assays can be conducted using, for example, peripheral B lymphocytes from immunized individuals. Such assay methods are known to those of skill in the art.
  • Other assays that can be used to characterize the self-replicating RNA molecules of the invention can involve detecting expression of the encoded antigen by the target cells.
  • FACS can be used to detect antigen expression on the cell surface or intracellularly. Another advantage of FACS selection is that one can sort for different levels of expression; sometimes-lower expression may be desired.
  • Other suitable method for identifying cells which express a particular antigen involve panning using monoclonal antibodies on a plate or capture using magnetic beads coated with monoclonal antibodies.
  • the self-replicating RNA of the invention may be delivered by a variety of methods, such as naked RNA delivery or in combination with lipids, polymers or other compounds that facilitate entry into the cells.
  • the RNA molecules of the present invention can be introduced into target cells or subjects using any suitable technique, e.g., by direct injection, microinjection, electroporation, lipofection, biolystics, and the like.
  • the immunogenic composition described herein comprises a polypeptide component and an RNA component.
  • the polypeptide component encompasses multi-chain polypeptide structures, such as a polypeptide complex (e.g., a complex formed by two or more proteins), or a large polypeptide structure, such as VLP.
  • Suitable antigens that can be used as the polypeptide component (the)
  • second polypeptide antigen of the immunogenic composition include proteins and peptides from any pathogen, such as a bacterial pathogen, a viral pathogen, a fungal pathogen, a protozoan pathogen, or a multi-cellular parasitic pathogen.
  • exemplary antigens include any one of the antigens described above, such as an antigen derived from RSV, HIV, or CMV.
  • the composition can contain more than one polypeptide antigen.
  • the polypeptide may also be a fusion polypeptide comprising two or more epitopes from two different proteins of the same pathogen, or two or more epitopes from two different pathogens.
  • the polypeptide antigen may include additional sequences, such as a sequence to facilitate expression, production, purification or detection (e.g., a poly-His sequence).
  • additional sequences such as a sequence to facilitate expression, production, purification or detection (e.g., a poly-His sequence).
  • polypeptide antigen will usually be isolated or purified. Thus, they will not be associated with molecules with which they are normally, if applicable, found in nature.
  • Polypeptides will usually be prepared by expression in a recombinant host system. Generally, they are produced by expression of recombinant constructs that encode the ecto-domains in suitable recombinant host cells, although any suitable methods can be used.
  • Suitable recombinant host cells include, for example, insect cells (e.g., Aedes aegypti, Autographa californica, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusia ni), mammalian cells (e.g., human, non-human primate, horse, cow, sheep, dog, cat, and rodent (e.g., hamster), avian cells (e.g., chicken, duck, and geese), bacteria (e.g., E.
  • insect cells e.g., Aedes aegypti, Autographa californica, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusia ni
  • mammalian cells e.g., human, non-human primate, horse, cow, sheep, dog, cat, and rodent (e.g., ham
  • yeast cells e.g., Saccharomyces cerevisiae, Candida albicans, Candida maltosa, Hansenual polymorpha, Kluyveromyces fragiiis, Kluyveromyces lactis, Pichia guiiierimondii, Pichia pastoris, Schizosaccharomyces pombe and Yarrowia Upolytica
  • Tetrahymena cells e.g., Tetrahymena thermophila
  • Many suitable insect cells and mammalian cells are well-known in the art.
  • Suitable insect cells include, for example, Sf9 cells, Sf21 cells, Tn5 cells, Schneider S2 cells, and High Five cells (a clonal isolate derived from the parental Trichoplusia ni BTI-TN-5B1-4 cell line (Invitrogen)).
  • Suitable mammalian cells include, for example, Chinese hamster ovary (CHO) cells, human embryonic kidney cells (HEK293 cells, typically transformed by sheared adenovirus type 5 DNA), NIH-3T3 cells, 293-T cells, Vero cells, HeLa cells, PERC.6 cells (ECACC deposit number 96022940), Hep G2 cells, MRC-5 (ATCC CCL-171), WI-38 (ATCC CCL-75), fetal rhesus lung cells (ATCC CL-160), Madin- Darby bovine kidney (“MDBK”) cells, Madin-Darby canine kidney (“MDCK”) cells (e.g., MDCK ( BL2), ATCC CCL34; or MDCK 33016, DSM ACC 2219), baby hamster kidney (BHK) cells, such as BHK21-F, HKCC cells, and the like.
  • CHO Chinese hamster ovary
  • HEK293 cells human embryonic kidney cells
  • Suitable avian cells include, for example, chicken embryonic stem cells (e.g., EBx® cells), chicken embryonic fibroblasts, chicken embryonic germ cells, duck cells (e.g., AGE1.CR and AGEl .CR.pIX cell lines (ProBioGen) which are described, for example, in Vaccine 27:4975-4982 (2009) and WO2005/042728), EB66 cells, and the like.
  • chicken embryonic stem cells e.g., EBx® cells
  • chicken embryonic fibroblasts e.g., chicken embryonic germ cells
  • duck cells e.g., AGE1.CR and AGEl .CR.pIX cell lines (ProBioGen) which are described, for example, in Vaccine 27:4975-4982 (2009) and WO2005/042728
  • EB66 cells e.g., EB66 cells, and the like.
  • Suitable insect cell expression systems such as baculovirus systems, are known to those of skill in the art and described in, e.g., Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987). Materials and methods for baculovirus/insert cell expression systems are commercially available in kit form from, inter alia, Invitrogen, San Diego CA. Avian cell expression systems are also known to those of skill in the art and described in, e.g., U.S. Patent Nos. 5,340,740; 5,656,479; 5,830,510; 6, 114, 168; and 6,500,668; European Patent No. EP 0787180B; European Patent Application No.
  • bacterial and mammalian cell expression systems are also known in the art and described in, e.g., Yeast Genetic Engineering (Barr et ah, eds., 1989) Butterworths, London.
  • Recombinant constructs encoding a polypeptide can be prepared in suitable vectors using conventional methods.
  • a number of suitable vectors for expression of recombinant proteins in insect or mammalian cells are well-known and conventional in the art.
  • Suitable vectors can contain a number of components, including, but not limited to one or more of the following: an origin of replication; a selectable marker gene; one or more expression control elements, such as a transcriptional control element (e.g., a promoter, an enhancer, a terminator), and/or one or more translation signals; and a signal sequence or leader sequence for targeting to the secretory pathway in a selected host cell (e.g., of mammalian origin or from a heterologous mammalian or non-mammalian species).
  • a transcriptional control element e.g., a promoter, an enhancer, a terminator
  • a signal sequence or leader sequence for targeting to the secretory pathway in a selected host cell (e.g.,
  • baculovirus expression vector such as pFastBac (Invitrogen)
  • pFastBac Invitrogen
  • the baculovirus particles are amplified and used to infect insect cells to express recombinant protein.
  • a vector that will drive expression of the construct in the desired mammalian host cell e.g., Chinese hamster ovary cells
  • Polypeptides can be purified using any suitable methods. For example, methods for purifying polypeptides by immunoaffinity chromatography are known in the art. Ruiz-Arguello et al, J. Gen. Virol, 55:3677-3687 (2004). Suitable methods for purifying desired proteins including precipitation and various types of chromatography, such as hydrophobic interaction, ion exchange, affinity, chelating and size exclusion are well-known in the art. Suitable purification schemes can be created using two or more of these or other suitable methods. If desired, the polypeptides can include a "tag" that facilitates purification, such as an epitope tag or a HIS tag. Such tagged polypeptides can conveniently be purified, for example from conditioned media, by chelating chromatography or affinity
  • RNA component In addition to the protein compontent and the RNA component, additional components, such as lipids, polymers or other compounds may be optionally included in the immunogenic composition as described herein to facilitate the entry of RNA into target cells.
  • additional components such as lipids, polymers or other compounds may be optionally included in the immunogenic composition as described herein to facilitate the entry of RNA into target cells.
  • RNA can be delivered as naked RNA (e.g. merely as an aqueous solution of RNA), to enhance entry into cells and also subsequent intercellular effects, the RNA molecule is preferably administered in combination with a delivery system, such as a particulate or emulsion delivery system.
  • a delivery system such as a particulate or emulsion delivery system.
  • the RNA molecule may be introduced into cells by way of receptor-mediated endocytosis. See e.g., U.S. Pat. No. 6,090,619; Wu and Wu, J. Biol. Chem., 263 : 14621 (1988); and Curiel et al, Proc. Natl. Acad. Sci.
  • U.S. Pat. No. 6,083,741 discloses introducing an exogenous nucleic acid into mammalian cells by associating the nucleic acid to a polycation moiety (e.g., poly-L-lysine having 3-100 lysine residues), which is itself coupled to an integrin receptor-binding moiety (e.g., a cyclic peptide having the sequence Arg-Gly-Asp).
  • a polycation moiety e.g., poly-L-lysine having 3-100 lysine residues
  • an integrin receptor-binding moiety e.g., a cyclic peptide having the sequence Arg-Gly-Asp.
  • RNA molecule of the present invention can be delivered into cells via amphiphiles. See e.g., U.S. Pat. No. 6,071,890.
  • a nucleic acid molecule may form a complex with the cationic amphiphile. Mammalian cells contacted with the complex can readily take it up.
  • Three particularly useful delivery systems are (i) liposomes (ii) non-toxic and biodegradable polymer microparticles (iii) cationic submicron oil-in-water emulsions.
  • RNA -containing aqueous core can have an anionic, cationic or zwitterionic hydrophilic head group. Formation of liposomes from anionic phospholipids dates back to the 1960s, and cationic liposome-forming lipids have been studied since the 1990s. Some phospholipids are anionic whereas other are zwitterionic. Suitable classes of phospholipid include, but are not limited to,
  • phosphatidylethanolamines phosphatidylcholines, phosphatidylserines, and
  • Useful cationic lipids include, but are not limited to, dioleoyl trimethylammonium propane (DOTAP), 1,2- distearyloxy-N,N-dimethyl-3 -aminopropane (DSDMA), 1 ,2-dioleyloxy-N,Ndimethyl-3 - aminopropane (DODMA), l,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane (DLinDMA), l,2-dilinolenyloxy-N,N-dimethyl-3 -aminopropane (DLenDMA).
  • DOTAP dioleoyl trimethylammonium propane
  • DSDMA 1,2- distearyloxy-N,N-dimethyl-3 -aminopropane
  • DODMA 1,2-dioleyloxy-N,Ndimethyl-3 - aminopropane
  • DLinDMA 1,2-dioleyloxy-N,N-di
  • Zwitterionic lipids include, but are not limited to, acyl zwitterionic lipids and ether zwitterionic lipids.
  • Examples of useful zwitterionic lipids are DPPC, DOPC and dodecylphosphocholine.
  • the lipids can be saturated or unsaturated. Table 2. Phospholipids
  • Liposomes can be formed from a single lipid or from a mixture of lipids.
  • a mixture may comprise (i) a mixture of anionic lipids (ii) a mixture of cationic lipids (iii) a mixture of zwitterionic lipids (iv) a mixture of anionic lipids and cationic lipids (v) a mixture of anionic lipids and zwitterionic lipids (vi) a mixture of zwitterionic lipids and cationic lipids or (vii) a mixture of anionic lipids, cationic lipids and zwitterionic lipids.
  • a mixture may comprise both saturated and unsaturated lipids.
  • a mixture may comprise DSPC (zwitterionic, saturated), DlinDMA (cationic, unsaturated), and/or DMPG (anionic, saturated).
  • DSPC zwitterionic, saturated
  • DlinDMA cationic, unsaturated
  • DMPG anionic, saturated
  • the hydrophilic portion of a lipid can be PEGylated (i.e. modified by covalent attachment of a polyethylene glycol). This modification can increase stability and prevent non-specific adsorption of the liposomes.
  • lipids can be conjugated to PEG using techniques such as those disclosed in Heyes et al. (2005) J Controlled Release 107:276-87..
  • a mixture of DSPC, DlinDMA, PEG-DMPG and cholesterol is used in the examples.
  • a separate aspect of the invention is a liposome comprising DSPC, DlinDMA, PEG-DMG and cholesterol.
  • This liposome preferably encapsulates RNA, such as a self- replicating RNA e.g. encoding an immunogen.
  • Liposomes are usually divided into three groups: multilamellar vesicles
  • MLV small unilamellar vesicles
  • LUV large unilamellar vesicles
  • SUVs have multiple bilayers in each vesicle, forming several separate aqueous compartments.
  • SUVs and LUVs have a single bilayer encapsulating an aqueous core; SUVs typically have a diameter ⁇ 50nm, and LUVs have a diameter >50nm.
  • Liposomes useful with of the invention are ideally LUVs with a diameter in the range of 50-220nm.
  • compositions comprising a population of LUVs with different diameters: (i) at least 80% by number should have diameters in the range of 20-220nm, (ii) the average diameter (Zav, by intensity) of the population is ideally in the range of 40-200nm, and/or (iii) the diameters should have a polydispersity index ⁇ 0.2.
  • One useful method involves mixing (i) an ethanolic solution of the lipids (ii) an aqueous solution of the nucleic acid and (iii) buffer, followed by mixing, equilibration, dilution and purification (Heyes et al. (2005) J Controlled Release 107:276-87.).
  • RNA is preferably encapsulated within the liposomes, and so the liposome forms a outer layer around an aqueous RNA-containing core. This encapsulation has been found to protect RNA from RNase digestion.
  • the liposomes can include some external RNA (e.g. on the surface of the liposomes), but at least half of the RNA (and ideally all of it) is encapsulated. 2.
  • RNA molecules can form microparticles to encapsulate or adsorb RNA.
  • the use of a substantially non-toxic polymer means that a recipient can safely receive the particles, and the use of a biodegradable polymer means that the particles can be metabolised after delivery to avoid long-term persistence.
  • Useful polymers are also sterilisable, to assist in preparing pharmaceutical grade formulations.
  • Suitable non-toxic and biodegradable polymers include, but are not limited to, poly(a-hydroxy acids), polyhydroxy butyric acids, polylactones (including polycaprolactones), polydioxanones, polyvalerolactone, polyorthoesters, polyanhydrides, polycyanoacrylates, tyrosine-derived polycarbonates, polyvinyl-pyrrolidinones or polyester- amides, and combinations thereof.
  • the microparticles are formed from poly(a- hydroxy acids), such as a poly(lactides) (“PLA”), copolymers of lactide and glycolide such as a poly(D,L-lactide-co-glycolide) (“PLG”), and copolymers of D,L-lactide and caprolactone.
  • PLG polymers include those having a lactide/glycolide molar ratio ranging, for example, from 20:80 to 80:20 e.g. 25:75, 40:60, 45:55, 55:45, 60:40, 75:25.
  • Useful PLG polymers include those having a molecular weight between, for example, 5,000-200,000 Da e.g. between 10,000-100,000, 20,000-70,000, 40,000-50,000 Da.
  • microparticles ideally have a diameter in the range of 0.02 ⁇ to
  • composition comprising a population of microparticles with different diameters at least 80% by number should have diameters in the range of 0.03-7 ⁇ .
  • a microparticle may include a cationic surfactant and/or lipid e.g. as disclosed in O'Hagan et al. (2001) J Virology! 5:9037- 9043; and Singh et al. (2003) Pharmaceutical Research 20: 247-251.
  • An alternative way of making polymeric microparticles is by molding and curing e.g. as disclosed in
  • Microparticles of the invention can have a zeta potential of between
  • RNA can be adsorbed to the microparticles, and adsorption is facilitated by including cationic materials (e.g. cationic lipids) in the microparticle.
  • cationic materials e.g. cationic lipids
  • Oil-in-water emulsions are known for adjuvanting influenza vaccines e.g. the MF59TM adjuvant in the FLUADTM product, and the AS03 adjuvant in the
  • RNA delivery according to the present invention can utilise an oil-in-water emulsion, provided that the emulsion includes one or more cationic molecules.
  • a cationic lipid can be included in the emulsion to provide a positive droplet surface to which negatively-charged RNA can attach.
  • the emulsion comprises one or more oils.
  • Suitable oil(s) include those from, for example, an animal (such as fish) or a vegetable source.
  • the oil is ideally biodegradable (metabolisable) and biocompatible.
  • Sources for vegetable oils include nuts, seeds and grains. Peanut oil, soybean oil, coconut oil, and olive oil, the most commonly available, exemplify the nut oils.
  • Jojoba oil can be used e.g. obtained from the jojoba bean.
  • Seed oils include safflower oil, cottonseed oil, sunflower seed oil, sesame seed oil and the like.
  • corn oil is the most readily available, but the oil of other cereal grains such as wheat, oats, rye, rice, teff, triticale and the like may also be used.
  • 6-10 carbon fatty acid esters of glycerol and 1,2-propanediol, while not occurring naturally in seed oils, may be prepared by hydrolysis, separation and esterification of the appropriate materials starting from the nut and seed oils. Fats and oils from mammalian milk are metabolizable and so may be used. The procedures for separation, purification, saponification and other means necessary for obtaining pure oils from animal sources are well known in the art.
  • cod liver oil For example, cod liver oil, shark liver oils, and whale oil such as spermaceti exemplify several of the fish oils which may be used herein.
  • a number of branched chain oils are synthesized biochemically in 5-carbon isoprene units and are generally referred to as terpenoids.
  • Squalene can also be obtained from yeast or other suitable microbes. In some embodiments, Squalene is preferably obtained from non-animal sources, such as from olives, olive oil or yeast. Squalane, the saturated analog to squalene, can also be used.
  • Fish oils, including squalene and squalane are readily available from commercial sources or may be obtained by methods known in the art.
  • oils are the tocopherols, particularly in combination with squalene.
  • the oil phase of an emulsion includes a tocopherol
  • any of the ⁇ , ⁇ , ⁇ , ⁇ , ⁇ or ⁇ tocopherols can be used, but a-tocopherols are preferred.
  • DL-a-tocopherol can both be used.
  • a preferred a-tocopherol is DL-a-tocopherol.
  • An oil combination comprising squalene and a tocopherol (e.g. DL-a-tocopherol) can be used.
  • the oil in the emulsion may comprise a combination of oils e.g.
  • the aqueous component of the emulsion can be plain water (e.g. w.f.i.) or can include further components e.g. solutes. For instance, it may include salts to form a buffer e.g. citrate or phosphate salts, such as sodium salts.
  • Typical buffers include: a phosphate buffer; a Tris buffer; a borate buffer; a succinate buffer; a histidine buffer; or a citrate buffer.
  • a buffered aqueous phase is preferred, and buffers will typically be included in the 5-20mM range.
  • the emulsion also includes a cationic lipid.
  • this lipid is a surfactant so that it can facilitate formation and stabilisation of the emulsion.
  • Useful cationic lipids generally contains a nitrogen atom that is positively charged under physiological conditions e.g. as a tertiary or quaternary amine. This nitrogen can be in the hydrophilic head group of an amphiphilic surfactant.
  • Useful cationic lipids include, but are not limited to: 1,2- dioleoyloxy-3-(trimethylammonio)propane (DOTAP), 3'-[N-( ',N'-Dimethylaminoethane)- carbamoyl] Cholesterol (DC Cholesterol), dimethyldioctadecyl-ammonium (DDA e.g. the bromide), l,2-Dimyristoyl-3-Trimethyl-AmmoniumPropane (DMTAP),
  • DOTAP 1,2- dioleoyloxy-3-(trimethylammonio)propane
  • DC Cholesterol 3'-[N-( ',N'-Dimethylaminoethane)- carbamoyl] Cholesterol
  • DDA dimethyldioctadecyl-ammonium
  • DMTAP l,2-Dimyristoyl-3-Trimethyl-AmmoniumPropane
  • Other useful cationic lipids are: benzalkonium chloride (BAK), benzethonium chloride, cetramide (which contains tetradecyltrimethylammonium bromide and possibly small amounts of
  • dedecyltrimethylammonium bromide and hexadecyltrimethyl ammonium bromide cetylpyridinium chloride (CPC), cetyl trimethylammonium chloride (CTAC), primary amines, secondary amines, tertiary amines, including but not limited to ⁇ , ⁇ ', ⁇ '- polyoxy ethylene (10)-N-tallow-l,3 -diaminopropane, other quaternary amine salts, including but not limited to dodecyltrimethylammonium bromide, hexadecyltrimethyl-ammonium bromide, mixed alkyl-trimethyl-ammonium bromide, benzyldimethyldodecylammonium chloride, benzyldimethylhexadecyl-ammonium chloride, benzyltrimethylammonium methoxide, cetyldimethylethylammonium bromide, dimethyldio
  • acyl group dimyristoyl, dipalmitoyl, distearoyl, dioleoyl), 1,2- dioleoyl-3-(4'-trimethyl- ammonio)butanoyl-sn-glycerol, 1,2-dioleoyl 3-succinyl-sn-glycerol choline ester, cholesteryl (4'-trimethylammonio) butanoate), N-alkyl pyridinium salts (e.g.
  • cetylpyridinium bromide and cetylpyridinium chloride N-alkylpiperidinium salts, dicationic bolaform electrolytes C12BU6), dialkylglycetylphosphorylcholine, lysolecithin, L-a dioleoylphosphatidylethanolamine, cholesterol hemisuccinate choline ester, lipopolyamines, including but not limited to dioctadecylamidoglycylspermine (DOGS), dipalmitoyl phosphatidylethanol-amidospermine (DPPES), lipopoly-L (or D)-lysine (LPLL, LPDL), poly (L (or D)-lysine conjugated to N- glutarylphosphatidylethanolamine, didodecyl glutamate ester with pendant amino group (Ci 2 GluPhC n N + ), ditetradecyl glutamate ester with pendant amino group (Ci 4 GluC
  • an emulsion can include a non-ionic surfactant and/or a zwitterionic surfactant.
  • surfactants include, but are not limited to: the polyoxyethylene sorbitan esters surfactants (commonly referred to as the Tweens), especially polysorbate 20 and polysorbate 80; copolymers of ethylene oxide (EO), propylene oxide (PO), and/or butylene oxide (BO), sold under the DOWFAXTM tradename, such as linear EO/PO block copolymers; octoxynols, which can vary in the number of repeating ethoxy (oxy-l,2-ethanediyl) groups, with octoxynol-9 (Triton X-100, or t-octylphenoxypolyethoxyethanol) being of particular interest;
  • octylphenoxy poly ethoxy ethanol
  • phospholipids such as phosphatidylcholine (lecithin); polyoxyethylene fatty ethers derived from lauryl, cetyl, stearyl and oleyl alcohols (known as Brij surfactants), such as triethyleneglycol monolauryl ether (Brij 30); polyoxyethylene-9-lauryl ether; and sorbitan esters (commonly known as the Spans), such as sorbitan trioleate (Span 85) and sorbitan monolaurate.
  • Preferred surfactants for including in the emulsion are polysorbate 80 (Tween 80; polyoxyethylene sorbitan monooleate), Span 85 (sorbitan trioleate), lecithin and Triton X-100.
  • Mixtures of these surfactants can be included in the emulsion e.g.
  • Tween 80/Span 85 mixtures or Tween 80/Triton-X100 mixtures.
  • a combination of a polyoxyethylene sorbitan ester such as polyoxyethylene sorbitan monooleate (Tween 80) and an octoxynol such as t-octylphenoxy-polyethoxy ethanol (Triton X-100) is also suitable.
  • Another useful combination comprises laureth 9 plus a polyoxyethylene sorbitan ester and/or an octoxynol.
  • Useful mixtures can comprise a surfactant with a HLB value in the range of 10- 20 (e.g. polysorbate 80, with a HLB of 15.0) and a surfactant with a HLB value in the range of 1-10 (e.g. sorbitan trioleate, with a HLB of 1.8).
  • Preferred amounts of oil (% by volume) in the final emulsion are between 2-20% e.g. 5-15%, 6-14%, 7-13%, 8-12%.
  • a squalene content of about 4-6% or about 9-11% is particularly useful.
  • Preferred amounts of surfactants (% by weight) in the final emulsion are between 0.001% and 8%.
  • polyoxyethylene sorbitan esters such as polysorbate 80
  • polysorbate 80 0.2 to 4%, in particular between 0.4-0.6%, between 0.45-0.55%, about 0.5% or between 1.5-2%, between 1.8-2.2%, between 1.9-2.1%, about 2%, or 0.85-0.95%, or about 1%
  • sorbitan esters such as sorbitan trioleate
  • 0.02 to 2% in particular about 0.5% or about 1%
  • octyl- or nonylphenoxy polyoxyethanols such as Triton X-100
  • polyoxyethylene ethers such as laureth 9 0.1 to 8%, preferably 0.1 to 10% and in particular 0.1 to 1% or about 0.5%.
  • the most effective emulsions have a droplet size in the submicron range.
  • the droplet sizes will be in the range 50-750nm.
  • the average droplet size is less than 250nm e.g. less than 200nm, less than 150nm.
  • the average droplet size is usefully in the range of 80-180nm.
  • at least 80% (by number) of the emulsion's oil droplets are less than 250 nm in diameter, and preferably at least 90%.
  • Apparatuses for determining the average droplet size in an emulsion, and the size distribution are commercially available. These these typically use the techniques of dynamic light scattering and/or single-particle optical sensing e.g. the AccusizerTM and NicompTM series of instruments available from Particle Sizing Systems (Santa Barbara, USA), or the ZetasizerTM instruments from Malvern Instruments (UK), or the Particle Size Distribution Analyzer instruments from Horiba (Kyoto, Japan).
  • the distribution of droplet sizes has only one maximum i.e. there is a single population of droplets distributed around an average (mode), rather than having two maxima.
  • Preferred emulsions have a polydispersity of ⁇ 0.4 e.g. 0.3, 0.2, or less.
  • Suitable emulsions with submicron droplets and a narrow size distribution can be obtained by the use of microfluidisation.
  • This technique reduces average oil droplet size by propelling streams of input components through geometrically fixed channels at high pressure and high velocity. These streams contact channel walls, chamber walls and each other. The results shear, impact and cavitation forces cause a reduction in droplet size. Repeated steps of microfluidisation can be performed until an emulsion with a desired droplet size average and distribution are achieved.
  • thermal methods can be used to cause phase inversion. These methods can also provide a submicron emulsion with a tight particle size distribution.
  • Preferred emulsions can be filter sterilised i.e. their droplets can pass through a 220nm filter. As well as providing a sterilisation, this procedure also removes any large droplets in the emulsion.
  • the cationic lipid in the emulsion is DOTAP.
  • the cationic oil-in-water emulsion may comprise from about 0.5 mg/ml to about 25 mg/ml DOTAP.
  • the cationic oil-in-water emulsion may comprise DOTAP at from about 0.5 mg/ml to about 25 mg/ml, from about 0.6 mg/ml to about 25 mg/ml, from about 0.7 mg/ml to about 25 mg/ml, from about 0.8 mg/ml to about 25 mg/ml, from about 0.9 mg/ml to about 25 mg/ml, from about 1.0 mg/ml to about 25 mg/ml, from about 1.1 mg/ml to about 25 mg/ml, from about 1.2 mg/ml to about 25 mg/ml, from about 1.3 mg/ml to about 25 mg/ml, from about 1.4 mg/ml to about 25 mg/ml, from about 1.5 mg/ml to about 25 mg/ml, from about 1.6 mg/ml to about 25 mg/ml, from about 1.7 mg/ml
  • the cationic oil-in- water emulsion comprises from about 0.8 mg/ml to about 1.6 mg/ml DOTAP, such as 0.8 mg/ml, 1.2 mg/ml, 1.4 mg/ml or 1.6 mg/ml.
  • the cationic lipid is DC Cholesterol.
  • the cationic oil-in-water emulsion may comprise DC Cholesterol at from about 0.1 mg/ml to about 5 mg/ml DC Cholesterol.
  • the cationic oil-in-water emulsion may comprise DC Cholesterol from about 0.1 mg/ml to about 5 mg/ml, from about 0.2 mg/ml to about 5 mg/ml, from about 0.3 mg/ml to about 5 mg/ml, from about 0.4 mg/ml to about 5 mg/ml, from about 0.5 mg/ml to about 5 mg/ml, from about 0.62 mg/ml to about 5 mg/ml, from about 1 mg/ml to about 5 mg/ml, from about 1.5 mg/ml to about 5 mg/ml, from about 2 mg/ml to about 5 mg/ml, from about 2.46 mg/ml to about 5 mg/ml, from about 3 mg/ml to about 5 mg/ml, from about 3.5 mg/ml to about 5 mg/ml, from about 4 mg/ml to about 5 mg/ml, from about 4.5 mg/ml to about 5 mg/ml, from about 0.1 mg/ml to about 4.92 mg
  • the cationic lipid is DDA.
  • the cationic oil-in- water emulsion may comprise from about 0.1 mg/ml to about 5 mg/ml DDA.
  • the cationic oil-in-water emulsion may comprise DDA at from about 0.1 mg/ml to about 5 mg/ml, from about 0.1 mg/ml to about 4.5 mg/ml, from about 0.1 mg/ml to about 4 mg/ml, from about 0.1 mg/ml to about 3.5 mg/ml, from about 0.1 mg/ml to about 3 mg/ml, from about 0.1 mg/ml to about 2.5 mg/ml, from about 0.1 mg/ml to about 2 mg/ml, from about 0.1 mg/ml to about 1.5 mg/ml, from about 0.1 mg/ml to about 1.45 mg/ml, from about 0.2 mg/ml to about 5 mg/ml, from about 0.3 mg/ml to about 5 mg/ml, from about
  • the cationic oil-in-water emulsion may comprise DDA at about 20 mg/ml, about 21 mg/ml, about 21.5 mg/ml, about 21.6 mg/ml, about 25 mg/ml.
  • the cationic oil-in-water emulsion comprises from about 0.73 mg/ml to about 1.45 mg/ml DDA, such as 1.45 mg/ml.
  • RNA molecules of the invention can also be delivered to cells ex vivo, such as cells explanted from an individual patient (e.g., lymphocytes, bone marrow aspirates, tissue biopsy) or universal donor hematopoietic stem cells, followed by reimplantation of the cells into a patient, usually after selection for cells which have been transfected with the RNA molecule.
  • cells ex vivo such as cells explanted from an individual patient (e.g., lymphocytes, bone marrow aspirates, tissue biopsy) or universal donor hematopoietic stem cells, followed by reimplantation of the cells into a patient, usually after selection for cells which have been transfected with the RNA molecule.
  • the appropriate amount of cells to deliver to a patient will vary with patient conditions, and desired effect, which can be determined by a skilled artisan. See e.g., U.S. Pat. Nos. 6,054,288; 6,048,524; and 6,048,729.
  • the cells used are autologous, i
  • the immunogenic compositions provided herein include or optionally include one or more immunoregulatory agents such as adjuvants.
  • immunoregulatory agents such as adjuvants.
  • exemplary adjuvants include, but are not limited to, a THl adjuvant and/or a TH2 adjuvant, further discussed below.
  • the adjuvants used in the immunogenic compositions provide herein include, but are not limited to:
  • PCPP Polyphosphazene
  • Immunostimulatory polynucleotide such as RNA or DNA; e.g., CpG-containing oligonucleotides
  • Mineral containing compositions suitable for use as adjuvants include mineral salts, such as aluminum salts and calcium salts.
  • the immunogenic composition may include mineral salts such as hydroxides (e.g., oxyhydroxides), phosphates (e.g.,
  • the mineral containing compositions may also be formulated as a particle of metal salt (WO 00/23105).
  • Aluminum salts may be included in vaccines of the invention such that the dose of Al 3+ is between 0.2 and 1.0 mg per dose.
  • the aluminum based adjuvant is alum
  • aluminum potassium sulfate (aluminum potassium sulfate (A1K(S0 4 ) 2 ), or an alum derivative, such as that formed in-situ by mixing an antigen in phosphate buffer with alum, followed by titration and precipitation with a base such as ammonium hydroxide or sodium hydroxide.
  • Aluminum-based adjuvant suitable for use in vaccine formulations is aluminum hydroxide adjuvant (Al(OH) 3 ) or crystalline aluminum
  • the aluminum based adjuvant can be aluminum phosphate adjuvant (A1P0 4 ) or aluminum hydroxyphosphate, which contains phosphate groups in place of some or all of the hydroxyl groups of aluminum hydroxide adjuvant.
  • A1P0 4 aluminum phosphate adjuvant
  • aluminum hydroxyphosphate which contains phosphate groups in place of some or all of the hydroxyl groups of aluminum hydroxide adjuvant.
  • Preferred aluminum phosphate adjuvants provided herein are amorphous and soluble in acidic, basic and neutral media.
  • the adjuvant comprises both aluminum phosphate and aluminum hydroxide.
  • the adjuvant has a greater amount of aluminum phosphate than aluminum hydroxide, such as a ratio of 2 : 1 , 3 : 1 , 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1 or greater than 9: 1, by weight aluminum phosphate to aluminum hydroxide.
  • aluminum salts in the vaccine are present at 0.4 to 1.0 mg per vaccine dose, or 0.4 to 0.8 mg per vaccine dose, or 0.5 to 0.7 mg per vaccine dose, or about 0.6 mg per vaccine dose.
  • the preferred aluminum-based adjuvant(s), or ratio of multiple aluminum-based adjuvants, such as aluminum phosphate to aluminum hydroxide is selected by optimization of electrostatic attraction between molecules such that the antigen carries an opposite charge as the adjuvant at the desired pH.
  • pretreatment of aluminum hydroxide with phosphate lowers its isoelectric point, making it a preferred adjuvant for more basic antigens.
  • Oil-emulsion compositions and formulations suitable for use as adjuvants include squalene-water emulsions, such as MF59 (5% Squalene, 0.5% Tween 80, and 0.5% Span 85, formulated into submicron particles using a microfluidizer). See WO 90/14837. See also, Podda (2001) VACCINE 19: 2673-2680; Frey et al. (2003) Vaccine 21 :4234-4237. MF59 is used as the adjuvant in the FLUADTM influenza virus trivalent subunit vaccine.
  • MF59 5% Squalene, 0.5% Tween 80, and 0.5% Span 85
  • compositions are submicron oil-in-water emulsions.
  • Preferred submicron oil-in-water emulsions for use herein are squalene/water emulsions optionally containing varying amounts of MTP-PE, such as a submicron oil-in-water emulsion containing 4-5% w/v squalene, 0.25- 1.0% w/v Tween 80TM (polyoxyethylenesorbitan monooleate), and/or 0.25-1.0% Span 85TM (sorbitan trioleate), and, optionally, N-acetylmuramyl-L-alanyl-D-isogluatminyl-L-alanine-2- ( ⁇ -2'- dipalmitoyl-SM-glycero-3 -huydroxyphosphophoryloxy)-ethylamine (MTP-PE), for example, the submicron oil-in-water emulsion known as "MF59" (WO 90/14837; U
  • Patent No. 6,299,884 U.S. Patent No. 6,451,325; and Ott et al, "MF59 - Design and Evaluation of a Safe and Potent Adjuvant for Human Vaccines" in Vaccine Design: The Subunit and Adjuvant Approach (Powell, M.F. and Newman, MJ. eds.) (New York: Plenum Press) 1995, pp. 277-296).
  • MF59 contains 4-5% w/v Squalene (e.g.
  • MTP-PE formulated into submicron particles using a microfluidizer such as Model 11 OY microfluidizer
  • MTP-PE may be present in an amount of about 0-500 ⁇ g/dose, more preferably 0-250 ⁇ g/dose and most preferably, 0-100 ⁇ g/dose.
  • MF59-0 refers to the above submicron oil-in-water emulsion lacking MTP- PE
  • MF59-MTP denotes a formulation that contains MTP-PE.
  • MF59-100 contains 100 ⁇ g MTP-PE per dose, and so on.
  • MF69 another submicron oil-in- water emulsion for use herein, contains 4.3% w/v squalene, 0.25% w/v Tween 80TM, and 0.75% w/v Span 85TM and optionally MTP-PE.
  • MF75 also known as SAF, containing 10% squalene, 0.4% Tween 80TM, 5% pluronic - blocked polymer L121, and thr-MDP, also microfluidized into a submicron emulsion.
  • MF75- MTP denotes an MF75 formulation that includes MTP, such as from 100-400 ⁇ g MTP-PE per dose.
  • IF A may also be used as adjuvants in the invention.
  • Saponins are a heterologous group of sterol glycosides and triterpenoid glycosides that are found in the bark, leaves, stems, roots and even flowers of a wide range of plant species. Saponins isolated from the bark of the Quillaia saponaria Molina tree have been widely studied as adjuvants. Saponins can also be commercially obtained from Smilax ornata (sarsaprilla), Gypsophilla paniculata (brides veil), and Saponaria officianalis (soap root). Saponin adjuvant formulations include purified formulations, such as QS21, as well as lipid formulations, such as ISCOMs. Saponin adjuvant formulations include STIMULON adjuvant (Antigenics, Inc., Lexington, MA).
