WO2012023660A1 - 크레이스토카릭스 오페르쿠라투스로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제 - Google Patents

크레이스토카릭스 오페르쿠라투스로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제 Download PDF

Info

Publication number
WO2012023660A1
WO2012023660A1 PCT/KR2010/007442 KR2010007442W WO2012023660A1 WO 2012023660 A1 WO2012023660 A1 WO 2012023660A1 KR 2010007442 W KR2010007442 W KR 2010007442W WO 2012023660 A1 WO2012023660 A1 WO 2012023660A1
Authority
WO
WIPO (PCT)
Prior art keywords
methoxy
swine
avian
dihydroxy
extract
Prior art date
Application number
PCT/KR2010/007442
Other languages
English (en)
French (fr)
Inventor
윤인중
김은희
최환원
오원근
다오트롱투완
텅풍티엔
Original Assignee
주식회사 중앙백신연구소
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 중앙백신연구소 filed Critical 주식회사 중앙백신연구소
Priority to US12/954,331 priority Critical patent/US20120046353A1/en
Publication of WO2012023660A1 publication Critical patent/WO2012023660A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/35—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/35—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom
    • A61K31/352—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom condensed with carbocyclic rings, e.g. methantheline 
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals

Definitions

  • the present invention is a compound for inhibiting neuraminidase enzyme derived from Creistocalyx operculatus (neuraminidase) and a composition for use in the prevention and treatment of avian and swine influenza and swine flu comprising the same as an active ingredient It is about.
  • the present invention relates to a neuraminidase inhibitor compound comprising any one of the compounds represented by the present invention, and a composition for the prevention and treatment of diseases related to viral neuraminidase inhibition such as cold, bird and swine influenza, swine flu, etc. containing the same as an active ingredient.
  • Influenza viruses are orthomyxoviruses belonging to the orthomyxo family and are classified into types A, B and C.
  • Type A is a virus that has been confirmed mainly in humans and has been confirmed in pigs, other mammals, and various wild birds compared to types B and C.
  • Avian influenza, swine influenza and Novel flu which are a problem worldwide, belong to the type A virus.
  • Influenza infections in birds are mainly related to H5, H7 and H9 types, with only three types of hemagglutinin (H1, H2, H3) and two types of neuraminidase (N1 and N2) in humans.
  • H1, H2, H3 hemagglutinin
  • N1 and N2 two types of neuraminidase
  • Avian influenza spreads quickly through wild birds and migratory birds that come to Korea, in addition to contacting poultry such as chickens, ducks and turkeys.
  • Avian influenza virus is periodically introduced and spread from Southeast Asia, where avian influenza has occurred, and can be transmitted from China through spring yellow dust.
  • Avian influenza a global viral disease of animals, has been incurred since 1996 in Korea, killing 5.3 million chickens and ducks, causing more than 150 billion won in direct damage. More than 10 livestock are slaughtered, causing huge economic losses for the poultry industry.
  • the swine influenza virus was reported for the first time in 1918.
  • swine has a human influenza receptor (N-acetylneuraminic acid ⁇ 2,6 galactose) and avian influenza receptor (N-acetylneuraminic acid ⁇ 2,3). It is known to have a galactose, which acts as a virus mixing vessel for the avian influenza virus to infect humans through reassortment or adaptation in pigs.
  • Swine flu is basically like a cold, high fever, cough, etc. There is a possibility that the virus becomes more lethal than humans.
  • WHO World Health Organization
  • Common symptoms of swine flu are very difficult to distinguish from the common flu.
  • Swine flu shows symptoms of fever, sore throat, cough, runny nose or stuffy nose, similar to the common flu, and recent reports related to swine flu show more severe fatal lung damage than the common flu.
  • Treatment is a very important problem. Therefore, it is necessary to secure a vaccine to prevent the swine flu.