  • the saponin is QS21.
  • a method of production of QS21 is disclosed in U.S. Patent No. 5,057,540.
  • Saponin formulations may also comprise a sterol, such as cholesterol (see WO 96/33739).
  • Saponin formulations may include sterols, cholesterols and lipid formulations. Combinations of saponins and cholesterols can be used to form unique particles called Immunostimulating Complexes (ISCOMs). ISCOMs typically also include a phospholipid such as phosphatidylethanolamine or phosphatidylcholine. Any known saponin can be used in ISCOMs. Preferably, the ISCOM includes one or more of Quil A, QHA and QHC. ISCOMs are further described in EP 0 109 942, WO 96/11711 and WO 96/33739. Optionally, the ISCOMS may be devoid of (an) additional detergent(s). See WO 00/07621.
  • Virosomes and Virus Like Particles generally contain one or more proteins from a virus optionally combined or formulated with a phospholipid. They are generally non-pathogenic, non-replicating and generally do not contain any of the native viral genome. The viral proteins may be recombinantly produced or isolated from whole viruses.
  • viral proteins suitable for use in virosomes or VLPs include proteins derived from influenza virus (such as HA or NA), Hepatitis B virus (such as core or capsid proteins), Hepatitis E virus, measles virus, Sindbis virus, Rotavirus, Foot-and-Mouth Disease virus, Retrovirus, Norwalk virus, human Papilloma virus, HIV, RNA-phages, Q -phage (such as coat proteins), GA-phage, fr-phage, AP205 phage, and Ty (such as retrotransposon Ty protein pi).
  • influenza virus such as HA or NA
  • Hepatitis B virus such as core or capsid proteins
  • Hepatitis E virus measles virus
  • Sindbis virus Rotavirus
  • Foot-and-Mouth Disease virus Retrovirus
  • Norwalk virus Norwalk virus
  • human Papilloma virus HIV
  • RNA-phages Q -phage (such as coat proteins)
  • Immunopotentiating reconstituted influenza virosomes are used as the subunit antigen delivery system in the intranasal trivalent INFLEXALTM product (Mischler and Metcalfe (2002) VACCINE 20 Suppl 5:B17-B23) and the I FLUVAC PLUSTM product.
  • Bacterial or microbial derivatives suitable for use as adjuvants include, but are not limited to:
  • Such derivatives include Monophosphoryl lipid A (MPL) and 3-O-deacylated MPL
  • 3dMPL is a mixture of 3 De-O-acylated monophosphoryl lipid A with 4, 5 or 6 acylated chains.
  • a preferred "small particle” form of 3 De-O-acylated monophosphoryl lipid A is disclosed in EP 0 689 454. Such "small particles” of 3dMPL are small enough to be sterile filtered through a 0.22 micron membrane (see EP 0 689 454).
  • Other non-toxic LPS derivatives include monophosphoryl lipid A mimics, such as aminoalkyl glucosaminide phosphate derivatives, e.g., RC-529. See Johnson et al. (1999) Bioorg. Med. Chem. Lett. 9:2273-2278.
  • Lipid A derivatives include derivatives of lipid A from Escherichia coli such as OM- 174.
  • OM- 174 is described for example in Meraldi et al. (2003) Vaccine 21 :2485-2491 ; and Pajak et al. (2003) Vaccine 21 :836-842.
  • Another exemplary adjuvant is the synthetic phospholipid dimer, E6020 (Eisai Co. Ltd., Tokyo, Japan), which mimics the physicochemical and biological properties of many of the natural lipid A's derived from Gram-negative bacteria.
  • Immunostimulatory oligonucleotides or polymeric molecules suitable for use as adjuvants in the invention include nucleotide sequences containing a CpG motif (a sequence containing an unmethylated cytosine followed by guanosine and linked by a phosphate bond). Bacterial double stranded RNA or oligonucleotides containing palindromic or poly(dG) sequences have also been shown to be immunostimulatory.
  • the CpG 's can include nucleotide modifications/analogs such as phosphorothioate modifications and can be double-stranded or single-stranded.
  • the guanosine may be replaced with an analog such as 2'-deoxy-7- deazaguanosine.
  • an analog such as 2'-deoxy-7- deazaguanosine.
  • the CpG sequence may be directed to TLR9, such as the motif
  • the CpG sequence may be specific for inducing a ThI immune response, such as a CpG- A ODN, or it may be more specific for inducing a B cell response, such a CpG-B ODN.
  • CpG-A and CpG-B ODNs are discussed in Blackwell et al. (2003) J. Immunol. 170(8):4061- 4068; Krieg (2002) TRENDS Immunol. 23(2): 64-65; and WO 01/95935.
  • the CpG is a CpG-A ODN.
  • the CpG oligonucleotide is constructed so that the 5' end is accessible for receptor recognition.
  • two CpG oligonucleotide sequences may be attached at their 3' ends to form "immunomers". See, for example, Kandimalla et al. (2003) BBRC 306:948-953; Kandimalla et al. (2003) Biochem. Soc. Trans. 3 l(part 3):664-658' Bhagat et al. (2003) BBRC 300:853-861 ; and WO03/035836.
  • Immunostimulatory oligonucleotides and polymeric molecules also include alternative polymer backbone structures such as, but not limited to, polyvinyl backbones (Pitha et al. (1970) Biochem. Biophys. Acta 204(l):39-48; Pitha et al. (1970) Biopolymers 9(8):965-977), and morpholino backbones (U.S. Patent No. 5, 142,047; U.S. Patent No. 5, 185,444). A variety of other charged and uncharged polynucleotide analogs are known in the art. Numerous backbone modifications are known in the art, including, but not limited to, uncharged linkages (e.g., methyl phosphonates, phosphotriesters,
  • phosphoami dates, and carbamates e.g., phosphorothioates and phosphorodithioates.
  • Adjuvant IC31 Intercell AG, Vienna, Austria, is a synthetic formulation that contains an antimicrobial peptide, KLK, and an immunostimulatory oligonucleotide, ODNIa.
  • the two component solution may be simply mixed with antigens (e.g., particles in accordance with the invention with an associated antigen), with no conjugation required.
  • ADP-ribosylating toxins and detoxified derivatives thereof Bacterial ADP- ribosylating toxins and detoxified derivatives thereof may be used as adjuvants in the invention.
  • the protein is derived from E. coli (i.e., E. coli heat labile enterotoxin "LT"), cholera ("CT"), or pertussis ("PT").
  • E. coli heat labile enterotoxin
  • CT cholera
  • PT pertussis
  • the use of detoxified ADP- ribosylating toxins as mucosal adjuvants is described in WO 95/1721 1 and as parenteral adjuvants in WO
  • the adjuvant is a detoxified LT mutant such as LT-K63, LT-R72, and LTR192G.
  • ADP-ribosylating toxins and detoxified derivatives thereof, particularly LT-K63 and LT-R72, as adjuvants can be found in the following references: Beignon et al. (2002) Infect. Immun. 70(6):3012-3019; Pizza et al. (2001) Vaccine 19:2534- 2541 ; Pizza et al. (2000) J. Med. Microbiol. 290(4-5):455- 461 ; Scharton-Kersten et al.
  • Bioadhesives and mucoadhesives may also be used as adjuvants.
  • Suitable bioadhesives include esterified hyaluronic acid microspheres (Singh et al. (2001) J. Cont. Release 70:267-276) or mucoadhesives such as cross-linked derivatives of polyacrylic acid, polyvinyl alcohol, polyvinyl pyrollidone, polysaccharides and carboxymethylcellulose. Chitosan and derivatives thereof may also be used as adjuvants in the invention (see WO 99/27960).
  • liposome formulations suitable for use as adjuvants are described in U.S. Patent No. 6,090,406; U.S. Patent No. 5,916,588; and EP Patent Publication No. EP 0 626 169.
  • Adjuvants suitable for use in the invention include polyoxyethylene ethers and polyoxyethylene esters (see, e.g., WO 99/52549). Such formulations further include polyoxyethylene sorbitan ester surfactants in combination with an octoxynol (WO 01/21207) as well as polyoxyethylene alkyl ethers or ester surfactants in combination with at least one additional non-ionic surfactant such as an octoxynol (WO 01/21152).
  • Preferred polyoxyethylene ethers are selected from the following group: polyoxyethylene-9-lauryl ether (laureth 9), polyoxyethylene-9-steoryl ether, polyoxytheylene-8-steoryl ether,
  • PCPP formulations suitable for use as adjuvants are described, for example, in Andrianov et al. (1998) Biomaterials 19(1-3): 109-1 15; and Payne et al. (1998) Adv. Drug Del. Rev. 31(3): 185-196.
  • muramyl peptides suitable for use as adjuvants include N- acetyl- muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl- 1 -alanyl-d- isoglutamine (nor-MDP), and N-acetylmuramyl-l-alanyl-d-isoglutaminyl-l-alanine-2-(l'- 2'- dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE).
  • thr-MDP N- acetyl- muramyl-L-threonyl-D-isoglutamine
  • nor-MDP N-acetyl-normuramyl- 1 -alanyl-d- isoglutamine
  • imidazoquinoline compounds suitable for use as adjuvants include Imiquimod and its analogues, which are described further in Stanley (2002) Clin. Exp. Dermatol. 27(7):571-577; Jones (2003) Curr. Opin. Investig. Drugs 4(2):214-218; and U.S. Patent Nos. 4,689,338; 5,389,640; 5,268,376; 4,929,624; 5,266,575; 5,352,784; 5,494,916; 5,482,936; 5,346,905; 5,395,937; 5,238,944; and 5,525,612.
  • thiosemicarbazone compounds suitable for use as adjuvants, as well as methods of formulating, manufacturing, and screening for such compounds, include those described in WO 04/60308.
  • the thiosemicarbazones are particularly effective in the stimulation of human peripheral blood mononuclear cells for the production of cytokines, such as TNF-a.
  • tryptanthrin compounds suitable for use as adjuvants include those described in WO 04/64759.
  • the tryptanthrin compounds are particularly effective in the stimulation of human peripheral blood mononuclear cells for the production of cytokines, such as TNF-a.
  • examples of benzonaphthyridine compounds suitable for use as adjuvants include:
  • benzonaphthyridine compounds suitable for use as adjuvants, as well as methods of formulating and manufacturing include those described in WO 2009/11 1337.
  • Lipopeptides suitable for use as adjuvants are described above.
  • Other exemplary lipopeptides include, e.g., LP 40, which is an agonist of TLR2. See, e.g., Akdis, et al, EUR. J. IMMUNOLOGY, 33 : 2717-26 (2003).
  • Murein lipopeptides are lipopeptides derived from E. coli. See, Hantke, et al, Eur. J. Biochem., 34: 284-296 (1973).
  • Murein lipopeptides comprise a peptide linked to N-acetyl muramic acid, and are thus related to Muramyl peptides, which are described in Baschang, et al, Tetrahedron, 45(20): 6331-6360 (1989).
  • the human immunomodulators suitable for use as adjuvants include, but are not limited to, cytokines, such as, by way of example only, interleukins (IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12), interferons (such as, by way of example only, interferon- ⁇ ), macrophage colony stimulating factor, and tumor necrosis factor.
  • cytokines such as, by way of example only, interleukins (IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12
  • interferons such as, by way of example only, interferon- ⁇
  • macrophage colony stimulating factor such as, by way of example only, macrophage colony stimulating factor, and tumor necrosis factor.
  • Microparticles suitable for use as adjuvants include, but are not limited to, microparticles formed from materials that are biodegradable and non-toxic (e.g. a poly(. alpha. -hydroxy acid), a polyhydroxybutyric acid, a polyorthoester, a polyanhydride, a polycaprolactone, etc.), with poly(lactide-co-glycolide).
  • such microparticles are treated to have a negatively-charged surface (e.g. with SDS) or a positively-charged surface (e.g. with a cationic detergent, such as CTAB).
  • microparticles suitable for use as adjuvants have a particle diameter of about 100 nm to about 150 ⁇ in diameter. In certain embodiments, the particle diameter is about 200 nm to about 30 ⁇ , and in other embodiments the particle diameter is about 500 nm to 10 ⁇ .
  • kits wherein an RNA molecule encoding a first polypeptide antigen (the RNA component); and a second polypeptide antigen (the polypeptide component), are in separate containers.
  • the kit can contain a first container comprising a composition comprising an RNA molecule encoding a first polypeptide antigen, and a second container comprising a composition comprising a second polypeptide antigen.
  • the polypeptide or the RNA molecule can be in liquid form or can be in solid form (e.g., lyophilized).
  • kits described may be used for co-delivery of the RNA component and the polypeptide component of the immunogenic compositions described herein (e.g., the RNA component and the polypeptide component are mixed prior to administration for simultaneous delivery, e.g., mixed within about 72 hours, about 48 hours, about 24 hours, about 12 hours, about 10 hours, about 9 hours, about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 45 minutes, about 30 minutes, about 15 minutes, about 10 minutes, or about 5 minutes prior to administration).
  • the RNA component and the polypeptide component are mixed prior to administration for simultaneous delivery, e.g., mixed within about 72 hours, about 48 hours, about 24 hours, about 12 hours, about 10 hours, about 9 hours, about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 45 minutes, about 30 minutes, about 15 minutes, about 10 minutes, or about 5 minutes prior to administration).
  • the invention provides a kit comprising: (i) a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope; and (ii) a boosting composition comprising a second polypeptide antigen that comprises a second epitope; wherein said first epitope and second epitope are the same epitope.
  • a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope
  • a boosting composition comprising a second polypeptide antigen that comprises a second epitope
  • RNA-coded antigen for the priming composition
  • polypeptide antigen for the boosting composition
  • proteins and peptides from any pathogen such as a bacterial pathogen, a viral pathogen, a fungal pathogen, a protozoan pathogen, or a multi-cellular parasitic pathogen.
  • exemplary antigens include any one of the antigens described above, such as an antigen derived from RSV, HIV, or CMV.
  • the RNA molecule of the priming composition can be delivered as naked RNA (e.g. merely as an aqueous solution of RNA).
  • the priming composition may optionally comprise a delivery system (such as a particulate or emulsion delivery system), so that the RNA molecule is administered in combination with the delivery system. Exemplary delivery systems are described above.
  • the delivery system may be in the same container as the RNA molecule (e.g., pre-formulated), or in a different container from the RNA (e.g., the RNA and the delivery system are separately packaged, and may be combined, e.g., within about 72 hours, about 48 hours, about 24 hours, about 12 hours, about 10 hours, about 9 hours, about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 45 minutes, about 30 minutes, about 15 minutes, about 10 minutes, or about 5 minutes prior to administration).
  • the priming composition, the boosting composition, or both may optionally include one or more immunoregulatory agents such as adjuvants, as described herein.
  • the immunoregulatory agent may be in the same container as the priming or boosting composition, or in a separate contained that can be combined with the priming or boosting composition prior to administration.
  • the priming composition comprising the RNA molecule or the boosting composition comprising the polypeptide can be in liquid form or can be in solid form (e.g., lyophilized).
  • Suitable containers include, for example, bottles, vials, syringes, and test tubes.
  • Containers can be formed from a variety of materials, including glass or plastic.
  • a container may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • the kit can further comprise a third container comprising a pharmaceutically-acceptable buffer, such as phosphate-buffered saline, Ringer's solution, or dextrose solution. It can also contain other materials useful to the end-user, including other pharmaceutically acceptable formulating solutions such as buffers, diluents, filters, needles, and syringes or other delivery device.
  • a pharmaceutically-acceptable buffer such as phosphate-buffered saline, Ringer's solution, or dextrose solution. It can also contain other materials useful to the end-user, including other pharmaceutically acceptable formulating solutions such as buffers, diluents, filters, needles, and syringes or other delivery device.
  • the kit may further include a fourth container comprising an adjuvant (such as an aluminum containing adjuvant or MF59).
  • the kit can also comprise a package insert containing written instructions for methods of inducing immunity or for treating infections.
  • the package insert can be an unapproved draft package insert or can be a package insert approved by the Food and Drug Administration (FDA) or other regulatory body.
  • FDA Food and Drug Administration
  • the invention also provides a delivery device pre-filled with the immunogenic compositions, the priming compositions, or the boosting compositions described above.
  • the invention relates to pharmaceutical compositions comprising an RNA component and a polypeptide component.
  • the pharmaceutical composition comprises: (i) a self-replicating RNA molecule that encodes a first polypeptide antigen comprising a first epitope (the RNA component); and (ii) a second polypeptide antigen comprising a second epitope (the polypeptide component); wherein said first epitope and second epitope are epitopes from the same pathogen; and (iii) a pharmaceutically acceptable carrier and/or a pharmaceutically acceptable vehicle.
  • the invention in another aspect, relates to a kit comprising: (i) a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope; and (ii) a boosting composition comprising a second polypeptide antigen that comprises a second epitope; wherein said first epitope and second epitope are the same epitope; and wherein the priming composition, the boosting composition, or both, comprise(s) a pharmaceutically acceptable carrier and/or a
  • the pharmaceutical compositions typically include a pharmaceutically acceptable carrier and/or a suitable delivery system as described herein (such as liposomes, nanoemulsions, PLG micro- and nanoparticles, lipoplexes, chitosan micro- and nanoparticles and other polyplexes for RNA delivery). If desired other pharmaceutically acceptable components can be included, such as excipients and adjuvants. These pharmaceutical compositions can be used as vaccines.
  • Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present invention. A variety of aqueous carriers can be used. Suitable pharmaceutically acceptable carriers for use in the pharmaceutical compositions include plain water (e.g. w.f.i.) or a buffer e.g. a phosphate buffer, a Tris buffer, a borate buffer, a succinate buffer, a histidine buffer, or a citrate buffer. Buffer salts will typically be included in the 5-20mM range.
  • compositions are preferably sterile, and may be sterilized by conventional sterilization techniques.
  • compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, and tonicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
  • auxiliary substances for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
  • the pharmaceutical compositions of the invention may have a pH between 5.0 and 9.5, e.g. between 6.0 and 8.0.
  • compositions of the invention may include sodium salts (e.g. sodium chloride) to give tonicity.
  • sodium salts e.g. sodium chloride
  • a concentration of 10+2 mg/ml NaCl is typical e.g. about 9 mg/ml.
  • compositions of the invention may have an osmolarity of between 200 mOsm/kg and 400 mOsm/kg, e.g. between 240-360 mOsm/kg, or between 290-310 mOsm/kg.
  • compositions of the invention may include one or more preservatives, such as thiomersal or 2-phenoxyethanol.
  • preservatives such as thiomersal or 2-phenoxyethanol.
  • Mercury-free compositions are preferred, and preservative-free vaccines can be prepared.
  • compositions of the invention are preferably non-pyrogenic e.g. containing ⁇ 1 EU (endotoxin unit, a standard measure) per dose, and preferably ⁇ 0.1 EU per dose.
  • Pharmaceutical compositions of the invention are preferably gluten free.
  • the concentrations of the polypeptide molecule and/or the RNA molecule in the pharmaceutical compositions can vary, and will be selected based on fluid volumes, viscosities, body weight and other considerations in accordance with the particular mode of administration selected and the intended recipient's needs.
  • the pharmaceutical compositions are formulated to provide an effective amount of RNA + polypeptide (either administered simultaneously, or administered sequentially, such as RNA prime, protein boost), such as an amount (either in a single dose or as part of a series) that is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated (e.g.
  • RNA content of compositions will generally be expressed in terms of the amount of RNA per dose.
  • a preferred dose has ⁇ 200 ⁇ g, ⁇ 100 ⁇ g, ⁇ 50 ⁇ g, or ⁇ 10 ⁇ g RNA, and expression can be seen at much lower levels e.g. ⁇ ⁇ g/dose, ⁇ lOOng/dose, ⁇ lOng/dose, ⁇ lng/dose, etc.
  • the amount of polypeptide in each dose will generally comprise from about 0.1 to about 100 ⁇ g of polypeptide, with from about 5 to about 50 ⁇ g being preferred and from about 5 to about 25 ⁇ g/dose being alternatively preferred.
  • the amount of adjuvant if any, will be an amount that will induce an immunomodulating response without significant adverse side effect.
  • An optional amount for a particular vaccine can be ascertained by standard studies involving observation of a vaccine's antibody titers and their virus neutralization capabilities.
  • the amount of adjuvant will be from about 1 to about 100 ⁇ g/dose, with from about 5 to about 50 ⁇ g/dose being preferred, and from about 20 to about 50 ⁇ g/dose being alternatively preferred.
  • Formulations suitable for parenteral administration include aqueous and nonaqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
  • the formulations can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials.
  • Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets. Cells transduced by the RNA molecules can also be administered intravenously or parenterally.
  • Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the packaged nucleic acid suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions.
  • liquid solutions such as an effective amount of the packaged nucleic acid suspended in diluents, such as water, saline or PEG 400
  • capsules, sachets or tablets each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin
  • suspensions in an appropriate liquid such as water, saline or PEG 400
  • Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, tragacanth, microcrystalline cellulose, acacia, gelatin, colloidal silicon dioxide, croscarmellose sodium, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers.
  • Lozenge forms can comprise the active ingredient in a flavor, usually sucrose and acacia or tragacanth, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
  • a flavor usually sucrose and acacia or tragacanth
  • pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
  • polypeptide and RNA molecules when administered orally, must be protected from digestion. Protection of polypeptide and RNA molecules can typically be accomplished either by complexing the RNA molecule or the polypeptide molecule with a composition to render the RNA/polypeptide resistant to acidic and enzymatic hydrolysis, or by packaging the RNA molecule or the polypeptide molecule in an appropriately resistant carrier such as a liposome. Means of protecting nucleic acids (such as RNA molecules) and polypeptides from digestion are well known in the art.
  • the pharmaceutical compositions can be encapsulated, e.g., in liposomes, or in a formulation that provides for slow release of the active ingredient.
  • the RNA molecule may be formulated as liposomes, then administered as a priming composition.
  • liposome-formulated RNA may be mixed with the polypeptide molecule to produce the RNA + polypeptide immunogenic composition of the invention.
  • the RNA molecule and the polypeptide molecule can be co-encapsulated in liposomes.
  • compositions described herein can be made into aerosol formulations (e.g., they can be "nebulized") to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.
  • Suitable suppository formulations may contain the RNA, the polypeptide, or the polypeptide and RNA combination as described herein, and a suppository base.
  • Suitable suppository bases include natural or synthetic triglycerides or paraffin hydrocarbons. It is also possible to use gelatin rectal capsules filled with the polypeptide and RNA molecules as described herein, and a suitable base, for example, liquid triglycerides, polyethylene glycols, and paraffin hydrocarbons.
  • the invention provides a method for inducing, generating or enhancing an immune response in a subject in need thereof, such as a vertebrate, preferably a mammal, comprising administering an effective amount of an immunogenic composition comprising an RNA component and a polypeptide component.
  • the composition comprises: (i) a self-replicating RNA molecule that encodes a first polypeptide antigen comprising a first epitope (the RNA component); and (ii) a second polypeptide antigen comprising a second epitope (the polypeptide component); wherein said first epitope and second epitope are epitopes from the same pathogen.
  • the immune response is preferably protective and preferably involves antibodies and/or cell-mediated immunity. The method may be used to induce a primary immune response and/or to boost an immune response.
  • the immunogenic compositions disclosed herein may be used in the manufacture of a medicament for inducing, generating, or enhancing an immune response in a subject in need thereof, such as a vertebrate, preferably a mammal.
  • the invention provides a method for treating or preventing an infectious disease in a subject (such as a vertebrate, preferably a mammal) in need thereof, comprising administering an effective amount of an immunogenic composition comprising an RNA component and a polypeptide component.
  • the composition comprises: (i) a self-replicating RNA molecule that encodes a first polypeptide antigen comprising a first epitope(the RNA component); and (ii) a second polypeptide antigen comprising a second epitope (the polypeptide component); wherein said first epitope and second epitope are epitopes from the same pathogen.
  • compositions disclosed herein may be used in the manufacture of a medicament for treating or preventing an infectious disease in a subject in need thereof, such as a vertebrate, preferably a mammal.
  • the invention provides a method for vaccinating a subject, such as a vertebrate, preferably a mammal, or immunizing a subject against a pathogen (e.g., a bacterial pathogen, a viral pathogen, a fungal pathogen, a protozoan pathogen, or a multi-cellular parasitic pathogen), comprising administering to a subject in need thereof an effective amount of an immunogenic composition comprising an RNA component and a polypeptide component.
  • a pathogen e.g., a bacterial pathogen, a viral pathogen, a fungal pathogen, a protozoan pathogen, or a multi-cellular parasitic pathogen
  • composition comprises: (i) a self-replicating RNA molecule that encodes a first polypeptide antigen comprising a first epitope (the RNA component); and (ii) a second polypeptide antigen comprising a second epitope (the polypeptide component); wherein said first epitope and second epitope are epitopes from the same pathogen.
  • compositions disclosed herein may be used in the manufacture of a medicament for vaccinating a subject in need thereof, such as a vertebrate, preferably a mammal.
  • RNA molecule and the polypeptide molecule are coadministered, it may still be desirable to package the polypeptide molecule and RNA molecule separately.
  • the two components may be combined, e.g., within about 72 hours, about 48 hours, about 24 hours, about 12 hours, about 10 hours, about 9 hours, about 8 hours, about 7 hours, about 6 hours, about 5 hours, about 4 hours, about 3 hours, about 2 hours, about 1 hour, about 45 minutes, about 30 minutes, about 15 minutes, about 10 minutes, or about 5 minutes prior to administration.
  • the polypeptide molecule and RNA molecule can be combined at a patient's bedside.
  • One aspect of the invention relates to the "prime and boost" immunization regimes in which the immune response induced by a priming composition is boosted by a boosting composition.
  • a boosting composition comprising substantially the same antigen in the same form (e.g., protein prime, protein boost; RNA prime, RNA boost; etc.), substantially the same antigen in a different form (e.g., RNA prime, protein boost; in which the RNA and the protein are directed to the same target antigen), or a different antigen in the same or a different form (e.g., RNA prime targeting antigen 1, protein boost targeting antigen 2, wherein antigen 1 and antigen 2 are different but share a common epitope), may be administered to boost the immune response in the primed host.
  • an antigen e.g., a polypeptide antigen, an RNA-coded antigen, an attenuated pathogen, or a combination thereof
  • a boosting composition comprising substantially the same antigen in the same form (e.
  • the invention provides a method for inducing, generating or enhancing an immune response in a subject in need thereof, such as a vertebrate, preferably a mammal, comprising: (i) administering to a subject in need thereof at least once a therapeutically effective amount of a priming composition comprising a self- replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope; and (ii) subsequently administering the subject at least once a therapeutically effective amount of a boosting composition comprising a second polypeptide antigen that comprises a second epitope; wherein said first epitope and second epitope are the same epitope.
  • the immune response is preferably protective and preferably involves antibodies and/or cell-mediated immunity.
  • the priming and boosting compositions disclosed herein may be used in the manufacture of a medicament for inducing, generating, or enhancing an immune response in a subject in need thereof, such as a vertebrate, preferably a mammal.
  • the invention provides a method for treating or preventing an infectious disease in a subject (such as a vertebrate, preferably a mammal) in need thereof, comprising: (i) administering to a subject in need thereof at least once a therapeutically effective amount of a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope; and (ii) subsequently administering the subject at least once a therapeutically effective amount of a boosting composition comprising a second polypeptide antigen that comprises a second epitope; wherein said first epitope and second epitope are the same epitope.
  • a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope
  • a boosting composition comprising a second polypeptide antigen that comprises a second epitope
  • the priming and boosting compositions disclosed herein may be used in the manufacture of a medicament for treating or preventing an infectious disease in a subject in need thereof, such as a vertebrate, preferably a mammal.
  • the invention provides a method for vaccinating a subject, such as a vertebrate, preferably a mammal, or immunizing a subject against a pathogen (e.g., a bacterial pathogen, a viral pathogen, a fungal pathogen, a protozoan pathogen, or a multicellular parasitic pathogen), comprising: (i) administering to a subject in need thereof at least once a therapeutically effective amount of a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope; and (ii) subsequently administering the subject at least once a therapeutically effective amount of a boosting composition comprising a second polypeptide antigen that comprises a second epitope; wherein said first epitope and second epitope are the same epitope.
  • a pathogen e.g., a bacterial pathogen, a viral pathogen, a fungal pathogen, a protozoan path
  • the priming composition and the boosting composition may be substantially the same (e.g., RNA + protein prime, RNA + protein boost), or may be different (e.g., RNA + protein prime, protein boost).
  • the antigens (either in polypeptide form or in RNA-coded form) to be included in the priming and boosting compositions need not be identical, but should share at least one common epitope (e.g., the priming composition comprising an RNA molecule that encodes a first polypeptide antigen that comprises a first epitope; the boosting composition comprising a second polypeptide antigen that comprises a second epitope; wherein said first epitope and second epitope are the same epitope).
  • One embodiment of the invention uses an "RNA prime, protein boost" immunization strategy. Following priming (at least once) with an RNA molecule, a polypeptide molecule is subsequently administered to boost the immune response in the primed host.
  • Another embodiment of the invention uses an "RNA+protein prime, protein boost" strategy. Following priming (at least once) with an immunogenic composition comprising an RNA molecule and a polypeptide molecule, a polypeptide molecule is subsequently administered to boost the immune response in the primed host.
  • the subject may be primed and/or boosted more than once.
  • the immunization strategy can be prime, prime, boost; or prime, boost, boost.
  • the priming composition is administered as least twice, at least 3 times, at least 4 times, or at least 5 times.
  • the boost composition is administered as least twice, at least 3 times, at least 4 times, or at least 5 times.
  • Administration of the boosting composition is generally weeks or months after administration of the priming composition, such as about 1 week, about 2 weeks, about 3 weeks, about 4 weeks, about 8 weeks, about 12 weeks, about 16 weeks, about 20 weeks, about 24 weeks, about 28 weeks, about 32 weeks, about 36 weeks, about 40 weeks, about 44 weeks, about 48 weeks, about 52 weeks, about 1 month, about 2 months, about 3 months, about 4 months, about 5 months, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, about 12 months, about 18 months, about 2 years, about 3 years, about 4 years, about 5 years, about 6 years, about 7 years, about 8 years, about 9 years, or about 10 years after the priming composition is administered.
  • Suitable animal subjects for administration of the compositions disclosed herein include, for example, fish, birds, cattle, pigs, horses, deer, sheep, goats, bison, rabbits, cats, dogs, chickens, ducks, turkeys, and the like.
  • the mammal is preferably a human.
  • the human is preferably a child (e.g., a toddler or infant), a teenager, or an adult; where the vaccine is for therapeutic use, the human is preferably a teenager or an adult.
  • a vaccine intended for children may also be
  • One way of checking efficacy of therapeutic treatment involves monitoring pathogen infection after administration of the compositions or vaccines disclosed herein.
  • One way of checking efficacy of prophylactic treatment involves monitoring immune responses, systemically (such as monitoring the level of IgGl and IgG2a production) and/or mucosally (such as monitoring the level of IgA production), against the antigen.
  • immune responses systemically (such as monitoring the level of IgGl and IgG2a production) and/or mucosally (such as monitoring the level of IgA production)
  • antigen-specific serum antibody responses are determined post-immunization but pre- challenge whereas antigen-specific mucosal antibody responses are determined post- immunization and post-challenge.
  • nucleic acid molecule e.g., the RNA
  • the nucleic acid molecule encodes a protein antigen
  • Another way of assessing the immunogenicity of the compositions or vaccines disclosed herein where the nucleic acid molecule (e.g., the RNA) encodes a protein antigen is to express the protein antigen recombinantly for screening patient sera or mucosal secretions by immunoblot and/or microarrays. A positive reaction between the protein and the patient sample indicates that the patient has mounted an immune response to the protein in question. This method may also be used to identify immunodominant antigens and/or epitopes within protein antigens.
  • compositions can also be determined in vivo by challenging appropriate animal models of the pathogen of interest infection.
  • Dosage can be by a single dose schedule or a multiple dose schedule. Multiple doses may be used in a primary immunization schedule and/or in a booster immunization schedule. In a multiple dose schedule the various doses may be given by the same or different routes, e.g., a parenteral prime and mucosal boost, a mucosal prime and parenteral boost, etc. Multiple doses will typically be administered at least 1 week apart (e.g., about 2 weeks, about 3 weeks, about 4 weeks, about 6 weeks, about 8 weeks, about 10 weeks, about 12 weeks, about 16 weeks, etc.).
  • compositions disclosed herein that include one or more antigens or are used in conjunction with one or more antigens may be used to treat both children and adults.
  • a human subject may be less than 1 year old, 1-5 years old, 5-15 years old, 15- 55 years old, or at least 55 years old.
  • Preferred subjects for receiving the compositions are the elderly (e.g., >50 years old, >60 years old, and preferably >65 years), the young (e.g., ⁇ 5 years old), hospitalized patients, healthcare workers, armed service and military personnel, pregnant women, the chronically ill, or immunodeficient patients.
  • the compositions are not suitable solely for these groups, however, and may be used more generally in a population.
  • Preferred routes of administration include, but are not limited to, intramuscular, intraperitoneal, intradermal, subcutaneous, intravenous, intraarterial, and intraoccular injection. Oral and transdermal administration, as well as administration by inhalation or suppository is also contemplated. Particularly preferred routes of administration include intramuscular, intradermal and subcutaneous injection. According to some embodiments of the present invention, the composition is administered to a host animal using a needleless injection device, which are well-known and widely available.
  • a vaccine that targets a particular target cell type (e.g., an antigen presenting cell or an antigen processing cell).
  • a particular target cell type e.g., an antigen presenting cell or an antigen processing cell.
  • RNA molecules of the invention can also be introduced directly into a tissue, such as muscle. See, e.g., U.S. Pat. No. 5,580,859.
  • RNA into cells of a mammal are also suitable for introduction of RNA into cells of a mammal.
  • biolistic or particle-mediated transformation (see, e.g., Sanford et al, U.S. Pat. No. 4,945,050; U.S. Pat. No. 5,036,006) are also suitable for introduction of RNA into cells of a mammal. These methods are useful not only for in vivo introduction of RNA into a mammal, but also for ex vivo modification of cells for reintroduction into a mammal.
  • the present invention includes the use of suitable delivery systems, such as liposomes, polymer microparticles or submicron emulsion microparticles with encapsulated or adsorbed RNA, or RNA + polypeptide, to deliver the RNA, or RNA + polypeptide, to elicit an immune response.
  • suitable delivery systems such as liposomes, polymer microparticles or submicron emulsion microparticles with encapsulated or adsorbed RNA, or RNA + polypeptide, to deliver the RNA, or RNA + polypeptide, to elicit an immune response.
  • the invention includes liposomes, microparticles, submicron emulsions, or combinations thereof, with adsorbed and/or encapsulated RNA, or RNA + polypeptide.
  • compositions disclosed herein that include one or more antigens, or are used in conjunction with one or more antigens may be administered to patients at substantially the same time as (e.g., during the same medical consultation or visit to a healthcare professional or vaccination centre) other vaccines, e.g., at substantially the same time as a measles vaccine, a mumps vaccine, a rubella vaccine, a MMR vaccine, a varicella vaccine, a MMRV vaccine, a diphtheria vaccine, a tetanus vaccine, a pertussis vaccine, a DTP vaccine, a conjugated H.
  • other vaccines e.g., at substantially the same time as a measles vaccine, a mumps vaccine, a rubella vaccine, a MMR vaccine, a varicella vaccine, a MMRV vaccine, a diphtheria vaccine, a tetanus vaccine, a pertussis vaccine, a DTP vaccine, a conjugated H.
  • influenzae type b vaccine an inactivated poliovirus vaccine, a hepatitis B virus vaccine, a meningococcal conjugate vaccine (such as a tetravalent A C W135 Y vaccine), a respiratory syncytial virus vaccine, etc.
  • an "antigen” refers to a molecule containing one or more epitopes (either linear, conformational or both), that elicits an immunological response.
  • An "epitope" is a portion of an antigen that is recognized by the immune system (e.g., by an antibody, an immunoglobulin receptor, a B cell receptor, or a T cell receptor).
  • An epitope can be linear or conformational. Commonly, an epitope is a polypeptide or polysaccharide in a naturally occurring antigen. In artificial antigens it can be a low molecular weight substance such as an arsanilic acid derivative.
  • T-cells and B-cells recognize antigens in different ways.
  • T-cells recognize peptide fragments of proteins that are embedded in class-II or class-I MHC molecules at the surface of cells
  • B-cells recognize surface features of an unprocessed antigen, via immunoglobulin-like cell surface receptors.
  • the difference in antigen recognition mechanisms of T-cells and B-cells are reflected in the different natures of their epitopes.
  • T-cell epitopes (which comprise peptides of about 8-12 amino acids in length) can be "internal” as well as "surface” when viewed in the context of the three-dimensional structure of the antigen.
  • a B-cell epitope is preferably exposed on the surface of the antigen or pathogen, and can be linear or conformational, whereas a T-cell epitope is typically linear but is not required to be available or on the surface of the antigen.
  • a B-cell epitope will include at least about 5 amino acids but can be as small as 3-4 amino acids.
  • a T-cell epitope, such as a CTL epitope will typically include at least about 7-9 amino acids, and a helper T-cell epitope will typically include at least about 12-20 amino acids.
  • fusion polypeptide refers to a single polypeptide in which the amino acid sequence is derived from at least two different naturally occurring proteins or polypeptide chains.
  • naked refers to nucleic acids that are substantially free of other macromolecules, such as lipids, polymers, and proteins.
  • a "naked” nucleic acid such as a self-replicating RNA, is not formulated with other macromolecules to improve cellular uptake. Accordingly, a naked nucleic acid is not encapsulated in, absorbed on, or bound to a liposome, a microparticle or nanoparticle, a cationic emulsion, and the like.
  • nucleotide analog or “modified nucleotide” refers to a nucleotide that contains one or more chemical modifications (e.g., substitutions) in or on the nitrogenous base of the nucleoside (e.g., cytosine (C), thymine (T) or uracil (U)), adenine (A) or guanine (G)).
  • C cytosine
  • T thymine
  • U uracil
  • G guanine
  • a nucleotide analog can contain further chemical modifications in or on the sugar moiety of the nucleoside (e.g., ribose, deoxyribose, modified ribose, modified deoxyribose, six-membered sugar analog, or open-chain sugar analog), or the phosphate.
  • pathogen refers to a virus, eukaryote, prokaryote or archaea that is capable of proliferation, and causes a disease or illness in a host organism, such as a vertebrate (e.g., a mammal).
  • a pathogen can be a viral, bacterial, protozoan, or fungal species, as well as a multi-cellular parasitic species.
  • two epitopes are from the same pathogen when the two epitopes are from the same pathogen species, but not necessarily from the same strain, serotype, clade, etc.
  • the two epitopes can be from two different subspecies, strains, or serotypes of the same pathogen (e.g., one epitope from H1 1 influenza virus, the other epitope from H3N2 influenza virus; one epitope from HIV-1 Clade B, the other epitope from HIV-1 Clade C; etc.).
  • one epitope from H1 1 influenza virus the other epitope from H3N2 influenza virus
  • one epitope from HIV-1 Clade B the other epitope from HIV-1 Clade C; etc.
  • polypeptide antigen refers to a polypeptide comprising one or more epitopes (either linear, conformational or both), that elicits an immunological response.
  • Polypeptide antigens include, for example, a naturally-occurring protein, a mutational variant of a naturally-occurring protein (e.g., a protein that has amino acid substitution(s), addition(s), or deletion(s)), a truncated form of a naturally-occurring protein (e.g., an intracellular domain or extracellular domain of a membrane-anchored protein), as well as a fusion protein (a protein that is derived from at least two different naturally occurring proteins or polypeptide chains).
  • polypeptide antigens also encompass polypeptides that comprise one or more amino acid stereoisomers, derivatives, or analogues.
  • amino acid derivatives include, e.g., chemical modifications of amino acids such as alkylation, acylation, carbamylation, iodination, etc.
  • Amino acid analogues include, e.g., compounds that have the same basic chemical structure as a naturally occurring amino acid, such as homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
  • Polypeptide antigens also encompass polypeptides that are modified post- translationally (such as acetylated, phosphorylated, or glycosylated polypeptides).
  • an epitope of a polypeptide antigen is not limited to a peptide.
  • an epitope of a glycosylated polypeptide may be a saccharide group that is attached to the polypeptide chain.
  • Two protein antigens are "substantially the same” if the amino acid sequence identify between the two antigens is at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, across the length of the shorter antigen.
  • treat include alleviating, abating or ameliorating disease or condition symptoms, preventing additional symptoms, ameliorating or preventing the underlying metabolic causes of symptoms, inhibiting the disease or condition, e.g., arresting the development of the disease or condition, relieving the disease or condition, causing regression of the disease or condition, relieving a condition caused by the disease or condition, or stopping the symptoms of the disease or condition.
  • treatment include, but are not limited to, prophylactic and/or therapeutic treatments
  • VRP viral replicon particle
  • virus-like particle refers to a structure formed by viral coat proteins (e.g., a capsid) and optionally an evelope, but having no genetic material.
  • a VLP resembles a viral particle.
  • Plasmid DNA encoding alphavirus replicons (see sequences, vA317, vA17, vA336, vA160, vA322, vA31 1, vA306, vA142, vA526, vA527, vA318, vA140, vA318, vA372, vA368, vA369) served as a template for synthesis of RNA in vitro.
  • Replicons contain the genetic elements required for RNA replication but lack those encoding gene products necessary for particle assembly; the structural genes of the alphavirus genome are replaced by sequences encoding a heterologous protein.
  • the positive-stranded RNA is translated to produce four non-structural proteins, which together replicate the genomic RNA and transcribe abundant subgenomic mRNAs encoding the heterologous gene product. Due to the lack of expression of the alphavirus structural proteins, replicons are incapable of inducing the generation of infectious particles.
  • a bacteriophage (T7 or SP6) promoter upstream of the alphavirus cDNA facilitates the synthesis of the replicon RNA in vitro and the hepatitis delta virus (HDV) ribozyme immediately downstream of the poly(A)-tail generates the correct 3 '-end through its self- cleaving activity.
  • HDV hepatitis delta virus
  • run-off transcripts were synthesized in vitro using T7 or SP6 bacteriophage derived DNA-dependent RNA polymerase.
  • RNA samples Post-transcriptionally capped RNA was precipitated with LiCl and reconstituted in nuclease-free water. The concentration of the RNA samples was determined by measuring the optical density at 260 nm. Integrity of the in vitro transcripts was confirmed by denaturing agarose gel electrophoresis.
  • l,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane was synthesized using a previously published procedure [Heyes, J., Palmer, L., Bremner, K., MacLachlan, I. Cationic lipid saturation influences intracellular delivery of encapsulated nucleic acids. Journal of Controlled Release, 107: 276-287 (2005)].
  • 1, 2-Diastearoyl-sw- glycero-3-phosphocholine (DSPC) was purchased from Genzyme. Cholesterol was obtained from Sigma-Aldrich (St. Lois, MO).
  • lipids RV03, RV04, RV05, RV06, RV07, RV08, RV09, RV10, RV1 1, RV12, RV15 were made as previously described in WO 2011/076807, which disclosed the lipids and methods for making them.
  • Lipid RV02 can be prepared according to known methods including the methods disclosed in WO 201 1/057020. For example by substituting the alpha-amino and carbonyl of NorArgenine with a long chain alkenoyl and a long chain alkylamino, respectively. RV02 has the structure
  • LNPs were formulated using three methods:
  • DlinDMA 1 1.8 mg of DSPC, 27.8 mg of Cholesterol and 8.07 mg of PEG DMG 2000 were weighed and dissolved in 7.55 mL of ethanol.
  • the freshly prepared lipid stock solution was gently rocked at 37 °C for about 15 min to form a homogenous mixture.
  • 120.9 ⁇ ⁇ of the stock was added to 1.879 mL ethanol to make a working lipid stock solution of 2 mL. This amount of lipids was used to form LNPs with 40 ⁇ g RNA at a 8: 1 N:P (Nitrogen to Phosphate) ratio.
  • RNA The protonatable nitrogen on DlinDMA (the cationic lipid) and phosphates on the RNA are used for this calculation.
  • Each ⁇ g of self-replicating RNA molecule was assumed to contain 3 nmoles of anionic phosphate, each ⁇ g of DlinDMA was assumed to contains 1.6 nmoles of cationic nitrogen.
  • a 2 mL working solution of RNA was also prepared from a stock solution of ⁇ ⁇ g ⁇ L in 100 mM citrate buffer (pH 6) (Teknova). Three 20 mL glass vials (with stir bars) were rinsed with RNase Away solution (Molecular BioProducts) and washed with plenty of MilliQ water before use to decontaminate the vials of RNAses.
  • RNA working solution was used for the RNA working solution and the others for collecting the lipid and RNA mixes (as described later).
  • the working lipid and RNA solutions were heated at 37 °C for 10 min before being loaded into 3cc luer-lok syringes (BD Medical). 2 mL of citrate buffer (pH 6) was loaded in another 3 cc syringe.
  • Syringes containing RNA and the lipids were connected to a T mixer (PEEKTM 500 ⁇ ID junction) using FEP tubing([fluorinated ethylene-propylene] 2mm ID x 3 mm OD, Idex Health Science, Oak Harbor, WA).
  • the outlet from the T mixer was also FEP tubing (2mm ID x 3mm).
  • the third syringe containing the citrate buffer was connected to a separate piece of tubing (2mm ID x 3mm OD). All syringes were then driven at a flow rate of 7 mL/min using a syringe pump (from kdScientific, model no. KDS-220). The tube outlets were positioned to collect the mixtures in a 20 mL glass vial (while stirring).
  • pKas referred to herein are measured in water at standard temperature and pressure. Also, unless otherwise indicated, all references to pKa are references to pKa measured using the following technique. 2mM solution of lipid in ethanol are prepared by weighing the lipid and then dissolving in ethanol. 0.3mM solution of fluorescent probe TNS in ethanokmethanol 9: 1 is prepared by first making 3mM solution of TNS in methanol and then diluting to 0.3mM with ethanol.
  • aqueous buffer containing sodium phosphate, sodium citrate, sodium acetate and sodium chloride, at the concentrations 20mM, 25mM, 20mM and 150 mM, respectively, is prepared.
  • the buffer is split into eight parts and the pH adjusted either with 12N HC1 or 6N NaOH to 4.44-4.52, 5.27, 6.15-6.21, 6.57, 7.10-7.20, 7.72-7.80, 8.27-8.33 and 10.47-11.12. 400uL of 2mM lipid solution and 800uL of 0.3mM TNS solution are mixed.
  • the background fluorescence value of an empty well on the 96 well plate is subtracted from each probe/lipid/buffer mixture.
  • the fluorescence intensity values are then normalized to the value at lowest pH.
  • the normalized fluorescence intensity vs. pH chart is then plotted in the Microsoft Excel software. The eight points are connected with a smooth line.
  • Method B 75 ⁇ g batch, PES hollow fibers and no mustang
  • DlinDMA 1 1.8 mg of DSPC, 27.8 mg of Cholesterol and 8.07 mg of PEG DMG 2000 were weighed and dissolved in 7.55 mL of ethanol.
  • the freshly prepared lipid stock solution was gently rocked at 37 °C for about 15 min to form a homogenous mixture.
  • 226.7 ⁇ ⁇ of the stock was added to 1.773 mL ethanol to make a working lipid stock solution of 2 mL. This amount of lipids was used to form LNPs with 75 ⁇ g RNA at a 8: 1 N:P (Nitrogen to Phosphate) ratio.
  • RNA The protonatable nitrogen on DlinDMA (the cationic lipid) and phosphates on the RNA are used for this calculation.
  • Each ⁇ g of self-replicating RNA molecule was assumed to contain 3 nmoles of anionic phosphate, each ⁇ g of DlinDMA was assumed to contains 1.6 nmoles of cationic nitrogen.
  • a 2 mL working solution of RNA was also prepared from a stock solution of ⁇ ⁇ g ⁇ L in 100 mM citrate buffer (pH 6) (Teknova). Three 20 mL glass vials (with stir bars) were rinsed with RNase Away solution (Molecular BioProducts) and washed with plenty of MilliQ water before use to decontaminate the vials of RNAses.
  • RNA working solution was used for the RNA working solution and the others for collecting the lipid and RNA mixes (as described later).
  • the working lipid and RNA solutions were heated at 37 °C for 10 min before being loaded into 3cc luer-lok syringes (BD Medical). 2 mL of citrate buffer (pH 6) was loaded in another 3 cc syringe.
  • Syringes containing RNA and the lipids were connected to a T mixer (PEEKTM 500 ⁇ ID junction) using FEP tubing([fluorinated ethylene-propylene] 2mm ID x 3 mm OD, Idex Health Science, Oak Harbor, WA).
  • the outlet from the T mixer was also FEP tubing (2mm ID x 3mm).
  • the third syringe containing the citrate buffer was connected to a separate piece of tubing (2mm ID x 3mm OD). All syringes were then driven at a flow rate of 7 mL/min using a syringe pump (from kdScientific, model no. KDS-220). The tube outlets were positioned to collect the mixtures in a 20 mL glass vial (while stirring). The stir bar was taken out and the ethanol/aqueous solution was allowed to equilibrate to room temperature for 1 h.
  • TFF system and hollow fiber filtration membranes were purchased from Spectrum Labs and were used according to the manufacturer's guidelines.
  • Polyethersulfone (PES) hollow fiber filtration membranes (part number P-Cl-lOOE-100-OlN) with a 100 kD pore size cutoff and 20 cm 2 surface area were used.
  • PES Polyethersulfone
  • IX PBS IX PBS
  • DlinDMA 1 1.8 mg of DSPC, 27.8 mg of Cholesterol and 8.07 mg of PEG DMG 2000 were weighed and dissolved in 7.55 mL of ethanol.
  • the freshly prepared lipid stock solution was gently rocked at 37 °C for about 15 min to form a homogenous mixture.
  • 226.7 ⁇ ⁇ of the stock was added to 1.773 mL ethanol to make a working lipid stock solution of 2 mL. This amount of lipids was used to form LNPs with 75 ⁇ g RNA at a 8: 1 N:P (Nitrogen to Phosphate) ratio.
  • RNA The protonatable nitrogen on DlinDMA (the cationic lipid) and phosphates on the RNA are used for this calculation.
  • Each ⁇ g of self-replicating RNA molecule was assumed to contain 3 nmoles of anionic phosphate, each ⁇ g of DlinDMA was assumed to contains 1.6 nmoles of cationic nitrogen.
  • a 2 mL working solution of RNA was also prepared from a stock solution of ⁇ ⁇ g ⁇ L in 100 mM citrate buffer (pH 6) (Teknova). Three 20 mL glass vials (with stir bars) were rinsed with RNase Away solution (Molecular BioProducts) and washed with plenty of MilliQ water before use to decontaminate the vials of RNAses.
  • RNA working solution was used for the RNA working solution and the others for collecting the lipid and RNA mixes (as described later).
  • the working lipid and RNA solutions were heated at 37 °C for 10 min before being loaded into 3cc luer-lok syringes (BD Medical). 2 mL of citrate buffer (pH 6) was loaded in another 3 cc syringe.
  • Syringes containing RNA and the lipids were connected to a T mixer (PEEKTM 500 ⁇ ID junction) using FEP tubing([fluorinated ethylene-propylene] 2mm ID x 3 mm OD, Idex Health Science, Oak Harbor, WA).
  • the outlet from the T mixer was also FEP tubing (2mm ID x 3mm).
  • the third syringe containing the citrate buffer was connected to a separate piece of tubing (2mm ID x 3mm OD). All syringes were then driven at a flow rate of 7 mL/min using a syringe pump (from kdScientific, model no. KDS-220). The tube outlets were positioned to collect the mixtures in a 20 mL glass vial (while stirring). The stir bar was taken out and the ethanol/aqueous solution was allowed to equilibrate to room temperature for 1 h.
  • Polyethersulfone (PES) hollow fiber filtration membranes (part number P-C1-100E- 100-0 IN) with a 100 kD pore size cutoff and 20 cm 2 surface area were used.
  • PES Polyethersulfone
  • IX PBS IX PBS
  • DOTAP was dissolved in the squalene directly, and no organic solvent was used. It was discovered that inclusion of a solvent in emulsions that contained greater than 1.6 mg/ml DOTAP produced a foamy feedstock that could not be microfluidized to produce an emulsion. Heating squalene to 37°C allowed DOTAP to be directly dissolved in squalene, and then the oil phase could be successfully dispersed in the aqueous phase (e.g., by homogenization) to produce an emulsion.
  • the number of nitrogens in solution was calculated from the cationic lipid concentration, DOTAP for example has 1 nitrogen that can be protonated per molecule.
  • the RNA concentration was used to calculate the amount of phosphate in solution using an estimate of 3 nmols of phosphate per microgram of RNA.
  • the N/P ratio can be modified.
  • RNA was complexed to the CNEs in a range of nitrogen / phosphate ratios (N/P). Calculation of the N/P ratio was done by calculating the number of moles of protonatable nitrogens in the emulsion per milliliter. To calculate the number of phosphates, a constant of 3 nmols of phosphate per microgram of RNA was used.
  • the appropriate ratio of the emulsion was added to the RNA.
  • the RNA was diluted to the appropriate concentration and added directly into an equal volume of emulsion while vortexing lightly. The solution was allowed to sit at room temperature for approximately 2 hours. Once complexed the resulting solution was diluted to the appropriate concentration and used within 1 hour.
  • RNA and RNA concentration were determined by Quant-iT RiboGreen RNA reagent kit (Invitrogen). Manufacturer's instructions were followed in the assay. The ribosomal RNA standard provided in the kit was used to generate a standard curve. LNPs were diluted ten fold or one hundred fold in IX TE buffer (from kit), before addition of the dye. Separately, LNPs were diluted ten or 100 fold in IX TE buffer containing 0.5% Triton X (Sigma-Aldrich), before addition of the dye.
  • Triton X was used to disrupt the LNPs, providing a fluorescence reading corresponding to the total RNA amount and the sample without Triton X provided fluorescence corresponding to the unencapsulated RNA.
  • RNAse protection of the encapsulated RNA was performed to evaluate the integrity of the RNA after the formulation process and to assess the RNAse protection of the encapsulated RNA.
  • the gel was cast as follows: 0.4g of agarose (Bio-Rad, Hercules, CA) was added to 36 ml of DEPC treated water and heated in a microwave until dissolved and then cooled until warm. 4 ml of lOx denaturing gel buffer (Ambion, Austin, TX), was then added to the agarose solution. The gel was poured and was allowed to set for at least 30 minutes at room temperature. The gel was then placed in a gel tank, and lx Northernmax running buffer (Ambion, Austin, TX) was added to cover the gel by a few millimeters.
  • RNA A per microgram of RNA (Ambion, Hercules, and CA) for 30 minutes at room temperature.
  • RNase was inactivated with Protenase K (Novagen, Darmstadt, Germany) by incubating the sample at 55°C for 10 minutes.
  • Post RNase inactivation a 1 : 1 v/v mixture of sample to 25:24: 1 v/v/v, phenol: chloroform: isoamyl alcohol was added to extract the RNA from the lipids into the aqueous phase. Samples were mixed by vortexing for a few seconds and then placed on a centrifuge for 15 minutes at 12k RPM. The aqueous phase (containing the RNA) was removed and used to analyze the RNA.
  • RNA construct Prior to loading (400 ng RNA per well) all the samples were incubated with formaldehyde loading dye, denatured for 10 minutes at 65°C and cooled to room temperature. Ambion Millennium markers were used to approximate the molecular weight of the RNA construct. The gel was run at 90 V. The gel was stained using 0.1% SYBR gold according to the manufacturer's guidelines (Invitrogen, Carlsbad, CA) in water by rocking at room temperature for 1 hour. Gel images were taken on a Bio-Rad Chemidoc XRS imaging system (Hercules, CA).
  • SEAP Secreted alkaline phosphatase
  • RNA replicon encoding for SEAP was administered with and without formulation to mice via intramuscularly injection. Groups of 5 female BALB/c mice aged 8-10 weeks and weighing about 20g were immunized with liposomes encapsulating RNA encoding for SEAP. Naked RNA was administered in RNase free IX PBS. As a positive control, viral replicon particles (VRPs) at a dose of 5X10 5 infectious units (IU) were also sometimes administered. A ⁇ dose was administered to each mouse (50 ⁇ 1 per site) in the quadriceps muscle. Blood samples were taken 1, 3, and 6 days post injection. Serum was separated from the blood immediately after collection, and stored at -30°C until use.
  • VRPs viral replicon particles
  • a chemiluminescent SEAP assay Phospha-Light System (Applied Biosystems, Bedford, MA) was used to analyze the serum.
  • Mouse sera were diluted 1 :4 in IX Phospha-Light dilution buffer. Samples were placed in a water bath sealed with aluminum sealing foil and heat inactivated for 30 minutes at 65°C. After cooling on ice for 3 minutes, and equilibrating to room temperature, 50 of Phospha-Light assay buffer was added to the wells and the samples were left at room temperature for 5 minutes.
  • reaction buffer containing 1 :20 CSPD® (chemiluminescent alkaline phosphate substrate) substrate 50 ⁇ ⁇ of reaction buffer containing 1 :20 CSPD® (chemiluminescent alkaline phosphate substrate) substrate was added, and the luminescence was measured after 20 minutes of incubation at room temperature. Luminescence was measured on a Berthold Centro LB 960 luminometer (Oak Ridge, TN) with a 1 second integration per well. The activity of SEAP in each sample was measured in duplicate and the mean of these two measurements taken.
  • VRP Viral replicon particles
  • VRPs viral replicon particles
  • the antigen (or reporter gene) replicons consisted of alphavirus chimeric replicons (VCR) derived from the genome of Venezuelan equine encephalitis virus (VEEV) engineered to contain the 3' terminal sequences (3 ' UTR) of Sindbis virus and a Sindbis virus packaging signal (PS) (see Fig. 2 of Perri et al). These replicons were packaged into VRPs by co-electroporating them into baby hamster kidney (BHK) cells along with defective helper RNAs encoding the Sindbis virus capsid and glycoprotein genes (see Fig. 2 of Perri et al, J. Virol. 77: 10394- 10403 (2003)). The VRPs were then harvested and titrated by standard methods and inoculated into animals in culture fluid or other isotonic buffers.
  • VCR alphavirus chimeric replicons
  • VEEV Venezuelan equine encephalitis virus
  • PS Sindbis virus packaging signal
  • the RSV F trimer is a recombinant protein comprising the ectodomain of RSV F with a deletion of the fusion peptide region preventing association with other trimers.
  • the resulting construct forms a homogeneous trimer, as observed by size exclusion chromatography, and has an expected phenotype consistent with a postfusion F conformation as observed by electron microscopy.
  • the protein was expressed in insect cells and purified by virtue of a HIS-tagged in fusion with the construct' s C-terminus followed by size exclusion chromatography using conventional techniques. The resulting protein sample exhibits greater than 95% purity.
  • trimer protein was adsorbed on 2 mg/mL alum using 10 mM Histidine buffer, pH 6.3 and isotonicity adjusted with sodium chloride to 150 mM.
  • F-subunit protein was adsorbed on alum overnight with gentle stirring at 2-8 °C.
  • mice Groups of 10 female BALB/c mice aged 8-10 weeks and weighing about 20 g were immunized at day 0 and day 21 with bleeds taken at days 14, 35 and 49. All animals were injected in the quadriceps in the two hind legs each getting an equivalent volume (50 ⁇ 1 per site). When measurement of T cell responses was required, spleens were harvested at day 35 or 49.
  • HRP horse radish peroxidase
  • OD optical density
  • GraphPad Prism For each serum sample, a plot of optical density (OD) versus logarithm of the reciprocal serum dilution was generated by nonlinear regression (GraphPad Prism). Titers were defined as the reciprocal serum dilution at an OD of approximately 0.5 (normalized to standard, pooled sera from RSV-infected cotton rats with a defined titer of 1 :2500, that was included on every plate).
  • Serum samples were tested for the presence of neutralizing antibodies by a plaque reduction neutralization test (PR T). Two-fold serial dilutions of HI-serum (in PBS with 5% HI-FBS) were added to an equal volume of RSV Long previously titered to give approximately 115 PFU/25 ⁇ . Serum/virus mixtures were incubated for 2 hours at 37°C and 5% C02, to allow virus neutralization to occur, and then 25 ⁇ of this mixture (containing approximately 1 15 PFU) was inoculated on duplicate wells of HEp-2 cells in 96 well plates.
  • PR T plaque reduction neutralization test
  • the cells were overlayed with 0.75% Methyl Cellulose/ EMEM 5% HI-FBS and incubated for 42 hours.
  • the number of infectious virus particles was determined by detection of syncytia formation by immunostaining followed by automated counting.
  • the neutralization titer is defined as the reciprocal of the serum dilution producing at least a 60% reduction in number of synctia per well, relative to controls (no serum).
  • Serum samples were tested for the presence of neutralizing antibodies by an infection reduction neutralization test. Two-fold serial dilutions of HI-serum (in DMEM with 10% HI FBS) were added to an equal volume of CMV (strain TB40 or clinical isolate 8819) previously titered to give approximately 200 ⁇ /50 ⁇ 1. Serum/virus mixtures were incubated for 2 hours at 37°C and 5% C02, to allow virus neutralization to occur, and then 50 ⁇ of this mixture (containing approximately 200 IU) was inoculated on duplicate wells of ARPE-19 cells in 96 half well plates. Plates were incubated for 40-44 hours.
  • the number of positive infected foci was determined by immunostaining with an AlexaFluor 488 conjugated IE1 CMV monoclonal antibody followed by automated counting.
  • the neutralization titer is defined as the reciprocal of the serum dilution producing a 50% reduction in number of positive virus foci per well, relative to controls (no serum).
  • Seronegative calves were defined as those having titers of ⁇ 1 :4 titer to BRSV in a constant virus, decreasing serum neutralization (SN) assay with 50-500 Tissue Culture Infective Dose 50 (TCID 50 ) BRSV. Calves were also screened prior to acquisition, for persistent infection with Bovine Virus Diarrhea Virus (BVDV). Immunohistochemistry (IHC) testing of ear notch samples was performed with all negative results.
  • SN serum neutralization
  • TCID 50 Tissue Culture Infective Dose 50
  • RNA and PBS vaccines were administered as 1.0 mL split doses on each side of the neck (2 mL total dose).
  • the Triangle 4 product was administered as labeled (2.0 mL dose on one side of the neck).
  • the RSV-F subunit protein vaccine (15 ⁇ g) adjvuanted with MF59 was administered as 1.0 mL split doses on each side of the neck (2 mL total dose).
  • Serum was collected for antibody analysis on days 0, 14, 21, 35, 42, 56, 63, 86, 100, 107, 114, 121, 128, 135, 146, 160, 167, 174, 181, 188, 195, and 202.
  • Example I CO-ADMINISTRATION OF RNA AND PROTEIN TO MICE
  • an RNA molecule encoding the RSV-F or an RNA molecule encoding the GFP protein, was co-administered with an RSV-F antigen in polypeptide form.
  • the effects of RNA on its "cognate” antigen and "non-cognate” antigen were assessed.
  • the RSV-F antigen is a "non-cognate" antigen of the GFP-coding RNA because the F antigen does not share sequence homology to, and does not immunologically cross-react with the polypeptide encoded by the RNA molecule (GFP).
  • RNAs were used for this study: the vA317 replicon that expresses the surface fusion glycoprotein of RSV (RSV-F); the vA17 replicon that expresses green fluorescent protein (GFP); and the vA336 replicon that is replication-defective and encodes GFP.
  • RSV-F surface fusion glycoprotein of RSV
  • GFP green fluorescent protein
  • vA336 replicon that is replication-defective and encodes GFP.
  • BALB/c mice 5 animals per group, were given bilateral intramuscular vaccinations (50 ⁇ , per leg) on days 0 and 21. Spleens were harvested at day 49 for T cell analysis. Animals, 70 total, were divided into 14 groups (5 animals per group):
  • Group 1 were given bilateral intramuscular vaccinations (50 ⁇ , per leg) on days 0, 21 with VRPs (lxlO 6 IU) expressing the full-length wild type surface fusion glycoprotein of RSV.
  • Group 2 were given bilateral intramuscular vaccinations (50 ⁇ , per leg) on days 0, 21 with the RSV-F subunit protein (5 ⁇ g).
  • Group 3 were given bilateral intramuscular vaccinations (50 ⁇ , per leg) on days 0, 21 with the RSV-F subunit protein vaccine (5 ⁇ g) adjuvanted with alum and a small molecule TLR7 agonist (TLR7A, 25 ⁇ g).
  • Group 4 were given bilateral intramuscular vaccinations (50 ⁇ ⁇ per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with self-replicating RNA (vA317, 1 ⁇ g, RSV-F) which had been formulated with CNE17 (prior to protein addition at an :P raio of 10: 1).
  • Group 5 were given bilateral intramuscular vaccinations (50 ⁇ , per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with self-replicating RNA (vA317, 1 ⁇ 3 ⁇ 4 RSV-F) which had been formulated with LNPs (RV01(36)).
  • the LNP had the following composition: 40% DlinDMA, 10% DSPC, 48% Choi, 2% PEG DMG 2000 and an N:P ratio of 8: 1. They were made using Method A, except a 150 ⁇ g RNA batch size was used.
  • Group 6 were given bilateral intramuscular vaccinations (50 ⁇ ⁇ per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with empty LNPs (RV01(36)), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in group 9 and 12 which contained 0.01 ⁇ g RNA.
  • Group 7 were given bilateral intramuscular vaccinations (50 ⁇ , per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with empty LNPs (RV01(36)), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in group 10 and 13 which contained 0.1 ⁇ g RNA.
  • Group 8 were given bilateral intramuscular vaccinations (50 ⁇ , per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with empty LNPs (RV01(36)), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in group 1 1 and 14 which contained 1.0 ⁇ g RNA.