  • a preventive vaccine it is almost impossible to make a vaccine that prevents all RNA viruses in which antigenic variation occurs every time. Therefore, in order to prepare for the development of avian and swine influenza, swine flu or a new pathogen mixed with the worst possible avian influenza and swine flu, it is necessary to develop a therapeutic agent that can prevent and treat it.
  • avian and swine influenza and swine flu treatments include orltamivir phosphate, an oral therapeutic agent developed as a selective inhibitor of neuraminidase of viral origin, and inhaled zanamivir.
  • Side effects of Tamiflu which is widely used as an oral treatment, have been reported such as nausea, vomiting, nervous or psychological problems, and in Japan, there are 15 cases of death in pediatric patients confirmed after Tamiflu approval.
  • resistant virus against Tamiflu which is used as an oral treatment, and the emergence of resistance to Tamiflu, which is fatal to the spread of swine flu, has been reported, and even human-to-human transmission of Tamiflu-resistant virus has been reported. It is being discovered.
  • the development of viral treatments for avian and swine influenza and swine flu is essential for human health and safety.
  • Tamiflu-resistant avian influenza viruses are known to occur through three genetic variations (Arg292Lys, Asn274Ser, His294Tyr) that normally alter the amino acids of Tamiflu's receptor protein to which Tamiflu binds. Of the three genetic variants, the 294 His, the most highly expressed variant of the Tamiflu-resistant avian influenza virus, changes to Tyr when its hydrophobic residues do not bind to Tamiflu receptors. . It is a virus found in the United States and Europe with a 10-25% chance of being found in the 2007-2008 season, increasing the risk of future mutations. The emergence of these Tamiflu-resistant viruses therefore provides a justification for humans to continue developing new viral therapies.
  • the neuraminidase inhibitors against avian and swine influenza and swine flu targeting the food and medicinal plants that can be adapted immediately if the effect is confirmed in view of the urgency against defense measures of avian and swine influenza and swine flu.
  • finding new active ingredients from natural medicines used in traditional medicine has many advantages over experimental modification of existing drugs to develop new ingredients of medicine.
  • these active ingredients have been used for a long time, there is little concern about toxicity due to drugs. This fact can be confirmed from the development of Tamifludo starting material, which is used as a treatment for swine flu, as the main ingredient of 'Staranis' fruit, which is a native plant of China.
  • Crestocaryx opercuratus which is the subject of the present invention, is a plant of about 6-12 m that is widely distributed from tropical Asia to the northern part of Australia. Traditionally used as a medicinal herb for diseases of the digestive system in Vietnam or western China, the buds of Crestocaryx opercuratus, called nu voi, are mainly used to suppress shock or reduce heat. (Loi, DT Medical Publishing House, Hanoi, Vietnam, 2001, 423-424). Cristocarix opercuratus has been shown to be effective in treating liver-related diseases and diabetes (Lu, YH et.al, Zhongguo Zhong Yao ZaZhi, 2003, 28, 964 ⁇ 966; Mai, TT et.
  • the present invention purely isolates the compounds from the organic solvent extract of Crestocaryx opercuratus, and each of these compounds is isolated against the neuraminidase (His294Tyr) of avian and swine influenza virus, swine flu and Tamiflu resistant virus. Comparing the activity of the compounds of the present invention was confirmed to have inhibitory activity against avian and swine influenza, swine flu.
  • An object of the present invention is purely from Crestocaryx opercuratus, which inhibits the neuraminidase of avian and swine influenza virus, swine flu, and Tamiflu-resistant swine flu, and thus has a prophylactic and therapeutic effect on avian influenza and swine flu related diseases. It is to provide a composition containing each or two or more of the compounds obtained by separation and purification as an active ingredient.
  • the present inventors collected various native plants and herbal medicines, and used a culture solution of avian and swine influenza virus or cloned the neuraminidase of the H1N1 and Tamiflu-resistant H1N1 viruses, and then introduced them into cells, thereby introducing neurais.
  • Cleistocalyx operculatus was selected as a candidate plant.
  • the present invention is a compound represented by the following Chemical Formula 1 among a plurality of compounds obtained by extracting Crystocaryx opercuratus with an alcohol and separating and purifying purely by chromatography, and confirming the structure through chemical structure and physicochemical characterization.
  • the present invention was completed after the activity was confirmed by a method of measuring the inhibitory effect of the virus-derived neuraminidase and Tamiflu-resistant neuraminidase.
  • the present invention is characterized by including at least one compound of the above compounds as an active ingredient to inhibit neuraminidase to prevent or treat avian and swine influenza, swine flu-related diseases.
  • the compound is a step of separating and purifying the pure purified compound from the organic solvent extract of Cresto Carrix Opercuratus; Examining the chemical structure and physicochemical properties of the compound obtained in the step; Making neuraminidase of the swine flu virus, neuraminidase of the Tamiflu resistant swine flu virus (His294Tyr); Activity of the compound was determined by measuring the inhibitory effect of the avian influenza virus (H9N2) and the swine influenza virus (H1N1) on the neuraminidase and the swine flu virus and the Tamiflu-resistant swine flu virus against neuraminidase. .
  • Inhibitory compounds of the avian influenza virus (H9N2) and the swine influenza virus (H1N1) against neuraminidase and the swine flu virus and the Tamiflu-resistant swine flu virus neuraminidase are organic from Crestokaryx opercuratus. Separation of plant components such as extraction with solvents (alcohol, aqueous alcohol solution, ethyl acetate, ether, acetone, chloroform, etc.), distribution of hexane and water, use of adsorption resins such as DIION HP-20 resin, method by column chromatography The well-known method used for extraction can be obtained easily or in combination suitably. The crude extract can be further purified according to a commercial method as needed.
  • solvents alcohol, aqueous alcohol solution, ethyl acetate, ether, acetone, chloroform, etc.
  • adsorption resins such as DIION HP-20 resin
  • the crude extract can be further purified according to a commercial method as needed.
  • the chromatography used in the present invention includes silica gel column chromatography, L-20 column chromatography, thin layer chromatography (TLC) and high performance liquid chromatography (TLC). high performance liquid chromatography) and the like.
  • Crestocaryx opercuratus extract according to the present invention or a compound separated therefrom has high stability and can be used as an additive in foods and pharmaceuticals.
  • the pharmaceutical composition comprising the extract or compound according to the present invention may be prepared according to a conventional method, respectively, in the form of powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, oral formulations, external preparations, suppositories, and sterile injectable solutions. It can be formulated and used in the form.
  • Carriers, excipients and diluents that may be included in the composition comprising the extract or compound include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate , Calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, and the like, and such solid preparations may contain at least one excipient such as starch, calcium carbonate, sucrose or lactose, gelatin, or the like. Mix is prepared. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used.
  • Oral liquid preparations include suspensions, solvents, emulsions, and syrups, and may include various excipients, such as wetting agents, sweeteners, fragrances, and preservatives, in addition to commonly used simple diluents such as water and liquid paraffin.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized preparations, suppositories.
  • the non-aqueous solvent and suspending agent propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate and the like can be used.
  • As the base of the suppository witepsol, macrogol, tween 61, cacao butter, laurin butter, glycerogelatin and the like can be used.
  • the dosage of the extract or compound will vary depending on the age, sex and weight of the subject to be treated, the particular disease or pathology to be treated, the severity of the disease or pathology, the route of administration and the judgment of the prescriber. Dosage determination based on these factors is within the level of skill in the art and generally dosages range from 0.01 mg / kg / day to approximately 2000 mg / kg / day. More preferred dosage is 0.1 mg / kg / day to 500 mg / kg / day. Administration may be administered once a day or may be divided several times. The dosage does not limit the scope of the invention in any aspect. Extracts or compounds of the present invention can be administered to mammals, such as mice, livestock, humans, and the like by a variety of routes.