  • Group 9 were given bilateral intramuscular vaccinations (50 ⁇ ⁇ per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with self-replicating RNA (vA17, 1 ⁇ g, GFP) formulated with LNPs (RV01(36)), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in groups 6 and 12.
  • Group 10 were given bilateral intramuscular vaccinations (50 ⁇ ⁇ per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with self-replicating RNA (vA17, 1 ⁇ g, GFP) formulated with LNPs (RV01(36)), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in groups 7 and 13.
  • Group 11 were given bilateral intramuscular vaccinations (50 ⁇ ⁇ per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with self-replicating RNA (vA17, 1 ⁇ g, GFP) formulated with LNPs (RV01(36), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in groups 8 and 14.
  • Group 12 were given bilateral intramuscular vaccinations (50 ⁇ ⁇ per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with non-replicating RNA (vA336, 1 ⁇ g, GFP) formulated with LNPs (RV01(36)), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in groups 6 and 9.
  • Group 13 were given bilateral intramuscular vaccinations (50 ⁇ ⁇ per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with non-replicating RNA (vA317, 1 ⁇ g, GFP) formulated with LNPs (RV01(36), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in groups 7 and 10.
  • Group 14 were given bilateral intramuscular vaccinations (50 ⁇ ⁇ per leg) on days 0, 21 with RSV-F subunit protein (5 ⁇ g) mixed with non-replicating RNA (vA317, 1 ⁇ g, GFP) formulated with LNPs (RV01(36), made as per group 5).
  • the lipid dose was equivalent to the dose of the LNP formulation in groups 8 and 11.
  • F-specific serum IgG titers are shown in tables I-1&2 (day 14) and I-
  • F-specific serum IgGl titers are shown in tables I-5&6 (day35) and F-specific serum IgG2a titers are shown in tables 1-7 - 1-9 (day 35).
  • RSV serum neutralizing antibody titers are shown in table I- 10 (days 35 and 49).
  • Average net F-specific cytokine-positive T cell frequencies are shown in Tables 1-11 and 1-12.
  • RNA formulated with LNP was a novel, potent adjuvant for recombinant protein (RSV F).
  • LNP was tested without and with RNA (encoding GFP) as adjuvants for F protein. Serum antibodies and splenic T cells specific for F antigen were measured.
  • the LNP RV01 (without RNA) was an adjuvant for F protein.
  • RV01 formulated with GFP RNA was even more effective, indicating that both the LNP and the RNA components contribute to the adjuvanticity.
  • RNA was needed to induce IgG2a, but not IgGl, indicating that LNP was not a "Thl" type adjuvant.
  • F RNA was compared to GFP RNA and to no RNA (LNP present in all).
  • LNP protein
  • F RNA was compared to GFP RNA and to no RNA (LNP present in all).
  • F RNA induced superior CD8 T cell responses compared to GFP RNA or no RNA
  • Table 1-1 F-specific serum IgG titers of BALB/c mice, 5 animals per group, 14 days after intramuscular vaccination. Data are represented as titers for individual mice and the geometric mean titers of 5 individual mice per group. If an individual animal had a titer of ⁇ 25 (limit of detection), it was assigned a titer of 5.
  • Table 1-2 Continued from Table 1-1. F-specific serum IgG titers of BALB/c mice, 5 animals per group, 14 days after intramuscular vaccination. Data are represented as titers for individual mice and the geometric mean titers of 5 individual mice per group. If an individual animal had a titer of ⁇ 25 (limit of detection), it was assigned a titer of 5.
  • Table 1-3 F-specific serum IgG titers of BALB/c mice, 5 animals per group, intramuscular vaccinations on days 0 and 21. Serum was collected for antibody analysis on day 35 (2wp2). Data are represented as titers for individual mice and the geometric mean titers of 5 individual mice per group.
  • Table 1-4 Continued from Table 1-3. F-specific serum IgG titers of BALB/c mice, 5 animals per group, intramuscular vaccinations on days 0 and 21. Serum was collected for antibody analysis on day 35 (2wp2). Data are represented as titers for individual mice and the geometric mean titers of 5 individual mice per group.
  • Table 1-5 F-specific serum IgGl titers of BALB/c mice, 5 animals per group, intramuscular vaccinations on days 0 and 21. Serum was collected for antibody analysis on day 35 (2wp2). Data are represented as titers for individual mice and the geometric mean titers of 5 individual mice per group.
  • Table 1-6 Continued from Table 1-5. F-specific serum IgGl titers of BALB/c mice, 5 animals per group, intramuscular vaccinations on days 0 and 21. Serum was collected for antibody analysis on day 35 (2wp2). Data are represented as titers for individual mice and the geometric mean titers of 5 i
  • Table 1-7 F-specific serum IgG2a titers of BALB/c mice, 5 animals per group, intramuscular vaccinations on days 0 and 21. Serum was collected for antibody analysis on day 35 (2wp2). Data are represented as titers for individual mice and the geometric mean titers of 5 individual mice per group. If an individual animal had a titer of ⁇ 25 (limit of detection), it was assigned a titer of 5.
  • Table 1-8 Continued from Table 1-7. F-specific serum IgG2a titers of BALB/c mice, 5 animals per group, intramuscular vaccinations on days 0 and 21. Serum was collected for antibody analysis on day 35 (2wp2). Data are represented as titers for individual mice and the geometric mean titers of 5 individual mice per group. If an individual animal had a titer of ⁇ 25 (limit of detection), it was
  • Table I- 10 RSV serum neutralization titers of BALB/c mice, 5 animals per group, after intramuscular vaccinations on days 0 and 21. Serum was collected for analysis on days 35 (2wp2) and 49 (4wp2). Data are represented as 60% plaque reduction neutralization titers of pools of 5 mice, 1 pool per group.
  • vA142 replicon was used for this study. This construct expresses the full-length wild type surface fusion glycoprotein of RSV with the fusion peptide deleted and the 3 ' end of the replicon is formed by ribozyme-mediated cleavage. BALB/c mice, 1 16 total, were divided into 1 1 groups (4-22 animals per group).
  • Group 1 (8 animals) were given bilateral intramuscular vaccinations
  • mice were given a third vaccination at day 42 with the RSV-F subunit protein vaccine (3 ⁇ g) adjuvanted with alum and the animals were sacrificed at day 63.
  • 6 mice were given a third vaccination at day 42 with RNA (vA142, 1 ⁇ g) formulated with CNE17 (10: 1 N:P ratio) and the animals were sacrificed at day 63.
  • mice were given a third vaccination at day 42 with RNA (vA142, 1 ⁇ g) formulated in LNP (RV01(39) (composition: DlinDMA 40%, DSPC- 10%, Choi- 48%, PEG DMG 5000-2% at an N:P ratio of 8: 1, made using Method A, 175 ⁇ g RNA batch size) and the animals were sacrificed at day 63.
  • RNA vA142, 1 ⁇ g
  • LNP RV01(39) (composition: DlinDMA 40%, DSPC- 10%, Choi- 48%, PEG DMG 5000-2% at an N:P ratio of 8: 1, made using Method A, 175 ⁇ g RNA batch size) and the animals were sacrificed at day 63.
  • TLR7A small molecule TLR7 agonist
  • RNA (vA142, 1 ⁇ g) formulated with CNE17 4 animals were sacrificed at day 42. 6 mice were given a third vaccination at day 42 with the RSV-F subunit protein vaccine (3 ⁇ g) adjuvanted with alum and the animals were sacrificed at day 63. 6 mice were given a third vaccination at day 42 with RNA (vA142, 1 ⁇ g) formulated with CNE17 and the animals were sacrificed at day 63.
  • RNA (vA142, 1 ⁇ g) formulated with LNP (RV01(39) ) (composition: DlinDMA 40%, DSPC- 10%, Choi- 48%, PEG DMG 5000-2% at an N:P ratio of 8: 1, made using Method A, 175 ⁇ g RNA batch size).
  • 4 animals were sacrificed at day 42.
  • 6 mice were given a third vaccination at day 42 with the RSV-F subunit protein vaccine (3 ⁇ g) adjuvanted with alum and the animals were sacrificed at day 63.
  • mice were given a third vaccination at day 42 with RNA (vA142, 1 ⁇ g) formulated with LNP (RV01(39) ) (composition: DlinDMA 40%, DSPC- 10%, Choi- 48%, PEG DMG 5000-2% at an N:P ratio of 8: 1, made using Method A, 175 ⁇ g RNA batch size) and the animals were sacrificed at day 63.
  • Group 8 (8 animals) were given bilateral intramuscular vaccinations
  • RNA (vA142, 1 ⁇ g) and the RSV-F protein subunit (no alum or MF59) formulated with CNE17. All animals were sacrificed at day 42.
  • RNA (vA142, 1 ⁇ g) formulated in LNP (RV01(39) ) (composition: DlinDMA 40%, DSPC- 10%, Choi- 48%, PEG DMG 5000-2% at an N:P ratio of 8: 1, made using Method A, 175 ⁇ g RNA batch size) and mixed with the RSV-F protein subunit (no alum or MF59). All animals were sacrificed at day 42.
  • VRPs (lxlO 6 IU) expressing the full-length wild type surface fusion glycoprotein of RSV with the fusion peptide deleted. 4 animals were sacrificed at day 42. 6 mice were given a third vaccination at day 42 with the RSV-F subunit protein vaccine (3 ⁇ g) adjuvanted with alum and the animals were sacrificed at day 63.
  • Serum was collected for antibody analysis on days 0, 20, 41 and 63. Spleens were harvested on days 42 and 63 for T-cell analysis.
  • F-specific serum IgG titers are shown in table II- 1 (day 20), II-2 (day 41) and II-7 (day 63).
  • F-specific serum IgGl titers are shown in tables II-3 (day 41) and II-8 (day 63)
  • F-specific serum IgG2a titers are shown in tables II-4 (day 41) and II-9 (day 63).
  • RSV serum neutralizing antibody titers are shown in tables II-5 (day 41) and 11-10 (day 63).
  • Average net F-specific cytokine-positive T cell frequencies are shown in tables II-6 (day 42) and II- 1 1 (day 63).
  • CNE17 is a potent adjuvant for the F subunit, as the F-specific IgG titers induced by vaccination with F subunit + CNE17 were greater than those induced by unadjuvanted F subunit, and equal to those induced by F subunit + alum or F subunit + MF59.
  • F subunit + CNE17, unadjuvanted F subunit, F subunit + alum, F subunit + MF59 the F-specific IgG response was primarily IgGl (very little/no IgG2a).
  • TLR7A TLR7 agonist
  • vA142 + CNE17 and vA142 + RV01 vaccines each induced F-specific IgG class switching to IgG2a (F-specific IgG2a titers were at least ten-fold greater than F-specific IgGl titers when measured after the second vaccination), although the magnitude of the response to vA142 + RV01 was approximately ten- fold greater response than the response to vA142 + CNE17.
  • vA142 + CNE17 + F subunit without alum or MF59 induced F-specific IgG titers that were 24-fold those induced by vA142 + CNE17 (without F subunit), but were approximately equal to those induced by F subunit + CNE17 (without vA142).
  • the F- specific IgG isotype induced by vA142 + CNE17 + F subunit was primarily IgGl, matching the response to F subunit + CNE17 (primarily IgGl) but not the response to vA142 + CNE17 (primarily IgG2a).
  • vA142 + RV01 + F subunit (without alum or MF59) induced a F-specific IgG titer that was approximately equal in magnitude to that induced by vA142 + CNE17 (without F subunit).
  • the F-specific IgG isotype induced by the vA142 + RV01 + F subunit vaccine was primarily IgG2a, matching the response to vA142 + CNE17.
  • the RSV neutralization titers at the two weeks post second vaccination time point correlated well with the total F-specific IgG titers.
  • vA142 + CNE17 + F subunit induced a robust CD8 T cell response that was greater in magnitude than the sum of the responses induced by F subunit + CNE17 and vA142 + CNE17 vaccines.
  • vA142 + RV01 + F subunit induced a robust CD8 response that was equal in magnitude to that induced by vA142 + RV01.
  • F-specific and RSV neutralization titers were greatly enhanced after F subunit + alum vaccination of mice previously vaccinated twice with vA142 + CNE17 (increased IgG titers by 46 fold and RSV neutralization titers by 62 fold). F-specific and RSV neutralization titers were also enhanced after F subunit + alum vaccination of mice previously vaccinated twice with vA142 + RVOl (increased IgG titers by 5 fold and RSV neutralization titers by 6 fold). The magnitude of the RSV neutralization titers after two replicon vaccinations followed by one F subunit + alum vaccination were equal to or greater than that induced by three subunit vaccinations.
  • the F-specific IgG isotype induced by F subunit + alum was primarily IgGl, whereas the isoytpe induced by vA142 + CNE17 or vA142 + RVOlwas primarily IgG2a.
  • This isoptype balance set by the priming vaccinations was maintained after a third vaccination with a homologous or heterologous vaccine.
  • the dominant F-specific IgG isotype was IgGl for mice vaccinated three times with F subunit + alum, vaccinated twice with F subunit + alum and then once with vA142 + CNE17, or vaccinated twice with F subunit + alum and then once with vA142 + RVOl .
  • the dominant F-specific IgG isotype was IgG2a for mice vaccinated three times with vA142 + CNE17, mice vaccinated three times with vA142 + RVOl, mice vaccinated twice with vA142 + CNE17 and then once with F subunit + alum, and mice vaccinated twice with vA142 + RVOl and then once with F subunit + alum.
  • IgGl is often associated with a T helper type 1 (Thl) and IgG2a is often associated with a T helper type 2 (Th2) response.
  • Table II- 1 F-specific serum IgG titers of BALB/c mice, 2-22 animals per group, 20 days ( ⁇ 3wpl) after intramuscular vaccination with the indicated vaccines. Data are represented as titers for individual animals and the geometric mean titer (bottom row in table) of each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table II-2 F-specific serum IgG titers of BALB/c mice, 2-22 animals per group, after intramuscular vaccination with the indicated vaccines on days 0 and 21. Serum was collected for antibody analysis on day 41 ( ⁇ 3wp2). Data are represented as titers for individual animals and the geometric mean titer (bottom row of table) for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table II-3 F-specific serum IgGl titers of BALB/c mice, 2-22 animals per group, after intramuscular vaccination with the indicated vaccines on days 0 and 21. Serum was collected for antibody analysis on day 41 ( ⁇ 3wp2). Data are represented as titers for individual animals and the geometric mean titer (bottom row of table) for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table II-4 F-specific serum IgG2a titers of BALB/c mice, 2-22 animals per group, after intramuscular vaccination with the indicated vaccines on days 0 and 21. Serum was collected for antibody analysis on day 41 ( ⁇ 3wp2). Data are represented as titers for individual animals and the geometric mean titer (bottom row of table) for each group. If an individual animal had a titer of ⁇ 125 (limit of detection) it was assigned a titer of 25.
  • Table II-5 RSV serum neutralization titers of BALB/c mice after intramuscular vaccinations with the indicated vaccines on days 0 and 21. Serum was collected for analysis on day 41 ( ⁇ 3wp2). Data are represented as 60% RSV neutralization titers for pools of 3-4 animals per group and geometric mean titers of 1-7 pools per group. If an individual pool had a titer of ⁇ 20 (limit of detection) it was assigned a titer of 10.
  • Table II-6 Frequencies of RSV F-specific CD4+ or CD8+ splenic T cells of BALB/c mice, 4 animals per group (except 2 in naive group), after intramuscular vaccination with the indicated vaccines on days 0 and 21. Spleens were collected for T cell analysis on day 42 ( ⁇ 3wp2). Shown are average net F-specific cytokine-positive frequencies (%>) of duplicate wells of one pool of 4 spleens per group.
  • Table II-7 F-specific serum IgG titers of BALB/c mice, 2-6 animals per group, after intramuscular vaccinations with the indicated 1 st , 2 nd , and 3 rd vaccines (administered on days 0, 21, and 42, respectively). Serum was collected for antibody analysis on day 63 (3wp3). Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table II-8 F-specific serum IgGl titers of BALB/c mice, 2-6 animals per group, after intramuscular vaccinations with the indicated 1 st , 2 nd , and 3 rd vaccines (administered on days 0, 21, and 42, respectively). Serum was collected for antibody analysis on day 63 (3wp3). Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 125 (limit of detection) it was assigned a titer of 25.
  • Table 11-10 RSV serum neutralization titers of BALB/c mice after intramuscular vaccinations with the indicated 1 st , 2 nd , and 3 rd vaccines (administered on days 0, 21, and 42, respectively). Serum was collected for analysis on day 63 (3wp3). Data are represented as 60% RSV neutralization titers for 2 pools of 3 animals per group and geometric mean titers of these 2 pools per group. If an individual
  • vA317 replicon which expresses the full-length wild type surface fusion glycoprotein of RSV (RSV-F); the vA318 replicon, which expresses the truncated (transmembrane and cytoplasmic tail removed) surface fusion glycoprotein of RSV; and the vA142 replicon, which expresses the full-length wild type surface fusion glycoprotein of RSV with the fusion peptide deleted.
  • Control groups received the RSV-F subunit protein vaccine (5 ⁇ g) adjuvanted with alum (8 animals/group) and VRP's expressing full-length RSV-F (lxlO 6 IU, 8 animals/group). All the LNP, subunit and VRP groups received a third vaccination (day 56) with RSV-F subunit protein vaccine (5 ⁇ g) adjuvanted with alum. In addition there was a naive control (4 animals/group). Serum was collected for antibody analysis on days 0, 21, 35, 56, 70.
  • RNA vA317, 1 ⁇ g
  • LNPs RV01(29)
  • CNE17 8 animals /group.
  • Serum was collected for antibody analysis on days 0, 14, 21, 28, 35, 42, 56, 70.
  • RSV serum neutralizing antibody titers on days 21, 35, 56 and 70 are shown in table III-5.
  • F-specific serum IgG titers on days 14, 21, 28, 35, 42, 56, 70 are shown in table III-6 for the two groups that did not receive the third vaccination with the RSV-F subunit vaccine.
  • RSV serum neutralizing antibody titers on days 14, 21, 28, 35, 42, 56, 70 for these two groups are shown in table III-7.
  • a ratio of F-specific IgG titer to RSV neutralizing titer can be calculated, and is one indication of the quality of the antibody response.
  • a lower ratio suggests that a larger fraction of the vaccine-induced antibody is capable of neutralizing RSV, and is therefore functional.
  • the data from this study show that the F-specific IgG: RSV neutralizing antibody titer ratio was lower after vaccination with replicon or VRP than after vaccination with F subunit + alum.
  • the lower F-specific IgG:RSV neutralizing antibody titer ratio set by two replicon or VRP vaccinations was maintained after a F subunit + alum boost.
  • This study also evaluated the kinetics of the antibody response to 1.0 ⁇ g vA317 formulated with RV01 or CNE17.
  • F-specific serum IgG and RSV neutralization titers induced by a single vaccination reached their peak around day 21 and were maintained through at least day 56 (50-70% drop in F-specific IgG titer, little change in RSV neutralization titer).
  • a homologous second vaccination was given to these animals on day 56, and boosted antibody titers to a level at least equal to that achieved when the second vaccination was administered on day 21.
  • Table III- 1 F-specific serum IgG titers of cotton rats, 2-8 animals per group, 21 days after intramuscular vaccination with the indicated vaccines. Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit
  • Table III-2 F-specific serum IgG titers of cotton rats, 2-8 animals per group, after intramuscular vaccination with the indicated vaccines on days 0 and 21. Serum was collected for antibody analysis on day 35 (2wp2). Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table III-3 F-specific serum IgG titers of cotton rats, 2-8 animals per group, after intramuscular vaccination with the indicated vaccines on days 0 and 21. Serum was collected for antibody analysis on day 56 (5wp2). Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table III-4 F-specific serum IgG titers of cotton rats, 2-8 animals per group, after intramuscular vaccination on days 0 and 21 with the indicated vaccines. All cotton rats (except those in naive group) were also vaccinated with 5 ⁇ g of F trimer subunit/alum on day 56. Serum was collected for antibody analysis on day 70 (2wp3). Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table III-5 RSV serum neutralization titers of cotton rats, 2-8 animals per group (2 per group for naive) after intramuscular vaccinations on days 0 and 21 with the indicated vaccines followed by 5 ug F trimer subunit/alum for all groups (except naive) on day 56. Serum was collected for analysis on days 21 (3wpl), 35 (2wp2), 56 (5wp2), and 70 (2wp3). Data are represented as 60% RSV
  • Table III-6 F-specific serum IgG titers of cotton rats, 5 animals per group, after intramuscular vaccination on days 0 and 56 with the indicated vaccines. Serum was collected for antibody analysis on days 14 (2wpl), 21 (3wpl), 28 (4wpl), 35 (5wpl), 42 (6wpl), 56 (8wpl) and 70 (2wp2). Data are represented as titers for individual animals and the geometric mean titer for each group. If an
  • Table III-7 RSV serum neutralization titers of cotton rats, 5 animals per group, after intramuscular vaccination on days 0 and 56 with the indicated vaccines. Serum was collected for antibody analysis on days 14 (2wpl), 21 (3wpl), 28 (4wpl), 35 (5wpl), 42 (6wpl), 56 (8wpl) and 70 (2wp2). Data are represented as 60% RSV neutralization titers for 1 pools of 5 animals per group. If an individual pool had a titer of ⁇ 20 (limit of detection) it was assigned a titer of 10.
  • vA142 replicon which expresses the full-length wild type surface fusion glycoprotein of RSV with the fusion peptide deleted, was used for this experiment.
  • LNPs (RV01(37).
  • the LNP had the following composition: 40% DlinDMA, 10% DSPC, 48% Choi, 2% PEG DMG 2000 and an N:P ratio of 8: 1. They were made using Method B, except a 175 ⁇ g RNA batch size was used.
  • Method B except a 175 ⁇ g RNA batch size was used.
  • Group 2 self-replicating RNA (vA142, 0.1 ⁇ 3 ⁇ 4 RSV-F) formulated in
  • LNPs (RV01(37).
  • the LNP had the following composition: 40% DlinDMA, 10% DSPC, 48% Choi, 2% PEG DMG 2000 and an N:P ratio of 8: 1. They were made using Method B, except a 175 ⁇ g RNA batch size was used.
  • LNPs (RV17(10).
  • the LNP had the following composition: NVP-LJC305 -NX-2 40%, DSPC- 10%, Choi- 49.5%, PEG DMG 5000-0.5% and an N:P ratio of 8: 1. They were made using Method A, except a 200 ⁇ g RNA batch size was used.
  • LNPs (RV17(10).
  • the LNP had the following composition: NVP-LJC305 -NX-2 40%, DSPC- 10%, Choi- 49.5%, PEG DMG 5000-0.5% and an N:P ratio of 8: 1. They were made using Method A, except a 200 ⁇ g RNA batch size was used.
  • LNPs (RV05(11).
  • the LNP had the following composition: NVP-LGB046-NX- 1 40%, 18:2 PE (DLoPE)- 30%, Choi- 28%, PEG DMG 2000-2% and an N:P ratio of 8: 1. They were made using Method A, except a 200 ⁇ g RNA batch size was used.
  • LNPs (RV05(11).
  • the LNP had the following composition: NVP-LGB046-NX- 1 40%, 18:2 PE (DLoPE)- 30%, Choi- 28%, PEG DMG 2000-2% and an N:P ratio of 8: 1. They were made using Method A, except a 200 ⁇ g RNA batch size was used.
  • Group 7 self-replicating RNA (vA142, 1.0 ⁇ 3 ⁇ 4 RSV-F) formulated with CNE13 at an N:P ratio of 10: 1.
  • Group 8 self-replicating RNA (vA142, 0.1 ⁇ 3 ⁇ 4 RSV-F) formulated with CNE13 at an N:P ratio of 10: 1.
  • Group 9 self-replicating RNA (vA142, 1.0 ⁇ 3 ⁇ 4 RSV-F) formulated with CNE17 at an N:P ratio of 10: 1.
  • Group 11 VRPs (lxlO 6 IU) expressing the full-length wild type surface fusion glycoprotein of RSV.
  • F-specific serum IgG titers are shown in table IV- 1 (day 21), IV-2
  • RSV neutralization titers were approximately equal for RV01, RV05, RV17 and CNE17, whereas titers with CNE13 were lower (35-68% of the RSV neutralization titer induced by a matched dose of vA142 + RV01). Titers in all groups were boosted by a homologous second vaccination given on day 21. After the second replicon vaccination, F-specific serum IgG titers were again highest with RV01, followed closely by RV05, RV17, and CNE17, and lower with CNE13 (25-33% of the F-specific IgG titer induced by a matched dose of vA142 + RV01).
  • RSV neutralization titers generally followed this same trend, although exhibited more variability within the groups.
  • RSV serum neutralization titers two weeks after the second vaccination were at least three fold lower in replicon groups than F subunit + alum or VRP groups.
  • a ratio of F-specific IgG titer to RSV neutralizing titer can be calculated, and is one indication of the quality of the antibody response.
  • a lower ratio suggests that a larger fraction of the vaccine-induced antibody is capable of neutralizing RSV, and is therefore functional.
  • the data from this study show that the F-specific IgG: RSV neutralizing antibody titer ratio is lower after vaccination with replicon or VRP than after vaccination with F subunit + alum.
  • the lower F-specific IgG:RSV neutralizing antibody titer ratio set by two replicon or VRP vaccinations was maintained after a F subunit + alum boost.
  • Table IV- 1 F-specific serum IgG titers of cotton rats, 3-8 animals per group, 21 days after intramuscular vaccination with the indicated vaccines. Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit
  • Table IV-2 F-specific serum IgG titers of cotton rats, 3-8 animals per group, after intramuscular vaccination with the indicated vaccines on days 0 and 21. Serum was collected for antibody analysis on day 35 (2wp2). Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table IV-3 F-specific serum IgG titers of cotton rats, 3-8 animals per group, after intramuscular vaccination with the indicated vaccines on days 0 and 21. Serum was collected for antibody analysis on day 49 (4wp2). Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it was assigned a titer of 5.
  • Table IV-4 F-specific serum IgG titers of cotton rats, 3-8 animals per group, after intramuscular vaccination on days 0 and 21 with the indicated vaccines. All cotton rats (except those in naive group) were also vaccinated with 5 ⁇ g of F trimer subunit/alum on day 49 (4wp2). Serum was collected for antibody analysis on day 64 ( ⁇ 2wp3). Data are represented as titers for individual animals and the geometric mean titer for each group. If an individual animal had a titer of ⁇ 25 (limit of detection) it
  • Table IV-5 RSV serum neutralization titers of cotton rats, 2-8 animals per group (2 per group for naive) after intramuscular vaccinations with the indicated vaccines on days 0 and 21 (3wpl). All animals (except naive) were then vaccinated with 5 ⁇ g F trimer subunit/alum on day 49 (4wp2). Serum was collected for analysis on days 21 (3wpl), 35 (2wp2), 49 (4wp2), and 64 ( ⁇ 2wp3). Data are represented as 60% RSV neutralization titers for 2 pools of 3-4 animals per group and geometric mean titers of these 2 pools per group (one pool of 3 animals for naive group). If an individual pool
  • RSV RSV-F
  • Calves (5 per group) were given intramuscular vaccinations on days 0, 21, 86 and 146.
  • RNA and PBS vaccines were administered as 1.0 mL split doses on each side of the neck (2 mL total dose).
  • the Triangle 4 product (a vaccine for prevention of disease caused by bovine respiratory syncytial virus as well as other pathogens; Ft. Dodge Animal Health) was administered as labeled (2.0 mL dose on one side of the neck).
  • the RSV-F subunit protein vaccine (15 ⁇ g) adjvuanted with MF59 was administered as 1.0 mL split doses on each side of the neck (2 mL total dose).
  • Self- replicating RNA (vA317, 60 ⁇ g) was formulated in LNP (RV01(01), with the following composition: 40% DlinDMA, 10% DSPC, 48% Choi, 2% PEG DMG 2000, N:P ratio of 8: 1 and was made using Method C, except a 1.5 mg RNA batch size was used.
  • Self replicating RNA (vA317, 60 ⁇ g) was formulated with CNE17 at an :P ratio of 10: 1.
  • RNA/CNE RNA/LNP
  • a commercial RSV vaccine Triangle 4
  • PBS PBS
  • RNA vaccines in this study encoded human RSV F while the Triangle 4 contained bovine RSV F (the RSV F protein is highly conserved between BRSV and HRSV). All calves were vaccinated a fourth time with RSV-F subunit/MF59. Serum was collected for antibody analysis on days 0, 14, 21, 35, 42, 56, 63, 86, 100, 107, 1 14, 121, 128, 135, 146, 160, 167, 174, 181, 188, 195, and 202.
  • RNA/CNE-vaccinated calves demonstrating good neutralizing antibody titers after the third vaccination as measured by the complement-independent HRSV neutralization assay.
  • all vaccinated calves had good neutralizing antibody titers after the second RNA vaccination regardless of the formulation.
  • both RNA/CNE and RNA/LNP elicited F-specific serum IgG titers that were detected in a few calves after the second vaccination and in all calves after the third vaccination.
  • RNA replicon vaccines in large animals is particularly important in light of the loss in potency observed previously with DNA-based vaccines when moving from small animal models to larger animals and humans.
  • a typical dose for DNA in cows is 0.5 -1.0 mg (Taylor 2005, Boxus 2007), so it is very encouraging that immune responses were induced with these 1 st generation RNA vaccines at a 60 ⁇ g dose.
  • the RNA/LNP vaccine was also shown to be superior to DNA in the mouse model experiments. [00427]
  • CNE-formulated RNA is more immunogenic than the LNP-formulated RNA in calves. This was evident in higher ELISA titers after the second vaccination, and higher neutralization titers after the third vaccination with the former formulation.
  • RSV-F subunit/MF59 was able to boost the IgG response in all previously vaccinated calves, and boost complement-independent HRSV neutralization titers of calves previously vaccinated with RNA.
  • Table V-2 RSV serum neutralization titers of cows, 5 animals per group, after intramuscular vaccinations with the indicated vaccines on days 0, 21, 86. All cows were vaccinated with 15 ⁇ g of F trimer subunit + MF59 on day 146. Serum was collected for analysis prior to vaccination (pre- immune) and on days 35, 56, 100, 107, 114, 146, 160, 167, and 174. Data are represented as 60% RSV neutralization titers of individual cows and the geometric mean titers of 5 individual cows per group. If an individual animal had a titer of ⁇ 20 (limit of detection) it was assigned a titer of 10. * Cow #18 was vaccinated with vA317/CNE17 vaccine at D86 (instead of Triangle 4), and therefore its titers are not included in the GMT from da 100 onwards.
  • VRPs expressing the gH/gL complex VRPs expressing green fluorescent protein (VRP-G), purified gH/gL subunit with or without MF59, different sequences of VRP or VRP-G followed by subunit in PBS or MF59, VRPs expressing the gH/gL complex mixed with purified gH/gL subunit, or VRP-G mixed with purified gH/gL subunit (see Table VI-1).
  • a group of control mice did not receive any vaccine, and additional control groups included GFP VRPs to determine whether any effects from VRP prime were specific to the encoded antigen.
  • spleens were extracted from sacrificed mice. Spleen cells were stimulated in vitro with purified gH/gL protein or a pool of 15-mer peptides (overlapping by 1 1 amino acids) corresponding approximately to the c- terminal half of the gH protein, stained for CD4, CD8, and cytokine expression, and analyzed using flow cytometry.
  • Vaccination with the gH/gL VRPs elicited strongly neutralizing antibody responses (Figure 1).
  • Purified gH/gL subunit elicited modest responses without adjuvant.
  • MF59 potently neutralizing antibody responses that were at least as strong as those elicited by gH/gL VRPs were elicted.
  • Different VRP prime, subunit/MF59 boost regimens did not increase the neutralizing titer compared to subunit.
  • Substituting the gH/gL VRP for a GFP-expressing GFP in the prime-boost regimens had the expected result of decreasing the magnitude of the neutralizing response.
  • VRP prime followed by unadjuvanted protein boost did not increase neutralizing titers compared to subunit/MF59 alone.
  • the titers for any given prime boost regimen were comparable when the subunit boost was delivered with or without MF59.
  • mice were immunized three times, three weeks apart with a SAM vaccine, which is a self replicating RNA as described herein, encoding the CMV pentameric complex (gH/gL/UL128/UL130/UL131), purified pentameric subunit adjuvanted with MF59, different sequences of SAM followed by subunit in MF59, or a combination of the two (Table VII- 1).
  • SAM vaccine was encapsulated in synthetic LNPs for non-viral delivery. A group of control mice did not receive any vaccine.
  • ELISA to determine binding antibody titers, using the same purified antigen in the assay as in the subunit vaccine.
  • the sera were also used for HCMV microneutralization assay using TB40 or VR1814 infection of ARPE-19 epithelial cells.
  • spleens were extracted from sacrificed mice. Spleen cells were stimulated in vitro with purified protein or a pool of 15-mer peptides (overlapping by 1 1 amino acids) corresponding to the c-terminal half of the gH protein, stained for cytokine expression, and analyzed using flow cytometry.
  • CD4+ T cell responses to the vaccinations using purified gH/gL and pentameric subunits were analyzed.
  • SAM vaccine prime protein boost and mixed SAM vaccine + subunit elicited more CD4+ T cells responding to gH/gL re-stimulation than SAM vaccine or subunit/MF59 alone (Figure 5).
  • CD4+ responses to RNA alone were insignificant, whereas responses to subunit/MF59 alone were Th2/Th0 phenotype.
  • the phenotype of the responding cells from mice immunized combinations of SAM vaccine and subunit was primarily Thl/ThO. Similar trends were seen when re-stimulating cells with purified pentameric complex, although the responses were generally stronger (Figure 6).
  • CD8+ T cell responses to the vaccinations using purified pentameric subunit or a pool of peptides to gH were also analyzed.
  • Cells from these animals also showed the strongest responses when re-stimulated with gH peptides ( Figure 8).
  • RSV-F RNA prime (as a dose range), and a subunit boost ( 3 ⁇ g, different formulations) were administered to mice to evaluate the ability of subunit, with different formulations as indicated in Table VIII- 1, to boost RNA-induced response.
  • Each mouse received a constant 3 ⁇ g subunit dose, with variable RNA doses and different subunit adjuvants.
  • Mice were vaccinated on days 0, 21 and 42 intramuscularly with a 100 ⁇ dose, split between the two hind legs. Serum was sampled on day 20 for F-specific IgG, and on days 35 and 56 for IgG, IgGl, IgG2a and neutralizing antibody. Spleens were harvested on day 56.
  • Table VIII- 1
  • RNA prime, subunit boost is an effective regimen for inducing high titer of RSV neutralizing antibodies (Figure 9).
  • the boost works with alum-adjuvanted, MF59-adjuvanted, or even unadjuvanted F subunit boost ( Figure 1 1).
  • RNA vaccine set a Thl -biased response (IgG2a, Thl cytokines) that was maintained after the subunit boost, irrespective of the boost adjuvant, and even when the subunit with or without adjuvant vaccine induced more of a Th2 -biased response on its own (without an RNA prime). Very low doses of the RNA vaccine, even those without a detectable immune response, were sufficient to set the Thl -biased response that was maintained after the subunit boost. ( Figure 10) [00444]
  • the specification is most thoroughly understood in light of the teachings of the references cited within the specification. The embodiments within the specification provide an illustration of embodiments of the invention and should not be construed to limit the scope of the invention.
  • CMV gB sol 750 (SEQ ID NO:3) :
  • CMV gM FL (SEQ ID NO: 14) : MAPSHVDKVNTRTWSASIVFMVLTFVNVSVHLVLSNFPHLGYPCVYYHVVDFERLNMSAYNV MHLHTPMLFLDSVQLVCYAVFMQLVFLAVTIYYLVCWIKISMRKDKGMSLNQSTRDISYMGD SLTAFLFILSMDTFQLFTLTMSFRLPSMIAFMAAVHFFCLTIFNVSMVTQYRSYKRSLFFFS RLHPKLKGTVQFRTLIVNLVEVALGFNTTVVAMALCYGFGNNFFVRTGHMVLAVFVVYAIIS IIYFLLIEAVFFQYVKVQFGYHLGAFFGLCGLIYPIVQYDTFLSNEYRTGISWSFGMLFFIW AMFTTCRAVRYFRGRGSGSVKYQALATASGEEVAALSHHDSLESRRLREEEDDDDEDFEDA-