  • All modes of administration can be expected, for example, by oral, rectal or intravenous, intramuscular, subcutaneous, intrauterine dural or cerebrovascular injections. Since the extract or compound of the present invention has little toxicity and side effects, it is a drug that can be used safely even for prolonged administration for the purpose of prevention.
  • the present invention also provides a dietary supplement for the prevention of algae and swine influenza and swine flu, including the Crestoscarix opercuratus extract and food supplements.
  • the health functional food of the present invention includes the form of tablets, capsules, pills or liquids, etc., and the food to which the extract of the present invention may be added, for example, the health functional food is a drink, meat, sausage, Dairy products including bread, candy, snacks, noodles, ice cream, beverages including soups and ionic drinks, nutritional products including alcoholic beverages and vitamin complexes.
  • the present invention provides a dietary supplement for the prevention and treatment of swine flu-related diseases, including Crestoscarix opercuratus extract and food acceptable food supplements.
  • the present invention is the Creststocarix opercuratus extract and Creststocarix opercuratus It can be used as feed additives and therapeutic substances for the purpose of preventing and treating animal diseases including the derived compounds.
  • the feed additive and the therapeutic substance of the present invention can be used for infectious enteritis caused by bacterial infection, which is a common common disease related to neuraminidase, which commonly occurs in animals and humans.
  • animal feed additives for the treatment, animal drugs are provided.
  • the Crestoscarix opercuratus extract and the Crestoscarix opercuratus-derived compounds according to the present invention are non-neurominidase of avian and swine influenza virus or swine flu virus neuraminidase and Tamiflu-resistant swine flu virus. Similarly, it was possible to inhibit neuraminidase in the Tamiflu-resistant H1N1 virus which has a competitively inhibiting therapeutic effect and Tamiflu resistance.
  • Tamiflu and the compound of the present invention in combination with avian influenza (H9N2), swine influenza (H1N1) virus was able to reduce the amount of Tamiflu. That is, Tamiflu inhibited 50% virus at 4.24 ⁇ 0.82ng / ml and 39.04 ⁇ 1.03ng / ml when Tamiflu alone was treated with avian influenza (H9N2) and swine influenza (H1N1) viruses without compound 4, but 1 ⁇ g of compound 4 was inhibited.
  • the extract of Crestocaryx opferractus and the compound isolated therefrom inhibit the neuraminidase of avian influenza virus, swine influenza virus, swine flu virus, and Tamiflu-resistant swine flu virus, thereby inhibiting avian influenza and swine flu.
  • the effectiveness of the prevention and treatment of related diseases can be expected.
  • there is little cytotoxicity can be very useful and used in medicines, cosmetics, health food, animal feed, animal medicines.
  • Figure 1 shows the HPLC analysis spectrum showing the peak and the compound appearing on the HPLC after confirming the structure by separating the compound isolated from Cresto Carrix of Percuratus.
  • FIG. 5 is a Lineweaver Burk plots showing that Compound 14 showing a strong inhibitory activity among compounds isolated from Crestocarix opercuratus is an uncompetitive inhibitor.
  • FIG. 6 shows the inhibition rate of neuraminidase activity of swine influenza virus according to Tamiflu concentration (ng / ml) in parallel with compound 4 (1 ⁇ g / ml).
  • FIG. 7 shows the inhibition rate of neuraminidase activity of avian influenza virus according to Tamiflu concentration (ng / ml) in parallel with compound 4 (1 ⁇ g / ml).
  • the extract was good in 50 ⁇ 100% ethanol, methanol extract, but 70% ethanol by comparing the amount and activity of the extraction solvent and the amount of solvents that are acceptable to the human body
  • the extract was set to the optimum extraction conditions.
  • Fraction F5 was loaded onto Sephadex LH-20 resin and eluted with methanol to obtain four subfractions (fr.5.1-5.5).