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Virology (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Mycology (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Communicable Diseases (AREA)
  • Molecular Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Organic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pulmonology (AREA)
  • Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2012/045854 2011-07-06 2012-07-06 Immunogenic compositions and uses thereof Ceased WO2013006842A2 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
EP18209088.6A EP3508219A1 (en) 2011-07-06 2012-07-06 Self-replicating rna prime - protein boost vaccines
JP2014519091A JP2014520807A (ja) 2011-07-06 2012-07-06 免疫原性組成物およびその使用
CA2841047A CA2841047A1 (en) 2011-07-06 2012-07-06 Immunogenic compositions and uses thereof
EP12735421.5A EP2729168A2 (en) 2011-07-06 2012-07-06 Immunogenic compositions and uses thereof
US14/130,869 US11058762B2 (en) 2011-07-06 2012-07-06 Immunogenic compositions and uses thereof
US17/330,826 US20210290755A1 (en) 2011-07-06 2021-05-26 Immunogenic compositions and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161505105P 2011-07-06 2011-07-06
US61/505,105 2011-07-06

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/130,869 A-371-Of-International US11058762B2 (en) 2011-07-06 2012-07-06 Immunogenic compositions and uses thereof
US17/330,826 Continuation US20210290755A1 (en) 2011-07-06 2021-05-26 Immunogenic compositions and uses thereof