  • the small fraction F5.3 was again fractionated into five fractions by reverse phase (RP-18) column chromatography using MeOH-H 2 O mixed solvent, increasing in sequence from 1: 1 to 10: 1.
  • Example 2 the structure of the compound isolated from Crestoscarix opercuratus was analyzed.
  • the chemical structure of the compound was analyzed based on 1 H and 13 C-NMR analysis of molecular weight and nuclear magnetic resonance analysis obtained using an ESI mass spectrometer.
  • the structure-determined compound had the structure shown in Formula 1 above, and summarized the chemical properties and 1 H, 13 C-NMR results of the separated compound is shown below.
  • the avian influenza virus used in the experiment was a low-pathogenic avian influenza virus A / chicken / Korea / 01310/2001 (H9N2). This was inoculated into the 10-day-old SPF (Specific-Pathogen Free) fertilized egg Allantoic Cavity, and 2 days later, the virus was inoculated into MDCK (Madin-Darby canine kidney) belonging to kidney cells and incubated for 5 days, followed by centrifugation. The culture of the supernatant layer was then used to measure the activity of viral neuraminidase of H9N2 origin.
  • SPF Specific-Pathogen Free
  • MDCK Medin-Darby canine kidney
  • the swine influenza virus used in the experiment was A / Sw / Kor / CAN1 / 04 (H1N1, KCTC 11165BP), a swine influenza virus from the Central Vaccine Institute.
  • the virus was inoculated into 10-day-old Specific-Pathogen Free (SPF) Egg Allantoic Cavity and harvested 2 days later to propagate the seed virus.
  • SPF Specific-Pathogen Free
  • the cultured seed virus was then reinoculated into the lumen cavity of SPF eggs to obtain a virus culture, and then used to measure the activity of viral neuraminidase of H1N1 origin.
  • the H1N1 virus is highly contagious and is highly likely to die of disease if infected. Therefore, the H1N1 virus is primarily used as a target for new drugs rather than identifying and identifying active substances that are effective. Only Days was expressed in animal cell lines to validate the activity of drug candidates.
  • the neuraminidase gene sequence of the H1N1 virus was confirmed from the NCBI gene bank, and cloned the neuraminidity of the H1N1 virus, and artificially produced a neuraminidism point mutant of the H1N1 virus was resistant to Tamiflu. Was used to explore the activity of natural products.
  • each base sequence used for cloning is as follows.
  • This method produced an oligonucleotide corresponding to the portion to be replaced, and then amplified the plasmid in vitro using a PCR enzyme, and methylation to remove the plasmid having the existing sequencing. DpnI enzyme that cleaves only the plasmids was treated. The mutated plasmid was amplified in bacteria and used for the experiment by finally confirming amino acid substitution through DNA sequencing.
  • the neuraminidase activity was used by modifying the method devised by Myers et al. In order to measure the exact inhibition rate.
  • Each 20 ⁇ l of 0.04 M sodium acetate buffer (pH 5.0) and 80 ⁇ l of 0.04 mM 4-methylumbelliferyl- ⁇ -DN-acetylneuraminic acid (Sigma M8639) were mixed with each neuraminidase sample for 10 minutes, followed by 0.1 M reaction. After the reaction was stopped by adding 100 ⁇ l of glycine-NaOH buffer, the activity was measured using a fluorescence difference at 360 nm / 440 nm using a fluorophotometer.
  • Tamiflu the compound, or each solvent and fraction extract were pretreated in the cell or administered together when culturing the virus to be activated (in order to process the compound directly on the sample, 1 ⁇ l of the compound was added to the fluorescence reaction).
  • the inhibition rate was calculated using A as the measured luminescence, C as the luminescence of the solvent in which the sample was dissolved, and B as the luminescence of the sample mixture.
  • the concentration of 4-methoxyumbelliferone was measured before adding 0.1M glycine-NaOH buffer to stop the reaction and calculated in Sigmaplot 11.0 (SPCC Inc., Chicago, IL).
  • Sigmaplot 11.0 Sigmaplot 11.0 (SPCC Inc., Chicago, IL).
  • SPCC Inc. Chicago, IL
  • neuraminidase activity of viral origin a method of measuring neuraminidase activity from virus cultures derived from avian influenza virus (H9N2) and swine influenza virus (H1N1) was used.
  • the activity of neuraminidase using the virus culture was measured by the method of Example 6 using the virus cultures of Examples 4-1 and 4-2, and each fraction of the ethanol extract and neurai using Compound 1 to Compound 14 were used.
  • Table 2 and Table 3 As shown in Table 2, in order to compare the activity of ethanol extracts and solvent fractions against neuraminidase, the extract activity of each extract against neuraminidase obtained from virus culture at the final concentration of 20 ⁇ g / ml. was measured.
  • the extract was confirmed that the activity is excellent in the 70% ethanol extract and ethyl acetate fraction.
  • the compounds of the present invention is a neuramini against avian influenza and swine influenza virus It was confirmed that there is inhibitory activity against Days.
  • Tamiflu has inhibitory activity against neuraminidase of avian influenza virus origin (4.24 ⁇ 0.82ng / ml) against neuraminidase of swine influenza virus origin (39.04 ⁇ 1.03ng / ml Better than).
  • Tamiflu is made by synthesizing compounds that selectively bind to active residues after identifying the neuraminidase protein structure of avian influenza. Tamiflu acts as an active residue as a competitive inhibitor of neuraminidase. However, recently, viruses resistant to Tamiflu have obtained resistance by using a method of modifying the active residue on which Tamiflu acts. The inventors used one of the active compounds to determine the inhibition pattern of the chalcone family of compounds. compound 4 The inhibition regime was reviewed using a method of varying the concentration of. A compound that is one of the main compounds of Crestocaryx opercuratus 4 Is a noncompetitive inhibitor that reversibly inhibits neuraminidase of swine influenza virus origin. These results confirm that the chalcone-based compound acts non-competitively on neuraminidase and thus can be widely used alone or in combination with Tamiflu despite the emergence of resistant viruses.
  • Example 8 Determination of neuraminidase activity in lysate of cells expressing neuraminidase directly
  • neuraminidase In order to measure the activity of neuraminidase in cell disruption cells expressing the neuraminidase of the H1N1 virus and the Tamiflu-resistant H1N1 virus, human kidney kidney HEK293T cells were treated with 0.25% trypsin and collected. The supernatant was removed and then suspended in DMEM medium free of bovine serum. 3 ⁇ l of lipofectamine (Lipofectamin, Invitrogen, Inc) was added to 100 ⁇ l of DMEM without bovine serum, and the mixture was slowly mixed and allowed to stand at room temperature for 15 minutes.
  • lipofectamine Lipofectamin, Invitrogen, Inc
  • transfection of the plasmids expressing the neuraminidase of the swine flu virus (Example 5-1) and the neuraminidase of the Tamiflu-resistant swine flu virus (Example 5-2) was performed by transfection (DNA) into animal cells.
  • each plasmid of 1 ⁇ g was slowly added dropwise to the microneedle tube over 30 seconds, and left for 15 minutes at room temperature.
  • the mixture of lipofectamine and DNA-plasmid and HEK293T cell line were slowly mixed, incubated at room temperature for 20 minutes in suspension, and then aliquoted in a 35 mm culture vessel and incubated in a CO 2 incubator for 24 hours.
  • HEK293T cells were washed twice with PBS, 500 ⁇ l of extract solution was added to each culture vessel, and the cells were disrupted and centrifuged at 14,000 rpm for 5 minutes. The obtained supernatant was purified by using the method of Example 6 Used for activity experiments.