Publications (2)

Publication Number Publication Date
WO2013006842A2 true WO2013006842A2 (en) 2013-01-10
WO2013006842A3 WO2013006842A3 (en) 2014-06-19

Family

ID=46513884

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/045854 Ceased WO2013006842A2 (en) 2011-07-06 2012-07-06 Immunogenic compositions and uses thereof

Country Status (5)

Country Link
US (2) US11058762B2 (enExample)
EP (2) EP3508219A1 (enExample)
JP (2) JP2014520807A (enExample)
CA (1) CA2841047A1 (enExample)
WO (1) WO2013006842A2 (enExample)

Cited By (76)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014005958A1 (en) * 2012-07-06 2014-01-09 Novartis Ag Immunogenic compositions and uses thereof
WO2014005959A1 (en) * 2012-07-06 2014-01-09 Novartis Ag Complexes of cytomegalovirus proteins
US8664194B2 (en) 2011-12-16 2014-03-04 Moderna Therapeutics, Inc. Method for producing a protein of interest in a primate
US8710200B2 (en) 2011-03-31 2014-04-29 Moderna Therapeutics, Inc. Engineered nucleic acids encoding a modified erythropoietin and their expression
WO2014108515A1 (en) 2013-01-10 2014-07-17 Novartis Ag Influenza virus immunogenic compositions and uses thereof
US8822663B2 (en) 2010-08-06 2014-09-02 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US8980864B2 (en) 2013-03-15 2015-03-17 Moderna Therapeutics, Inc. Compositions and methods of altering cholesterol levels
US8999380B2 (en) 2012-04-02 2015-04-07 Moderna Therapeutics, Inc. Modified polynucleotides for the production of biologics and proteins associated with human disease
US9107886B2 (en) 2012-04-02 2015-08-18 Moderna Therapeutics, Inc. Modified polynucleotides encoding basic helix-loop-helix family member E41
US20150322115A1 (en) * 2014-05-08 2015-11-12 Redvax Gmbh Means and methods for treating cmv
WO2015189425A1 (en) * 2014-06-13 2015-12-17 Glaxosmithkline Biologicals Sa Immunogenic combinations
US9283287B2 (en) 2012-04-02 2016-03-15 Moderna Therapeutics, Inc. Modified polynucleotides for the production of nuclear proteins
US9334328B2 (en) 2010-10-01 2016-05-10 Moderna Therapeutics, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US9428535B2 (en) 2011-10-03 2016-08-30 Moderna Therapeutics, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US9464124B2 (en) 2011-09-12 2016-10-11 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
WO2016184822A1 (en) 2015-05-15 2016-11-24 Curevac Ag Prime-boost regimens involving administration of at least one mrna construct
US9572897B2 (en) 2012-04-02 2017-02-21 Modernatx, Inc. Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins
US9597380B2 (en) 2012-11-26 2017-03-21 Modernatx, Inc. Terminally modified RNA
EP3307314A1 (en) * 2015-06-12 2018-04-18 GlaxoSmithKline Biologicals S.A. Adenovirus polynucleotides and polypeptides
US10064935B2 (en) 2015-10-22 2018-09-04 Modernatx, Inc. Human cytomegalovirus RNA vaccines
WO2018170260A1 (en) * 2017-03-15 2018-09-20 Modernatx, Inc. Respiratory syncytial virus vaccine
WO2019023566A1 (en) * 2017-07-28 2019-01-31 Janssen Vaccines & Prevention B.V. METHODS AND COMPOSITIONS FOR PROVIDING IMMUNIZATION AGAINST Heterologous ARNREP
US10195156B2 (en) 2015-12-22 2019-02-05 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US10207010B2 (en) 2015-12-10 2019-02-19 Modernatx, Inc. Compositions and methods for delivery of agents
US10266485B2 (en) 2015-09-17 2019-04-23 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10323076B2 (en) 2013-10-03 2019-06-18 Modernatx, Inc. Polynucleotides encoding low density lipoprotein receptor
WO2019123169A1 (en) 2017-12-20 2019-06-27 Glaxosmithkline Biologicals Sa Epstein-barr virus antigen constructs
US10426829B2 (en) 2015-09-03 2019-10-01 Novavax, Inc. Vaccine compositions having improved stability and immunogenicity
US10449244B2 (en) 2015-07-21 2019-10-22 Modernatx, Inc. Zika RNA vaccines
US10493143B2 (en) 2015-10-22 2019-12-03 Modernatx, Inc. Sexually transmitted disease vaccines
US10611800B2 (en) 2016-03-11 2020-04-07 Pfizer Inc. Human cytomegalovirus gB polypeptide
US10653767B2 (en) 2017-09-14 2020-05-19 Modernatx, Inc. Zika virus MRNA vaccines
WO2020035609A3 (en) * 2018-08-17 2020-05-28 Glaxosmithkline Biologicals Sa Immunogenic compositions and uses thereof
US10695419B2 (en) 2016-10-21 2020-06-30 Modernatx, Inc. Human cytomegalovirus vaccine
US10815291B2 (en) 2013-09-30 2020-10-27 Modernatx, Inc. Polynucleotides encoding immune modulating polypeptides
US10857105B2 (en) 2017-03-15 2020-12-08 MordernaTX, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10925958B2 (en) 2016-11-11 2021-02-23 Modernatx, Inc. Influenza vaccine
US11045540B2 (en) 2017-03-15 2021-06-29 Modernatx, Inc. Varicella zoster virus (VZV) vaccine
US11052146B2 (en) 2008-12-09 2021-07-06 Novavax, Inc. Modified RSV F proteins and methods of their use
US11066355B2 (en) 2019-09-19 2021-07-20 Modernatx, Inc. Branched tail lipid compounds and compositions for intracellular delivery of therapeutic agents
US11103578B2 (en) 2016-12-08 2021-08-31 Modernatx, Inc. Respiratory virus nucleic acid vaccines
WO2021202772A1 (en) * 2020-04-01 2021-10-07 University Of Florida Research Foundation, Incorporated Multilamellar rna nanoparticle vaccine against sars-cov-2
US11203569B2 (en) 2017-03-15 2021-12-21 Modernatx, Inc. Crystal forms of amino lipids
US11235052B2 (en) 2015-10-22 2022-02-01 Modernatx, Inc. Chikungunya virus RNA vaccines
US11278612B2 (en) 2018-03-19 2022-03-22 Novavax, Inc. Multivalent influenza nanoparticle vaccines
US11351242B1 (en) 2019-02-12 2022-06-07 Modernatx, Inc. HMPV/hPIV3 mRNA vaccine composition
US11364292B2 (en) 2015-07-21 2022-06-21 Modernatx, Inc. CHIKV RNA vaccines
WO2022137128A3 (en) * 2020-12-23 2022-08-04 Glaxosmithkline Biologicals Sa Self-amplifying messenger rna
US11406703B2 (en) 2020-08-25 2022-08-09 Modernatx, Inc. Human cytomegalovirus vaccine
US11446374B2 (en) 2008-12-09 2022-09-20 Novavax, Inc. Modified RSV F proteins and methods of their use
US11524023B2 (en) 2021-02-19 2022-12-13 Modernatx, Inc. Lipid nanoparticle compositions and methods of formulating the same
US11547764B2 (en) 2011-06-08 2023-01-10 Translate Bio, Inc. Lipid nanoparticle compositions and methods for MRNA delivery
US11576961B2 (en) 2017-03-15 2023-02-14 Modernatx, Inc. Broad spectrum influenza virus vaccine
US11583504B2 (en) 2016-11-08 2023-02-21 Modernatx, Inc. Stabilized formulations of lipid nanoparticles
EP4159741A1 (en) 2014-07-16 2023-04-05 ModernaTX, Inc. Method for producing a chimeric polynucleotide encoding a polypeptide having a triazole-containing internucleotide linkage
US11629172B2 (en) 2018-12-21 2023-04-18 Pfizer Inc. Human cytomegalovirus gB polypeptide
US11643441B1 (en) 2015-10-22 2023-05-09 Modernatx, Inc. Nucleic acid vaccines for varicella zoster virus (VZV)
US11744801B2 (en) 2017-08-31 2023-09-05 Modernatx, Inc. Methods of making lipid nanoparticles
US11752206B2 (en) 2017-03-15 2023-09-12 Modernatx, Inc. Herpes simplex virus vaccine
US11786607B2 (en) 2017-06-15 2023-10-17 Modernatx, Inc. RNA formulations
US11793843B2 (en) 2019-01-10 2023-10-24 Janssen Biotech, Inc. Prostate neoantigens and their uses
US11857622B2 (en) 2020-06-21 2024-01-02 Pfizer Inc. Human cytomegalovirus GB polypeptide
US11911453B2 (en) 2018-01-29 2024-02-27 Modernatx, Inc. RSV RNA vaccines
US11969506B2 (en) 2017-03-15 2024-04-30 Modernatx, Inc. Lipid nanoparticle formulation
US12018289B2 (en) 2019-11-18 2024-06-25 Janssen Biotech, Inc. Vaccines based on mutant CALR and JAK2 and their uses
US12070495B2 (en) 2019-03-15 2024-08-27 Modernatx, Inc. HIV RNA vaccines
US12077501B2 (en) 2017-06-14 2024-09-03 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US12083228B2 (en) 2017-07-24 2024-09-10 Novavax, Inc. Methods and compositions for treating respiratory disease
US12090235B2 (en) 2018-09-20 2024-09-17 Modernatx, Inc. Preparation of lipid nanoparticles and methods of administration thereof
US12128113B2 (en) 2016-05-18 2024-10-29 Modernatx, Inc. Polynucleotides encoding JAGGED1 for the treatment of Alagille syndrome
US12151029B2 (en) 2018-09-19 2024-11-26 Modernatx, Inc. PEG lipids and uses thereof
US12214027B2 (en) 2019-03-29 2025-02-04 Intervet Inc. Stabilisation of live mollicutes bacteria in a liquid composition
US12263248B2 (en) 2018-09-19 2025-04-01 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12295997B2 (en) 2020-07-06 2025-05-13 Janssen Biotech, Inc. Prostate neoantigens and their uses
US12383508B2 (en) 2018-09-19 2025-08-12 Modernatx, Inc. High-purity peg lipids and uses thereof
US12582683B2 (en) 2023-06-27 2026-03-24 Janssen Biotech, Inc. Prostate neoantigens and their uses

Families Citing this family (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP5940064B2 (ja) 2010-07-06 2016-06-29 ノバルティス アーゲー 低用量のrnaを用いた大型哺乳動物の免疫化
RS54489B1 (sr) 2010-07-06 2016-06-30 Glaxosmithkline Biologicals Sa Lipozomi sa lipidima koji imaju poboljšanu pka vrednost za oslobađanje rnk
HUE047796T2 (hu) 2010-07-06 2020-05-28 Glaxosmithkline Biologicals Sa RNS bevitele több immunútvonal bekapcsolására
SMT202200311T1 (it) 2010-08-31 2022-09-14 Glaxosmithkline Biologicals Sa Liposomi pegilati per somministrare rna codificante un immunogene
EP3520813B1 (en) 2010-10-11 2023-04-19 GlaxoSmithKline Biologicals S.A. Antigen delivery platforms
EP3854413A1 (en) * 2011-07-06 2021-07-28 GlaxoSmithKline Biologicals SA Immunogenic combination compositions and uses thereof
AU2012322704B2 (en) * 2011-10-11 2017-09-07 Novartis Ag Recombinant self-replicating polycistronic RNA molecules
US9040397B2 (en) * 2011-10-21 2015-05-26 LGS Innovations LLC Method of making graphene layers, and articles made thereby
WO2014028429A2 (en) 2012-08-14 2014-02-20 Moderna Therapeutics, Inc. Enzymes and polymerases for the synthesis of rna
WO2014159813A1 (en) 2013-03-13 2014-10-02 Moderna Therapeutics, Inc. Long-lived polynucleotide molecules
US10258698B2 (en) 2013-03-14 2019-04-16 Modernatx, Inc. Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions
RU2021109685A (ru) 2014-04-23 2021-04-13 МОДЕРНАТиЭкс, ИНК. Вакцины на основе нуклеиновых кислот
AU2016336344A1 (en) 2015-10-05 2018-04-19 Modernatx, Inc. Methods for therapeutic administration of messenger ribonucleic acid drugs
WO2017123652A1 (en) 2016-01-11 2017-07-20 Verndari, Inc. Microneedle compositions and methods of using same
US12491261B2 (en) 2016-10-26 2025-12-09 Acuitas Therapeutics, Inc. Lipid nanoparticle formulations
EP3600396A4 (en) 2017-03-30 2021-01-13 The Government of the United States of America as represented by the Secretary of the Army NUCLEIC ACID VACCINE COMPOSITION WITH A LIPID FORMULATION AND METHOD FOR INCREASING THE POTENTIAL OF NUCLEIC ACID VACCINE
MX2019013259A (es) 2017-05-08 2020-01-13 Gritstone Oncology Inc Vectores de neoantigeno de alfavirus.
WO2019036008A1 (en) 2017-08-16 2019-02-21 Acuitas Therapeutics, Inc. LIPIDS FOR USE IN LIPID NANOPARTICULAR FORMULATIONS
AU2018331874B2 (en) * 2017-09-13 2022-06-02 Sanofi Pasteur Human cytomegalovirus immunogenic composition
EP4495597A3 (en) 2018-01-04 2025-04-30 Iconic Therapeutics LLC Anti-tissue factor antibodies, antibody-drug conjugates, and related methods
CN113966221A (zh) * 2019-03-08 2022-01-21 麻省理工学院 合成溶瘤lnp复制子rna和用于癌症免疫治疗的用途
JP7457733B2 (ja) 2019-05-30 2024-03-28 グリットストーン バイオ インコーポレイテッド 改変アデノウイルス
CA3143632A1 (en) 2019-06-20 2020-12-24 Janssen Sciences Ireland Unlimited Company Self-replicating rna molecules for hepatitis b virus (hbv) vaccines and uses thereof
JP2023517644A (ja) 2020-03-09 2023-04-26 アークトゥラス・セラピューティクス・インコーポレイテッド コロナウイルスワクチン組成物及び方法
MX2022014167A (es) 2020-05-11 2023-02-14 Janssen Pharmaceuticals Inc Replicón de arn que codifica una proteína de espícula del coronavirus estabilizada.
EP4153223A1 (en) * 2020-05-20 2023-03-29 Flagship Pioneering Innovations VI, LLC Immunogenic compositions and uses thereof
DK4182297T3 (da) 2020-07-16 2025-12-01 Acuitas Therapeutics Inc Kationiske lipider til brug i lipid-nanopartikler
EP4192496A4 (en) 2020-08-06 2025-01-01 Gritstone bio, Inc. MULTIEPITOP VACCINE CASSETTES
CN116171150A (zh) 2020-08-14 2023-05-26 阿克丘勒斯治疗公司 冻干脂质纳米颗粒的方法
WO2022103927A1 (en) * 2020-11-12 2022-05-19 Shape Biopharmaceuticals Inc. Immunogenic compositions for coronaviruses
WO2023114943A2 (en) 2021-12-16 2023-06-22 Acuitas Therapeutics, Inc. Lipids for use in lipid nanoparticle formulations
US12115217B2 (en) 2022-11-18 2024-10-15 Trustees Of Boston University Self-replicating RNA and uses thereof
WO2025244961A1 (en) * 2024-05-22 2025-11-27 Merck Sharp & Dohme Llc Processes for making stable nanoemulsion adjuvants

Citations (88)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4186745A (en) 1976-07-30 1980-02-05 Kauzlarich James J Porous catheters
US4373071A (en) 1981-04-30 1983-02-08 City Of Hope Research Institute Solid-phase synthesis of polynucleotides
EP0109942A2 (en) 1982-10-18 1984-05-30 Bror Morein Immunogenic protein or peptide complex, method of producing said complex and the use thereof as an immune stimulant and as a vaccine
US4458066A (en) 1980-02-29 1984-07-03 University Patents, Inc. Process for preparing polynucleotides
US4500707A (en) 1980-02-29 1985-02-19 University Patents, Inc. Nucleosides useful in the preparation of polynucleotides
US4668777A (en) 1981-03-27 1987-05-26 University Patents, Inc. Phosphoramidite nucleoside compounds
US4689338A (en) 1983-11-18 1987-08-25 Riker Laboratories, Inc. 1H-Imidazo[4,5-c]quinolin-4-amines and antiviral use
EP0329181A2 (en) 1988-02-19 1989-08-23 Sanyo Electric Co., Ltd. Device for driving reel supports
US4929624A (en) 1989-03-23 1990-05-29 Minnesota Mining And Manufacturing Company Olefinic 1H-imidazo(4,5-c)quinolin-4-amines
US4945050A (en) 1984-11-13 1990-07-31 Cornell Research Foundation, Inc. Method for transporting substances into living cells and tissues and apparatus therefor
US4973679A (en) 1981-03-27 1990-11-27 University Patents, Inc. Process for oligonucleo tide synthesis using phosphormidite intermediates
WO1990014837A1 (en) 1989-05-25 1990-12-13 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
US5036006A (en) 1984-11-13 1991-07-30 Cornell Research Foundation, Inc. Method for transporting substances into living cells and tissues and apparatus therefor
US5047524A (en) 1988-12-21 1991-09-10 Applied Biosystems, Inc. Automated system for polynucleotide synthesis and purification
US5057540A (en) 1987-05-29 1991-10-15 Cambridge Biotech Corporation Saponin adjuvant
US5132418A (en) 1980-02-29 1992-07-21 University Patents, Inc. Process for preparing polynucleotides
US5142047A (en) 1985-03-15 1992-08-25 Anti-Gene Development Group Uncharged polynucleotide-binding polymers
US5153319A (en) 1986-03-31 1992-10-06 University Patents, Inc. Process for preparing polynucleotides
US5185444A (en) 1985-03-15 1993-02-09 Anti-Gene Deveopment Group Uncharged morpolino-based polymers having phosphorous containing chiral intersubunit linkages
US5238944A (en) 1988-12-15 1993-08-24 Riker Laboratories, Inc. Topical formulations and transdermal delivery systems containing 1-isobutyl-1H-imidazo[4,5-c]quinolin-4-amine
US5262530A (en) 1988-12-21 1993-11-16 Applied Biosystems, Inc. Automated system for polynucleotide synthesis and purification
US5266575A (en) 1991-11-06 1993-11-30 Minnesota Mining And Manufacturing Company 2-ethyl 1H-imidazo[4,5-ciquinolin-4-amines
US5268376A (en) 1991-09-04 1993-12-07 Minnesota Mining And Manufacturing Company 1-substituted 1H-imidazo[4,5-c]quinolin-4-amines
US5340740A (en) 1992-05-15 1994-08-23 North Carolina State University Method of producing an avian embryonic stem cell culture and the avian embryonic stem cell culture produced by the process
US5352784A (en) 1993-07-15 1994-10-04 Minnesota Mining And Manufacturing Company Fused cycloalkylimidazopyridines
EP0626169A2 (en) 1988-08-25 1994-11-30 The Liposome Company, Inc. A dosage form comprising an antigen and a salt form of an organic acid derivative of a sterol
US5389640A (en) 1991-03-01 1995-02-14 Minnesota Mining And Manufacturing Company 1-substituted, 2-substituted 1H-imidazo[4,5-c]quinolin-4-amines
US5395937A (en) 1993-01-29 1995-03-07 Minnesota Mining And Manufacturing Company Process for preparing quinoline amines
US5397307A (en) 1993-12-07 1995-03-14 Schneider (Usa) Inc. Drug delivery PTCA catheter and method for drug delivery
WO1995017211A1 (en) 1993-12-22 1995-06-29 Biocine S.P.A. Non-toxic mucosal adjuvant
EP0689454A1 (en) 1993-03-23 1996-01-03 Smithkline Beecham Biolog VACCINE COMPOSITIONS CONTAINING 3-O DESACETYL MONOPHOSPHORYLIC LIPID
US5482936A (en) 1995-01-12 1996-01-09 Minnesota Mining And Manufacturing Company Imidazo[4,5-C]quinoline amines
US5494916A (en) 1993-07-15 1996-02-27 Minnesota Mining And Manufacturing Company Imidazo[4,5-C]pyridin-4-amines
WO1996011711A1 (en) 1994-10-12 1996-04-25 Iscotec Ab Saponin preparations and use thereof in iscoms
US5547472A (en) 1994-01-20 1996-08-20 Terumo Kabushiki Kaisha Catheter with medicament injection pores
WO1996033739A1 (en) 1995-04-25 1996-10-31 Smithkline Beecham Biologicals S.A. Vaccines containing a saponin and a sterol
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
WO1997028818A1 (en) 1996-02-12 1997-08-14 Cobra Therapeutics Limited Novel methods of vaccination and vaccines therefore comprising a nucleic acid encoding a first epitope and a peptide containing a second epitope
US5674192A (en) 1990-12-28 1997-10-07 Boston Scientific Corporation Drug delivery
US5700642A (en) 1995-05-22 1997-12-23 Sri International Oligonucleotide sizing using immobilized cleavable primers
WO1998040100A1 (en) 1997-03-10 1998-09-17 Ottawa Civic Loeb Research Institute USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT
WO1998042375A1 (en) 1997-03-21 1998-10-01 Chiron Corporation Detoxified mutants of bacterial adp-ribosylating toxins as parenteral adjuvants
WO1999027960A1 (en) 1997-11-28 1999-06-10 West Pharmaceutical Services Vaccine compositions for mucosal administration comprising chitosan
WO1999030733A1 (en) 1997-12-16 1999-06-24 Smithkline Beecham Biologicals S.A. Method to enhance an immune response of nucleic acid vaccination
US5916588A (en) 1984-04-12 1999-06-29 The Liposome Company, Inc. Peptide-containing liposomes, immunogenic liposomes and methods of preparation and use
WO1999052549A1 (en) 1998-04-09 1999-10-21 Smithkline Beecham Biologicals S.A. Adjuvant compositions
WO1999062923A2 (en) 1998-06-05 1999-12-09 Dynavax Technologies Corporation Immunostimulatory oligonucleotides with modified bases and methods of use thereof
WO2000007621A2 (en) 1998-08-05 2000-02-17 Smithkline Beecham Biologicals S.A. Vaccine comprising an iscom consisting of sterol and saponin which is free of additional detergent
US6048524A (en) 1991-11-05 2000-04-11 Transkaryotic Therapies, Inc. In vivo production and delivery of erythropoietin for gene therapy
US6048729A (en) 1987-05-01 2000-04-11 Transkaryotic Therapies, Inc. In vivo protein production and delivery system for gene therapy
US6054288A (en) 1991-11-05 2000-04-25 Transkaryotic Therapies, Inc. In vivo protein production and delivery system for gene therapy
WO2000023105A2 (en) 1998-10-16 2000-04-27 Smithkline Beecham Biologicals S.A. Adjuvant systems and vaccines
US6071890A (en) 1994-12-09 2000-06-06 Genzyme Corporation Organ-specific targeting of cationic amphiphile/DNA complexes for gene therapy
US6083741A (en) 1994-11-17 2000-07-04 Imperial College Of Science Technology And Medicine Internalisation of DNA, using conjugates of poly-l-lysine and an integrin receptor ligand
US6090619A (en) 1997-09-08 2000-07-18 University Of Florida Materials and methods for intracellular delivery of biologically active molecules
US6090406A (en) 1984-04-12 2000-07-18 The Liposome Company, Inc. Potentiation of immune responses with liposomal adjuvants
US6114168A (en) 1994-10-21 2000-09-05 Institute National De La Recherche Agronomique Active retinoic acid-free culture medium for chicken embryonic stem cells
US6129705A (en) 1997-10-01 2000-10-10 Medtronic Ave, Inc. Drug delivery and gene therapy delivery system
US6207646B1 (en) 1994-07-15 2001-03-27 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
WO2001021207A2 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Use of combination of polyoxyethylene sorbitan ester and octoxynol as adjuvant and its use in vaccines
WO2001021152A1 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Adjuvant comprising a polyxyethylene alkyl ether or ester and at least one nonionic surfactant
US6239116B1 (en) 1994-07-15 2001-05-29 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
WO2001095935A1 (en) 2000-01-20 2001-12-20 Ottawa Health Research Institute Immunostimulatory nucleic acids for inducing a th2 immune response
WO2002026757A2 (en) 2000-09-26 2002-04-04 Hybridon, Inc. Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes
US6429199B1 (en) 1994-07-15 2002-08-06 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules for activating dendritic cells
WO2003024481A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag Packaging of immunostimulatory substances into virus-like particles: method of preparation and use
WO2003024480A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag In vivo activation of antigen presenting cells for enhancement of immune responses induced by virus like particles
WO2003035836A2 (en) 2001-10-24 2003-05-01 Hybridon Inc. Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5' ends
WO2003043415A1 (fr) 2001-11-22 2003-05-30 Vivalis Systeme d'expression de proteines exogenes dans un systeme aviaire
WO2003076601A1 (fr) 2002-03-08 2003-09-18 Vivalis Lignées de cellules aviaires utiles pour la production de substances d'intérêt
WO2004060308A2 (en) 2002-12-27 2004-07-22 Chiron Corporation Thiosemicarbazones as anti-virals and immunopotentiators
WO2004064759A2 (en) 2003-01-21 2004-08-05 Chiron Corporation Use of tryptanthrin compounds for immune potentiation
WO2005042728A2 (en) 2003-11-03 2005-05-12 Probiogen Ag Immortalized avian cell lines for virus production
WO2006061643A1 (en) 2004-12-09 2006-06-15 Oxxon Therapeutics Limited Method for vaccinating usign a prime-boost regime and hsv as a vector
US20080057080A1 (en) 2004-05-18 2008-03-06 Vical Incorporated Influenza virus vaccine composition and methods of use
US20080085870A1 (en) 2002-12-23 2008-04-10 Vical Incorporated Codon-optimized polynucleotide-based vaccines against human cytomegalovirus infection
WO2009074861A2 (en) 2007-12-10 2009-06-18 Powderject Research Limited Improved vaccine
WO2009079796A1 (en) 2007-12-24 2009-07-02 Id Biomedical Corporation Of Quebec Recombinant rsv antigens
WO2009111337A1 (en) 2008-03-03 2009-09-11 Irm Llc Compounds and compositions as tlr activity modulators
US7604803B2 (en) 2002-07-05 2009-10-20 Lipoxen Technologies Limited Method to enhance an immune response of nucleic acid vaccination
WO2009132206A1 (en) 2008-04-25 2009-10-29 Liquidia Technologies, Inc. Compositions and methods for intracellular delivery and release of cargo
WO2009156852A1 (en) 2008-06-25 2009-12-30 Novartis Ag Rapid responses to delayed booster immunisations
WO2010036948A2 (en) 2008-09-26 2010-04-01 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Dna prime/inactivated vaccine boost immunization to influenza virus
US7862829B2 (en) 2004-07-09 2011-01-04 University Of North Carolina At Chapel Hill Viral adjuvants
WO2011005799A2 (en) 2009-07-06 2011-01-13 Novartis Ag Self replicating rna molecules and uses thereof
WO2011008974A2 (en) 2009-07-15 2011-01-20 Novartis Ag Rsv f protein compositions and methods for making same
WO2011057020A1 (en) 2009-11-04 2011-05-12 Marina Biotech, Inc. Activity generating delivery molecules
WO2011076807A2 (en) 2009-12-23 2011-06-30 Novartis Ag Lipids, lipid compositions, and methods of using them

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002009645A2 (en) 2000-08-01 2002-02-07 The Johns Hopkins University Intercellular transport protein linked to an antigen as a molecular vaccine
PT1651666E (pt) * 2003-07-11 2009-08-28 Alphavax Inc Vacinas de citomegalovírus à base de alfavírus
CA2704153A1 (en) 2007-09-26 2009-04-02 Vanderbilt University Vaccine for rsv and mpv
EP2556151A1 (en) 2010-04-07 2013-02-13 Novartis AG Method for generating a parvovirus b19 virus-like particle
JP5940064B2 (ja) 2010-07-06 2016-06-29 ノバルティス アーゲー 低用量のrnaを用いた大型哺乳動物の免疫化
HRP20221048T1 (hr) 2010-08-31 2022-11-11 Glaxosmithkline Biologicals Sa Mali liposomi za isporuku rna koja kodira imunogen
US11730804B1 (en) * 2022-04-13 2023-08-22 Replicate Bioscience, Inc. Compositions and methods for the prevention and treatment of rabies virus infection

Patent Citations (96)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4186745A (en) 1976-07-30 1980-02-05 Kauzlarich James J Porous catheters
US4458066A (en) 1980-02-29 1984-07-03 University Patents, Inc. Process for preparing polynucleotides
US4500707A (en) 1980-02-29 1985-02-19 University Patents, Inc. Nucleosides useful in the preparation of polynucleotides
US5132418A (en) 1980-02-29 1992-07-21 University Patents, Inc. Process for preparing polynucleotides
US4973679A (en) 1981-03-27 1990-11-27 University Patents, Inc. Process for oligonucleo tide synthesis using phosphormidite intermediates
US4668777A (en) 1981-03-27 1987-05-26 University Patents, Inc. Phosphoramidite nucleoside compounds
US4373071A (en) 1981-04-30 1983-02-08 City Of Hope Research Institute Solid-phase synthesis of polynucleotides
EP0109942A2 (en) 1982-10-18 1984-05-30 Bror Morein Immunogenic protein or peptide complex, method of producing said complex and the use thereof as an immune stimulant and as a vaccine
US4689338A (en) 1983-11-18 1987-08-25 Riker Laboratories, Inc. 1H-Imidazo[4,5-c]quinolin-4-amines and antiviral use
US5916588A (en) 1984-04-12 1999-06-29 The Liposome Company, Inc. Peptide-containing liposomes, immunogenic liposomes and methods of preparation and use
US6090406A (en) 1984-04-12 2000-07-18 The Liposome Company, Inc. Potentiation of immune responses with liposomal adjuvants
US4945050A (en) 1984-11-13 1990-07-31 Cornell Research Foundation, Inc. Method for transporting substances into living cells and tissues and apparatus therefor
US5036006A (en) 1984-11-13 1991-07-30 Cornell Research Foundation, Inc. Method for transporting substances into living cells and tissues and apparatus therefor
US5185444A (en) 1985-03-15 1993-02-09 Anti-Gene Deveopment Group Uncharged morpolino-based polymers having phosphorous containing chiral intersubunit linkages
US5142047A (en) 1985-03-15 1992-08-25 Anti-Gene Development Group Uncharged polynucleotide-binding polymers
US5153319A (en) 1986-03-31 1992-10-06 University Patents, Inc. Process for preparing polynucleotides
US6048729A (en) 1987-05-01 2000-04-11 Transkaryotic Therapies, Inc. In vivo protein production and delivery system for gene therapy
US5057540A (en) 1987-05-29 1991-10-15 Cambridge Biotech Corporation Saponin adjuvant
EP0329181A2 (en) 1988-02-19 1989-08-23 Sanyo Electric Co., Ltd. Device for driving reel supports
EP0626169A2 (en) 1988-08-25 1994-11-30 The Liposome Company, Inc. A dosage form comprising an antigen and a salt form of an organic acid derivative of a sterol
US5238944A (en) 1988-12-15 1993-08-24 Riker Laboratories, Inc. Topical formulations and transdermal delivery systems containing 1-isobutyl-1H-imidazo[4,5-c]quinolin-4-amine
US5047524A (en) 1988-12-21 1991-09-10 Applied Biosystems, Inc. Automated system for polynucleotide synthesis and purification
US5262530A (en) 1988-12-21 1993-11-16 Applied Biosystems, Inc. Automated system for polynucleotide synthesis and purification
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US4929624A (en) 1989-03-23 1990-05-29 Minnesota Mining And Manufacturing Company Olefinic 1H-imidazo(4,5-c)quinolin-4-amines
WO1990014837A1 (en) 1989-05-25 1990-12-13 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
US6299884B1 (en) 1989-05-25 2001-10-09 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
US6451325B1 (en) 1989-05-25 2002-09-17 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
US5674192A (en) 1990-12-28 1997-10-07 Boston Scientific Corporation Drug delivery
US5389640A (en) 1991-03-01 1995-02-14 Minnesota Mining And Manufacturing Company 1-substituted, 2-substituted 1H-imidazo[4,5-c]quinolin-4-amines
US5525612A (en) 1991-09-04 1996-06-11 Minnesota Mining And Manufacturing Company 1-substituted 1H-imidazo-[4,5-c]quinolin-4-amines
US5346905A (en) 1991-09-04 1994-09-13 Minnesota Mining And Manufacturing Company 1-substituted 1H-imidazo-[4,5-C]quinolin-4-amines
US5268376A (en) 1991-09-04 1993-12-07 Minnesota Mining And Manufacturing Company 1-substituted 1H-imidazo[4,5-c]quinolin-4-amines
US6054288A (en) 1991-11-05 2000-04-25 Transkaryotic Therapies, Inc. In vivo protein production and delivery system for gene therapy
US6048524A (en) 1991-11-05 2000-04-11 Transkaryotic Therapies, Inc. In vivo production and delivery of erythropoietin for gene therapy
US5266575A (en) 1991-11-06 1993-11-30 Minnesota Mining And Manufacturing Company 2-ethyl 1H-imidazo[4,5-ciquinolin-4-amines
US5656479A (en) 1992-05-15 1997-08-12 North Carolina State University Avian embryonic stem cells
US5340740A (en) 1992-05-15 1994-08-23 North Carolina State University Method of producing an avian embryonic stem cell culture and the avian embryonic stem cell culture produced by the process
US5830510A (en) 1992-05-15 1998-11-03 North Carolina State University Veterinary pharmaceutical formulation containing avian embryonic stem cells
US5395937A (en) 1993-01-29 1995-03-07 Minnesota Mining And Manufacturing Company Process for preparing quinoline amines
EP0689454A1 (en) 1993-03-23 1996-01-03 Smithkline Beecham Biolog VACCINE COMPOSITIONS CONTAINING 3-O DESACETYL MONOPHOSPHORYLIC LIPID
US5352784A (en) 1993-07-15 1994-10-04 Minnesota Mining And Manufacturing Company Fused cycloalkylimidazopyridines
US5494916A (en) 1993-07-15 1996-02-27 Minnesota Mining And Manufacturing Company Imidazo[4,5-C]pyridin-4-amines
US5397307A (en) 1993-12-07 1995-03-14 Schneider (Usa) Inc. Drug delivery PTCA catheter and method for drug delivery
WO1995017211A1 (en) 1993-12-22 1995-06-29 Biocine S.P.A. Non-toxic mucosal adjuvant
US5547472A (en) 1994-01-20 1996-08-20 Terumo Kabushiki Kaisha Catheter with medicament injection pores
US6429199B1 (en) 1994-07-15 2002-08-06 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules for activating dendritic cells
US6207646B1 (en) 1994-07-15 2001-03-27 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
US6239116B1 (en) 1994-07-15 2001-05-29 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
WO1996011711A1 (en) 1994-10-12 1996-04-25 Iscotec Ab Saponin preparations and use thereof in iscoms
US6500668B2 (en) 1994-10-21 2002-12-31 Jacques Samarut Culture medium for avian embryonic cells
EP0787180B1 (fr) 1994-10-21 2002-09-04 Institut National De La Recherche Agronomique (Inra) Milieu de culture de cellules embryonnaires totipotentes aviaires, depourvu d'acide retinoique actif
US6114168A (en) 1994-10-21 2000-09-05 Institute National De La Recherche Agronomique Active retinoic acid-free culture medium for chicken embryonic stem cells
US6083741A (en) 1994-11-17 2000-07-04 Imperial College Of Science Technology And Medicine Internalisation of DNA, using conjugates of poly-l-lysine and an integrin receptor ligand
US6071890A (en) 1994-12-09 2000-06-06 Genzyme Corporation Organ-specific targeting of cationic amphiphile/DNA complexes for gene therapy
US5482936A (en) 1995-01-12 1996-01-09 Minnesota Mining And Manufacturing Company Imidazo[4,5-C]quinoline amines
WO1996033739A1 (en) 1995-04-25 1996-10-31 Smithkline Beecham Biologicals S.A. Vaccines containing a saponin and a sterol
US5700642A (en) 1995-05-22 1997-12-23 Sri International Oligonucleotide sizing using immobilized cleavable primers
WO1997028818A1 (en) 1996-02-12 1997-08-14 Cobra Therapeutics Limited Novel methods of vaccination and vaccines therefore comprising a nucleic acid encoding a first epitope and a peptide containing a second epitope
WO1998040100A1 (en) 1997-03-10 1998-09-17 Ottawa Civic Loeb Research Institute USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT
WO1998042375A1 (en) 1997-03-21 1998-10-01 Chiron Corporation Detoxified mutants of bacterial adp-ribosylating toxins as parenteral adjuvants
US6090619A (en) 1997-09-08 2000-07-18 University Of Florida Materials and methods for intracellular delivery of biologically active molecules
US6129705A (en) 1997-10-01 2000-10-10 Medtronic Ave, Inc. Drug delivery and gene therapy delivery system
WO1999027960A1 (en) 1997-11-28 1999-06-10 West Pharmaceutical Services Vaccine compositions for mucosal administration comprising chitosan
WO1999030733A1 (en) 1997-12-16 1999-06-24 Smithkline Beecham Biologicals S.A. Method to enhance an immune response of nucleic acid vaccination
WO1999052549A1 (en) 1998-04-09 1999-10-21 Smithkline Beecham Biologicals S.A. Adjuvant compositions
WO1999062923A2 (en) 1998-06-05 1999-12-09 Dynavax Technologies Corporation Immunostimulatory oligonucleotides with modified bases and methods of use thereof
WO2000007621A2 (en) 1998-08-05 2000-02-17 Smithkline Beecham Biologicals S.A. Vaccine comprising an iscom consisting of sterol and saponin which is free of additional detergent
WO2000023105A2 (en) 1998-10-16 2000-04-27 Smithkline Beecham Biologicals S.A. Adjuvant systems and vaccines
WO2001021152A1 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Adjuvant comprising a polyxyethylene alkyl ether or ester and at least one nonionic surfactant
WO2001021207A2 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Use of combination of polyoxyethylene sorbitan ester and octoxynol as adjuvant and its use in vaccines
WO2001095935A1 (en) 2000-01-20 2001-12-20 Ottawa Health Research Institute Immunostimulatory nucleic acids for inducing a th2 immune response
WO2002026757A2 (en) 2000-09-26 2002-04-04 Hybridon, Inc. Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes
WO2003024481A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag Packaging of immunostimulatory substances into virus-like particles: method of preparation and use
WO2003024480A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag In vivo activation of antigen presenting cells for enhancement of immune responses induced by virus like particles
WO2003035836A2 (en) 2001-10-24 2003-05-01 Hybridon Inc. Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5' ends
WO2003043415A1 (fr) 2001-11-22 2003-05-30 Vivalis Systeme d'expression de proteines exogenes dans un systeme aviaire
WO2003076601A1 (fr) 2002-03-08 2003-09-18 Vivalis Lignées de cellules aviaires utiles pour la production de substances d'intérêt
US7604803B2 (en) 2002-07-05 2009-10-20 Lipoxen Technologies Limited Method to enhance an immune response of nucleic acid vaccination
US20080085870A1 (en) 2002-12-23 2008-04-10 Vical Incorporated Codon-optimized polynucleotide-based vaccines against human cytomegalovirus infection
WO2004060308A2 (en) 2002-12-27 2004-07-22 Chiron Corporation Thiosemicarbazones as anti-virals and immunopotentiators
WO2004064759A2 (en) 2003-01-21 2004-08-05 Chiron Corporation Use of tryptanthrin compounds for immune potentiation
WO2005042728A2 (en) 2003-11-03 2005-05-12 Probiogen Ag Immortalized avian cell lines for virus production
US20080057080A1 (en) 2004-05-18 2008-03-06 Vical Incorporated Influenza virus vaccine composition and methods of use
US7862829B2 (en) 2004-07-09 2011-01-04 University Of North Carolina At Chapel Hill Viral adjuvants
WO2006061643A1 (en) 2004-12-09 2006-06-15 Oxxon Therapeutics Limited Method for vaccinating usign a prime-boost regime and hsv as a vector
WO2009074861A2 (en) 2007-12-10 2009-06-18 Powderject Research Limited Improved vaccine
WO2009079796A1 (en) 2007-12-24 2009-07-02 Id Biomedical Corporation Of Quebec Recombinant rsv antigens
WO2009111337A1 (en) 2008-03-03 2009-09-11 Irm Llc Compounds and compositions as tlr activity modulators
WO2009132206A1 (en) 2008-04-25 2009-10-29 Liquidia Technologies, Inc. Compositions and methods for intracellular delivery and release of cargo
WO2009156852A1 (en) 2008-06-25 2009-12-30 Novartis Ag Rapid responses to delayed booster immunisations
WO2010036948A2 (en) 2008-09-26 2010-04-01 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Dna prime/inactivated vaccine boost immunization to influenza virus
WO2011005799A2 (en) 2009-07-06 2011-01-13 Novartis Ag Self replicating rna molecules and uses thereof
WO2011008974A2 (en) 2009-07-15 2011-01-20 Novartis Ag Rsv f protein compositions and methods for making same
WO2011057020A1 (en) 2009-11-04 2011-05-12 Marina Biotech, Inc. Activity generating delivery molecules
WO2011076807A2 (en) 2009-12-23 2011-06-30 Novartis Ag Lipids, lipid compositions, and methods of using them

Non-Patent Citations (91)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", vol. 2, 1988, GREENE PUBLISH. ASSOC. & WILEY INTERSCIENCE
"Functional Polymer Colloids and Microparticles", vol. 4, 2002
"Functional Polymer Colloids and Microparticles", vol. 4, 2002, CITUS BOOKS
"Liposome Technology", vol. I, II &, 2006, INFORMA HEALTHCARE
"Liposomes: Methods and Protocols, Volume 1: Pharmaceutical Nanocarriers: Methods and Protocols", vol. 1, 2009, HUMANA PRESS
"Microparticulate Systems for the Delivery of Proteins and Vaccines", 1996, CRC PRESS
"Polymers in Drug Delivery", 2006, CRC PRESS
"The Molecular Biology of the Yeast Saccharomyces", vol. I, II, 1982, COLD SPRING HARBOR PRESS
"VACCINE DESIGN: THE SUBUNIT AND ADJUVANT APPROACH", 1995, PLENUM PRESS
"Yeast Genetic Engineering", 1989, BUTTERWORTHS
AKDIS ET AL., EUR. J. IMMUNOLOGY, vol. 33, 2003, pages 2717 - 26
ANDRIANOV ET AL., BIOMATERIALS, vol. 19, no. 1-3, 1998, pages 109 - 115
BARR ET AL., ADV. DRUG DEL. REV., vol. 32, 1998, pages 247 - 271
BASCHANG ET AL., TETRAHEDRON, vol. 45, no. 20, 1989, pages 6331 - 6360
BEAUCAGE S L ET AL., TETRAHEDRON LETT, vol. 22, 1981, pages 1859
BEIGNON ET AL., INFECT. IMMUN., vol. 70, no. 6, 2002, pages 3012 - 3019
BERGLUND ET AL., NAT. BIOTECH., vol. 16, 1998, pages 562 - 565
BHAGAT ET AL., BBRC, vol. 300, 2003, pages 853 - 861
BITTER ET AL., METHODS IN ENZYMOLOGY, vol. 153, 1987, pages 516 - 544
BLACKWELL ET AL., J. IMMUNOL., vol. 170, no. 8, 2003, pages 4061 - 4068
CHOWDARY ET AL., NATURE STRUCTURAL & MOLECULAR BIOLOGY, vol. 17, 2010, pages 882 - 888
CURIEL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 8850
DOMENIGHINI ET AL., MOI. MICROBIOL., vol. 15, no. 6, 1995, pages 1165 - 1167
DUBENSKY ET AL., J. VIROL., vol. 70, 1996, pages 508 - 519
FREY ET AL., VACCINE, vol. 21, 2003, pages 4234 - 4237
FROEHLER B C ET AL., NUCL ACID RES, vol. 14, 1986, pages 5399 - 407
GAFFNEY B L ET AL., TETRAHEDRON LETT, vol. 29, 1988, pages 2619 - 22
GAREGG P ET AL., TETRAHEDRON LETT, vol. 27, 1986, pages 4051 - 4
GAREGG P ET AL., TETRAHEDRON LETT, vol. 27, 1986, pages 4055 - 8
GERBER ET AL., J. VIROL., vol. 75, no. 10, 2001, pages 4752 - 4760
GLOVER: "DNA Cloning", vol. II, 1986, IRL PRESS
GLUCK ET AL., VACCINE, vol. 20, 2002, pages 10 - 16
GOODCHILD J, BIOCONJUGATE CHEM, vol. 1, 1990, pages 165
GURSEL, M. ET AL., VACCINE, vol. 17, 1999, pages 1376 - 1383
HANTKE ET AL., EUR. J. BIOCHEM., vol. 34, 1973, pages 284 - 296
HARIHARAN ET AL., J. VIROL., vol. 72, 1998, pages 950 - 958
HEYES ET AL., J CONTROLLED RELEASE, vol. 107, 2005, pages 276 - 87
HEYES, J.; PALMER, L.; BREMNER, K.; MACLACHLAN, I.: "Cationic lipid saturation influences intracellular delivery of encapsulated nucleic acids", JOURNAL OF CONTROLLED RELEASE, vol. 107, 2005, pages 276 - 287
JOHNSON ET AL., BIOORG. MED. CHEM. LETT., vol. 9, 1999, pages 2273 - 2278
JONES, CURR. OPIN. INVESTIG. DRUGS, vol. 4, no. 2, 2003, pages 214 - 218
KANDIMALLA ET AL., BBRC, vol. 306, 2003, pages 948 - 953
KANDIMALLA ET AL., BIOCHEM. SOC. TRANS., vol. 3 L, 2003, pages 664 - 658
KANDIMALLA ET AL., BIOCHEM. SOC. TRANS., vol. 31, 2003, pages 654 - 658
KANDIMALLA ET AL., NUCL. ACIDS RES., vol. 31, no. 9, 2003, pages 2393 - 2400
KIM ET AL., JMED VIROL, vol. 79, 2007, pages 820 - 828
KLINMAN, D. M. ET AL., VACCINE, vol. 17, 1999, pages 19 - 25
KRIEG, NAT. MED., vol. 9, no. 7, 2003, pages 831 - 835
KRIEG, TRENDS IMMUNOL., vol. 23, no. 2, 2002, pages 64 - 65
LENZ ET AL., J. IMMUNOL., vol. 166, no. 9, 2001, pages 5346 - 5355
LILJESTROM, BIO/TECHNOLOGY, vol. 9, 1991, pages 1356 - 1361
LIMBACH ET AL., NUCLEIC ACIDS RESEARCH, vol. 22, no. 12, 1994, pages 2183 - 2196
MASUDA ET AL., NUCLEIC ACIDS SYMPOSIUM SERIES, vol. 51, 2007, pages 3 - 4
MCCLUSKIE ET AL., FEMS IMMUNOL. MED. MICROBIOL., vol. 32, 2002, pages 179 - 185
MERALDI ET AL., VACCINE, vol. 21, 2003, pages 2485 - 2491
MISCHLER; METCALFE, VACCINE, vol. 20, no. 5, 2002, pages B17 - B23
NIIKURA ET AL., VIROLOGY, vol. 293, 2002, pages 273 - 280
O'HAGAN ET AL., J VIROLOGY, vol. 75, 2001, pages 9037 - 9043
OTT ET AL., JOURNAL OF CONTROLLED RELEASE, vol. 79, 2002, pages 1 - 5
OTT ET AL.: "Vaccine Design: The Subunit and Adjuvant Approach", 1995, PLENUM PRESS, article "MF59 - Design and Evaluation of a Safe and Potent Adjuvant for Human Vaccines", pages: 277 - 296
PAJAK ET AL., VACCINE, vol. 21, 2003, pages 836 - 842
PARTIDOS ET AL., IMMUNOL. LETT., vol. 67, no. 3, 1999, pages 209 - 216
PAYNE ET AL., ADV. DRUG DEL. REV., vol. 31, no. 3, 1998, pages 185 - 196
PEPPOLONI ET AL., VACCINES, vol. 2, no. 2, 2003, pages 285 - 293
PERRI ET AL., J. VIROL., vol. 77, 2003, pages 10394 - 10403
PERRI ET AL.: "An alphavirus replicon particle chimera derived from venezuelan equine encephalitis and sindbis viruses is a potent gene-based vaccine delivery vector", J VIROL, vol. 77, 2003, pages 10394 - 10403
PINE ET AL., J. CONTROL RELEASE, vol. 85, no. 1-3, 2002, pages 263 - 270
PINTO ET AL., J. INFECT. DIS., vol. 188, 2003, pages 327 - 338
PITHA ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 204, no. 1, 1970, pages 39 - 48
PITHA ET AL., BIOPOLYMERS, vol. 9, no. 8, 1970, pages 965 - 977
PIZZA ET AL., J. MED. MICROBIOL., vol. 290, no. 4-5, 2000, pages 455 - 461
PIZZA ET AL., VACCINE, vol. 19, 2001, pages 2534 - 2541
PODDA, VACCINE, vol. 19, 2001, pages 2673 - 2680
POLO ET AL., PNAS, vol. 96, 1999, pages 4598 - 4603
PUSHKO ET AL., VIROLOGY, vol. 239, 1997, pages 389 - 401
REAP ET AL., VACCINE, vol. 25, 2007, pages 7441 - 7449
RUIZ-ARGUELLO ET AL., J. GEN. VIROL., vol. 85, 2004, pages 3677 - 3687
RYAN ET AL., INFECT. IMMUN., vol. 67, no. 12, 1999, pages 6270 - 6280
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR PRESS
SCHARTON-KERSTEN ET AL., INFECT. IMMUN., vol. 68, no. 9, 2000, pages 5306 - 5313
See also references of EP2729168A2
SINGH ET AL., J. CONT. RELEASE, vol. 70, 2001, pages 267 - 276
SINGH ET AL., PHARMACEUTICAL RESEARCH, vol. 20, 2003, pages 247 - 251
SJOLANDER ET AL., ADV. DRUG DEL. REV., vol. 32, 1998, pages 321 - 338
STANLEY, CLIN. EXP. DERMATOL., vol. 27, no. 7, 2002, pages 571 - 577
SUMMERS; SMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN NO. 1555, 1987
SWANSON ET AL., PNAS USA, vol. 108, no. 23, 2011, pages 9619 - 9624
UHLMANN ET AL., CHEM REV, vol. 90, 1990, pages 544 - 84
VACCINE, vol. 27, 2009, pages 4975 - 4982
VAJDY, M. ET AL.: "Mucosal adjuvants and delivery systems for protein-, DNA-and RNA-based vaccines", IMMUNOL CELL BIOL, vol. 82, no. 6, 2004, pages 617 - 27
WU; WU, J. BIOL. CHEM., vol. 263, 1988, pages 14621
XIONG ET AL., SCIENCE, vol. 243, 1989, pages 1188 - 1191

Cited By (178)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11052146B2 (en) 2008-12-09 2021-07-06 Novavax, Inc. Modified RSV F proteins and methods of their use
US11446374B2 (en) 2008-12-09 2022-09-20 Novavax, Inc. Modified RSV F proteins and methods of their use
US12357684B2 (en) 2008-12-09 2025-07-15 Novavax, Inc. Modified RSV F proteins and methods of their use
US9181319B2 (en) 2010-08-06 2015-11-10 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US9447164B2 (en) 2010-08-06 2016-09-20 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US8822663B2 (en) 2010-08-06 2014-09-02 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US9937233B2 (en) 2010-08-06 2018-04-10 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US10064959B2 (en) 2010-10-01 2018-09-04 Modernatx, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US9334328B2 (en) 2010-10-01 2016-05-10 Moderna Therapeutics, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US9657295B2 (en) 2010-10-01 2017-05-23 Modernatx, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US8710200B2 (en) 2011-03-31 2014-04-29 Moderna Therapeutics, Inc. Engineered nucleic acids encoding a modified erythropoietin and their expression
US9950068B2 (en) 2011-03-31 2018-04-24 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US9533047B2 (en) 2011-03-31 2017-01-03 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US12121592B2 (en) 2011-06-08 2024-10-22 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11951180B2 (en) 2011-06-08 2024-04-09 Translate Bio, Inc. Lipid nanoparticle compositions and methods for MRNA delivery
US11951181B2 (en) 2011-06-08 2024-04-09 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11951179B2 (en) 2011-06-08 2024-04-09 Translate Bio, Inc. Lipid nanoparticle compositions and methods for MRNA delivery
US11730825B2 (en) 2011-06-08 2023-08-22 Translate Bio, Inc. Lipid nanoparticle compositions and methods for mRNA delivery
US11547764B2 (en) 2011-06-08 2023-01-10 Translate Bio, Inc. Lipid nanoparticle compositions and methods for MRNA delivery
US9464124B2 (en) 2011-09-12 2016-10-11 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US10751386B2 (en) 2011-09-12 2020-08-25 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US10022425B2 (en) 2011-09-12 2018-07-17 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US9428535B2 (en) 2011-10-03 2016-08-30 Moderna Therapeutics, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US9271996B2 (en) 2011-12-16 2016-03-01 Moderna Therapeutics, Inc. Formulation and delivery of PLGA microspheres
US8664194B2 (en) 2011-12-16 2014-03-04 Moderna Therapeutics, Inc. Method for producing a protein of interest in a primate
US9186372B2 (en) 2011-12-16 2015-11-17 Moderna Therapeutics, Inc. Split dose administration
US8680069B2 (en) 2011-12-16 2014-03-25 Moderna Therapeutics, Inc. Modified polynucleotides for the production of G-CSF
US8754062B2 (en) 2011-12-16 2014-06-17 Moderna Therapeutics, Inc. DLIN-KC2-DMA lipid nanoparticle delivery of modified polynucleotides
US9295689B2 (en) 2011-12-16 2016-03-29 Moderna Therapeutics, Inc. Formulation and delivery of PLGA microspheres
US9814760B2 (en) 2012-04-02 2017-11-14 Modernatx, Inc. Modified polynucleotides for the production of biologics and proteins associated with human disease
US9878056B2 (en) 2012-04-02 2018-01-30 Modernatx, Inc. Modified polynucleotides for the production of cosmetic proteins and peptides
US9254311B2 (en) 2012-04-02 2016-02-09 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins
US9255129B2 (en) 2012-04-02 2016-02-09 Moderna Therapeutics, Inc. Modified polynucleotides encoding SIAH E3 ubiquitin protein ligase 1
US9221891B2 (en) 2012-04-02 2015-12-29 Moderna Therapeutics, Inc. In vivo production of proteins
US9283287B2 (en) 2012-04-02 2016-03-15 Moderna Therapeutics, Inc. Modified polynucleotides for the production of nuclear proteins
US9220755B2 (en) 2012-04-02 2015-12-29 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins associated with blood and lymphatic disorders
US9301993B2 (en) 2012-04-02 2016-04-05 Moderna Therapeutics, Inc. Modified polynucleotides encoding apoptosis inducing factor 1
US9303079B2 (en) 2012-04-02 2016-04-05 Moderna Therapeutics, Inc. Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins
US9114113B2 (en) 2012-04-02 2015-08-25 Moderna Therapeutics, Inc. Modified polynucleotides encoding citeD4
US9220792B2 (en) 2012-04-02 2015-12-29 Moderna Therapeutics, Inc. Modified polynucleotides encoding aquaporin-5
US10501512B2 (en) 2012-04-02 2019-12-10 Modernatx, Inc. Modified polynucleotides
US9192651B2 (en) 2012-04-02 2015-11-24 Moderna Therapeutics, Inc. Modified polynucleotides for the production of secreted proteins
US8999380B2 (en) 2012-04-02 2015-04-07 Moderna Therapeutics, Inc. Modified polynucleotides for the production of biologics and proteins associated with human disease
US9107886B2 (en) 2012-04-02 2015-08-18 Moderna Therapeutics, Inc. Modified polynucleotides encoding basic helix-loop-helix family member E41
US9572897B2 (en) 2012-04-02 2017-02-21 Modernatx, Inc. Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins
US9587003B2 (en) 2012-04-02 2017-03-07 Modernatx, Inc. Modified polynucleotides for the production of oncology-related proteins and peptides
US9050297B2 (en) 2012-04-02 2015-06-09 Moderna Therapeutics, Inc. Modified polynucleotides encoding aryl hydrocarbon receptor nuclear translocator
US9216205B2 (en) 2012-04-02 2015-12-22 Moderna Therapeutics, Inc. Modified polynucleotides encoding granulysin
US9095552B2 (en) 2012-04-02 2015-08-04 Moderna Therapeutics, Inc. Modified polynucleotides encoding copper metabolism (MURR1) domain containing 1
US9675668B2 (en) 2012-04-02 2017-06-13 Moderna Therapeutics, Inc. Modified polynucleotides encoding hepatitis A virus cellular receptor 2
US9061059B2 (en) 2012-04-02 2015-06-23 Moderna Therapeutics, Inc. Modified polynucleotides for treating protein deficiency
US9089604B2 (en) 2012-04-02 2015-07-28 Moderna Therapeutics, Inc. Modified polynucleotides for treating galactosylceramidase protein deficiency
US9782462B2 (en) 2012-04-02 2017-10-10 Modernatx, Inc. Modified polynucleotides for the production of proteins associated with human disease
US9149506B2 (en) 2012-04-02 2015-10-06 Moderna Therapeutics, Inc. Modified polynucleotides encoding septin-4
US9827332B2 (en) 2012-04-02 2017-11-28 Modernatx, Inc. Modified polynucleotides for the production of proteins
US9828416B2 (en) 2012-04-02 2017-11-28 Modernatx, Inc. Modified polynucleotides for the production of secreted proteins
US9233141B2 (en) 2012-04-02 2016-01-12 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins associated with blood and lymphatic disorders
GB2513768A (en) * 2012-07-06 2014-11-05 Novartis Ag Complexes of cytomegalovirus proteins
CN104853771A (zh) * 2012-07-06 2015-08-19 诺华股份有限公司 巨细胞病毒蛋白的复合物
US10287322B2 (en) 2012-07-06 2019-05-14 Glaxosmithkline Biologicals S.A. Complexes of cytomegalovirus proteins
US9683022B2 (en) 2012-07-06 2017-06-20 Glaxosmithkline Biologicals S.A. Complexes of cytomegalovirus proteins
WO2014005959A1 (en) * 2012-07-06 2014-01-09 Novartis Ag Complexes of cytomegalovirus proteins
CN104853770A (zh) * 2012-07-06 2015-08-19 诺华股份有限公司 免疫原性组合物及其应用
AU2013286093B2 (en) * 2012-07-06 2018-01-04 Novartis Ag Complexes of cytomegalovirus proteins
GB2513768B (en) * 2012-07-06 2015-04-15 Novartis Ag Complexes of cytomegalovirus proteins and nucleic acids encoding such proteins
WO2014005958A1 (en) * 2012-07-06 2014-01-09 Novartis Ag Immunogenic compositions and uses thereof
EP2869843B1 (en) 2012-07-06 2019-08-07 GlaxoSmithKline Biologicals SA Complexes of cytomegalovirus proteins
US9597380B2 (en) 2012-11-26 2017-03-21 Modernatx, Inc. Terminally modified RNA
WO2014108515A1 (en) 2013-01-10 2014-07-17 Novartis Ag Influenza virus immunogenic compositions and uses thereof
US8980864B2 (en) 2013-03-15 2015-03-17 Moderna Therapeutics, Inc. Compositions and methods of altering cholesterol levels
US10815291B2 (en) 2013-09-30 2020-10-27 Modernatx, Inc. Polynucleotides encoding immune modulating polypeptides
US10323076B2 (en) 2013-10-03 2019-06-18 Modernatx, Inc. Polynucleotides encoding low density lipoprotein receptor
US20150322115A1 (en) * 2014-05-08 2015-11-12 Redvax Gmbh Means and methods for treating cmv
EP3888676A1 (en) 2014-06-13 2021-10-06 GlaxoSmithKline Biologicals S.A. Immunogenic combinations
WO2015189425A1 (en) * 2014-06-13 2015-12-17 Glaxosmithkline Biologicals Sa Immunogenic combinations
US11571472B2 (en) 2014-06-13 2023-02-07 Glaxosmithkline Biologicals Sa Immunogenic combinations
JP2017523139A (ja) * 2014-06-13 2017-08-17 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム 免疫原性組合せ物
CN106659777A (zh) * 2014-06-13 2017-05-10 葛兰素史密丝克莱恩生物有限公司 免疫原性组合产品
EP4159741A1 (en) 2014-07-16 2023-04-05 ModernaTX, Inc. Method for producing a chimeric polynucleotide encoding a polypeptide having a triazole-containing internucleotide linkage
WO2016184822A1 (en) 2015-05-15 2016-11-24 Curevac Ag Prime-boost regimens involving administration of at least one mrna construct
US11254711B2 (en) 2015-06-12 2022-02-22 Glaxosmithkline Biologicals Sa Adenovirus polynucleotides and polypeptides
US11254710B2 (en) 2015-06-12 2022-02-22 Glaxosmithkline Biologicals Sa Adenovirus polynucleotides and polypeptides
CN108025058A (zh) * 2015-06-12 2018-05-11 葛兰素史密丝克莱恩生物有限公司 腺病毒多核苷酸和多肽
EP3307314A1 (en) * 2015-06-12 2018-04-18 GlaxoSmithKline Biologicals S.A. Adenovirus polynucleotides and polypeptides
CN108025058B (zh) * 2015-06-12 2022-12-16 葛兰素史密丝克莱恩生物有限公司 腺病毒多核苷酸和多肽
US10702597B2 (en) 2015-07-21 2020-07-07 Modernatx, Inc. CHIKV RNA vaccines
US11364292B2 (en) 2015-07-21 2022-06-21 Modernatx, Inc. CHIKV RNA vaccines
US10449244B2 (en) 2015-07-21 2019-10-22 Modernatx, Inc. Zika RNA vaccines
US11007260B2 (en) 2015-07-21 2021-05-18 Modernatx, Inc. Infectious disease vaccines
US11253585B2 (en) 2015-09-03 2022-02-22 Novavax, Inc. Vaccine compositions having improved stability and immunogenicity
US10426829B2 (en) 2015-09-03 2019-10-01 Novavax, Inc. Vaccine compositions having improved stability and immunogenicity
US12257297B2 (en) 2015-09-03 2025-03-25 Novavax, Inc. Vaccine compositions having improved stability and immunogenicity
US11364294B2 (en) 2015-09-03 2022-06-21 Novavax, Inc. Vaccine compositions having improved stability and immunogenicity
US10442756B2 (en) 2015-09-17 2019-10-15 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12404232B2 (en) 2015-09-17 2025-09-02 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10266485B2 (en) 2015-09-17 2019-04-23 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10392341B2 (en) 2015-09-17 2019-08-27 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US11220476B2 (en) 2015-09-17 2022-01-11 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12151995B2 (en) 2015-09-17 2024-11-26 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US11235052B2 (en) 2015-10-22 2022-02-01 Modernatx, Inc. Chikungunya virus RNA vaccines
US11278611B2 (en) 2015-10-22 2022-03-22 Modernatx, Inc. Zika virus RNA vaccines
US10383937B2 (en) 2015-10-22 2019-08-20 Modernatx, Inc. Human cytomegalovirus RNA vaccines
US10716846B2 (en) 2015-10-22 2020-07-21 Modernatx, Inc. Human cytomegalovirus RNA vaccines
US11643441B1 (en) 2015-10-22 2023-05-09 Modernatx, Inc. Nucleic acid vaccines for varicella zoster virus (VZV)
US10064935B2 (en) 2015-10-22 2018-09-04 Modernatx, Inc. Human cytomegalovirus RNA vaccines
US11484590B2 (en) 2015-10-22 2022-11-01 Modernatx, Inc. Human cytomegalovirus RNA vaccines
US10493143B2 (en) 2015-10-22 2019-12-03 Modernatx, Inc. Sexually transmitted disease vaccines
US12491260B2 (en) 2015-12-10 2025-12-09 Modernatx, Inc. Compositions and methods for delivery of agents
US10485885B2 (en) 2015-12-10 2019-11-26 Modernatx, Inc. Compositions and methods for delivery of agents
US10556018B2 (en) 2015-12-10 2020-02-11 Modernatx, Inc. Compositions and methods for delivery of agents
US10207010B2 (en) 2015-12-10 2019-02-19 Modernatx, Inc. Compositions and methods for delivery of agents
US11285222B2 (en) 2015-12-10 2022-03-29 Modernatx, Inc. Compositions and methods for delivery of agents
US10799463B2 (en) 2015-12-22 2020-10-13 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US10195156B2 (en) 2015-12-22 2019-02-05 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US12396961B2 (en) 2015-12-22 2025-08-26 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US10611800B2 (en) 2016-03-11 2020-04-07 Pfizer Inc. Human cytomegalovirus gB polypeptide
US12128113B2 (en) 2016-05-18 2024-10-29 Modernatx, Inc. Polynucleotides encoding JAGGED1 for the treatment of Alagille syndrome
US10695419B2 (en) 2016-10-21 2020-06-30 Modernatx, Inc. Human cytomegalovirus vaccine
US11197927B2 (en) 2016-10-21 2021-12-14 Modernatx, Inc. Human cytomegalovirus vaccine
US11541113B2 (en) 2016-10-21 2023-01-03 Modernatx, Inc. Human cytomegalovirus vaccine
US12144895B2 (en) 2016-11-08 2024-11-19 Modernatx, Inc. Stabilized formulations of lipid nanoparticles
US11583504B2 (en) 2016-11-08 2023-02-21 Modernatx, Inc. Stabilized formulations of lipid nanoparticles
US11696946B2 (en) 2016-11-11 2023-07-11 Modernatx, Inc. Influenza vaccine
US12318443B2 (en) 2016-11-11 2025-06-03 Modernatx, Inc. Influenza vaccine
US12409218B2 (en) 2016-11-11 2025-09-09 Modernatx, Inc. Influenza vaccine
US10925958B2 (en) 2016-11-11 2021-02-23 Modernatx, Inc. Influenza vaccine
US11103578B2 (en) 2016-12-08 2021-08-31 Modernatx, Inc. Respiratory virus nucleic acid vaccines
WO2018170260A1 (en) * 2017-03-15 2018-09-20 Modernatx, Inc. Respiratory syncytial virus vaccine
US10857105B2 (en) 2017-03-15 2020-12-08 MordernaTX, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12552738B2 (en) 2017-03-15 2026-02-17 Modernatx, Inc. Crystal forms of amino lipids
US11203569B2 (en) 2017-03-15 2021-12-21 Modernatx, Inc. Crystal forms of amino lipids
US11918644B2 (en) 2017-03-15 2024-03-05 Modernatx, Inc. Varicella zoster virus (VZV) vaccine
US11045540B2 (en) 2017-03-15 2021-06-29 Modernatx, Inc. Varicella zoster virus (VZV) vaccine
US11576961B2 (en) 2017-03-15 2023-02-14 Modernatx, Inc. Broad spectrum influenza virus vaccine
US11464848B2 (en) 2017-03-15 2022-10-11 Modernatx, Inc. Respiratory syncytial virus vaccine
US12324859B2 (en) 2017-03-15 2025-06-10 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US11969506B2 (en) 2017-03-15 2024-04-30 Modernatx, Inc. Lipid nanoparticle formulation
US11752206B2 (en) 2017-03-15 2023-09-12 Modernatx, Inc. Herpes simplex virus vaccine
US12077501B2 (en) 2017-06-14 2024-09-03 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US11786607B2 (en) 2017-06-15 2023-10-17 Modernatx, Inc. RNA formulations
US12083228B2 (en) 2017-07-24 2024-09-10 Novavax, Inc. Methods and compositions for treating respiratory disease
US11964007B2 (en) 2017-07-28 2024-04-23 Janssen Vaccines & Prevention B.V. Methods and compositions for heterologous repRNA immunizations
WO2019023566A1 (en) * 2017-07-28 2019-01-31 Janssen Vaccines & Prevention B.V. METHODS AND COMPOSITIONS FOR PROVIDING IMMUNIZATION AGAINST Heterologous ARNREP
US11235051B2 (en) 2017-07-28 2022-02-01 Janssen Vaccines & Prevention B.V. Methods and compositions for heterologous repRNA immunizations
US11744801B2 (en) 2017-08-31 2023-09-05 Modernatx, Inc. Methods of making lipid nanoparticles
US12357575B2 (en) 2017-08-31 2025-07-15 Modernatx, Inc. Methods of making lipid nanoparticles
US11207398B2 (en) 2017-09-14 2021-12-28 Modernatx, Inc. Zika virus mRNA vaccines
US10653767B2 (en) 2017-09-14 2020-05-19 Modernatx, Inc. Zika virus MRNA vaccines
WO2019123169A1 (en) 2017-12-20 2019-06-27 Glaxosmithkline Biologicals Sa Epstein-barr virus antigen constructs
US11911453B2 (en) 2018-01-29 2024-02-27 Modernatx, Inc. RSV RNA vaccines
US12453766B2 (en) 2018-01-29 2025-10-28 Modernatx, Inc. RSV RNA vaccines
US11278612B2 (en) 2018-03-19 2022-03-22 Novavax, Inc. Multivalent influenza nanoparticle vaccines
US11896662B2 (en) 2018-03-19 2024-02-13 Novavax, Inc. Multivalent influenza nanoparticle vaccines
WO2020035609A3 (en) * 2018-08-17 2020-05-28 Glaxosmithkline Biologicals Sa Immunogenic compositions and uses thereof
US12083174B2 (en) 2018-08-17 2024-09-10 Glaxosmithkline Biologicals Sa Immunogenic compositions and uses thereof
CN113164584A (zh) * 2018-08-17 2021-07-23 葛兰素史密丝克莱恩生物有限公司 免疫原性组合物及其用途
US12383508B2 (en) 2018-09-19 2025-08-12 Modernatx, Inc. High-purity peg lipids and uses thereof
US12151029B2 (en) 2018-09-19 2024-11-26 Modernatx, Inc. PEG lipids and uses thereof
US12263248B2 (en) 2018-09-19 2025-04-01 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12090235B2 (en) 2018-09-20 2024-09-17 Modernatx, Inc. Preparation of lipid nanoparticles and methods of administration thereof
US11629172B2 (en) 2018-12-21 2023-04-18 Pfizer Inc. Human cytomegalovirus gB polypeptide
US11793843B2 (en) 2019-01-10 2023-10-24 Janssen Biotech, Inc. Prostate neoantigens and their uses
US11351242B1 (en) 2019-02-12 2022-06-07 Modernatx, Inc. HMPV/hPIV3 mRNA vaccine composition
US12070495B2 (en) 2019-03-15 2024-08-27 Modernatx, Inc. HIV RNA vaccines
US12214027B2 (en) 2019-03-29 2025-02-04 Intervet Inc. Stabilisation of live mollicutes bacteria in a liquid composition
US11597698B2 (en) 2019-09-19 2023-03-07 Modernatx, Inc. Branched tail lipid compounds and compositions for intracellular delivery of therapeutic agents
US12312293B2 (en) 2019-09-19 2025-05-27 Modernatx, Inc. Branched tail lipid compounds and compositions for intracellular delivery of therapeutic agents
US11066355B2 (en) 2019-09-19 2021-07-20 Modernatx, Inc. Branched tail lipid compounds and compositions for intracellular delivery of therapeutic agents
US12018289B2 (en) 2019-11-18 2024-06-25 Janssen Biotech, Inc. Vaccines based on mutant CALR and JAK2 and their uses
WO2021202772A1 (en) * 2020-04-01 2021-10-07 University Of Florida Research Foundation, Incorporated Multilamellar rna nanoparticle vaccine against sars-cov-2
US11857622B2 (en) 2020-06-21 2024-01-02 Pfizer Inc. Human cytomegalovirus GB polypeptide
US12295997B2 (en) 2020-07-06 2025-05-13 Janssen Biotech, Inc. Prostate neoantigens and their uses
US11406703B2 (en) 2020-08-25 2022-08-09 Modernatx, Inc. Human cytomegalovirus vaccine
WO2022137128A3 (en) * 2020-12-23 2022-08-04 Glaxosmithkline Biologicals Sa Self-amplifying messenger rna
US11622972B2 (en) 2021-02-19 2023-04-11 Modernatx, Inc. Lipid nanoparticle compositions and methods of formulating the same
US12508278B2 (en) 2021-02-19 2025-12-30 Modernatx, Inc. Lipid nanoparticle compositions and methods of formulating the same
US11524023B2 (en) 2021-02-19 2022-12-13 Modernatx, Inc. Lipid nanoparticle compositions and methods of formulating the same
US12582683B2 (en) 2023-06-27 2026-03-24 Janssen Biotech, Inc. Prostate neoantigens and their uses

Also Published As

Publication number Publication date
JP2014520807A (ja) 2014-08-25
EP3508219A1 (en) 2019-07-10
JP2017025103A (ja) 2017-02-02
WO2013006842A3 (en) 2014-06-19
US20140242152A1 (en) 2014-08-28
US11058762B2 (en) 2021-07-13
US20210290755A1 (en) 2021-09-23
EP2729168A2 (en) 2014-05-14
CA2841047A1 (en) 2013-01-10

Similar Documents

Publication Publication Date Title
US20210290755A1 (en) Immunogenic compositions and uses thereof
US20240082329A1 (en) Immunogenic combination compositions and uses thereof
US11813323B2 (en) RSV immunization regimen
AU2012280904B2 (en) Cationic oil-in-water emulsions
CA2804591C (en) Cationic oil-in-water emulsions
US20150140068A1 (en) Immunogenic compositions and uses thereof
HK40086859A (en) Rsv immunization regimen
HK40086431A (en) Rsv immunization regimen
HK40086431B (en) Rsv immunization regimen

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12735421

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2014519091

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2841047

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2012735421

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 14130869

Country of ref document: US