  • Table 4 shows the compounds isolated from the Crestoscarix opercuratus extract One To compound 14 Active and active ingredient against neuraminidase of the viral origin 4 , compound 5 , Compound 8 And compounds 14 The results were measured for the activity against the neuraminidase of the H1N1 virus and the tamiflu-resistant H1N1 virus.
  • Example 7 The 50% inhibition rate of Tamiflu against neuraminidase of swine influenza virus confirmed in Example 7 was 39.04 ⁇ 1.03ng / ml, and the 50% inhibition rate of Tamiflu against neuraminidase of avian influenza virus was 4.24 ⁇ 0.82ng / ml. Tamiflu has been identified as a competitive inhibitor. As a result confirmed in Example 7, Compound 4, which is one of the compounds of the present invention, had a concentration of 6.42 ⁇ 0.43 ⁇ g / ml showing a 50% inhibition rate against swine influenza as a noncompetitive inhibitor.
  • the 50% inhibition rate of Tamiflu against swine influenza virus was measured as 10.51 ⁇ 0.64ng / ml as shown in FIG. 6 and FIG.
  • the activity of Tamiflu could be increased by about 3.71-fold, and about 9.22-fold by 0.46 ⁇ 0.42ng / ml for avian influenza virus.
  • Currently recommended treatment for the pandemic of swine flu or avian influenza is the situation in which Tamiflu alone, Tamiflu, amantadine (primarily rimantidine, rimantidine), and Jannavir are recommended, but the Amantadine family is highly toxic. Therefore, the combination therapy of the compound of the present invention and Tamiflu is an effective strategy for the treatment of resistant virus.
  • the mortality was examined 24 hours after administration, and both the control group and the experimental group administered the ethyl acetate active fraction containing the compounds of Crestocaryx opferractus 70% ethanol extract and compounds 1 to 14 at a concentration of 4.0 g / kg. Survived.
  • mice of the control group was administered only the test and solvent treated with 70% ethanol extract containing Compound 1 to Compound 14 to investigate the effects of each organ (tissue) of the animals intended for C57BL / 6J mice
  • GPT glutamate-pyruvate transferase
  • BUN Bood Urea Nitrogen
  • Example 1 According to the Invention 200 g of a 70% ethanol extract of Crestoscarix opercuratus or a compound isolated therefrom was mixed with 175.9 g lactose, 180 g potato starch and 32 g colloidal silicic acid. 10% gelatin solution was added to the mixture, which was then ground and passed through a 14 mesh sieve. It was dried and the mixture obtained by adding 160 g of potato starch, 50 g of talc and 5 g of magnesium stearate was made into a tablet.
  • Example 1 according to the invention 1 g of a 70% ethanol extract of Crestoscarix opercuratus or compound isolated therefrom, 0.6 g sodium chloride and 0.1 g ascorbic acid were dissolved in distilled water to make 100 ml. The solution was bottled and sterilized by heating at 20 ° C. for 30 minutes.
  • Crestocaryx opferractus 70% ethanol extract of Example 1 according to the present invention or 0.2 to 10% by weight of a compound isolated therefrom was prepared for health promotion cooking seasoning.
  • the Crestoscarix opercuratus 70% ethanol extract of Example 1 according to the present invention or a compound separated therefrom is added to the flour at 0.1 to 5.0% by weight, respectively, and the mixture is used to make bread, cakes and cookies. , Crackers and noodles were prepared to prepare foods for health promotion.
  • the Crestoscarix opercuratus 70% ethanol extract of Example 1 according to the present invention or a compound separated therefrom is added to the milk at 0.1 to 1.0% by weight, respectively, and the milk is used as butter and ice cream.
  • Various dairy products were made.
  • the health promotion fruit juice was prepared by adding 0.1 g of each of the Crestoscarix opercuratus 70% ethanol extract of Example 1 or the compound isolated therefrom to 1,000 ml of apple or grape juice.
  • the feed additive was prepared by mixing 10.0 g of each of the Crestoscarix opercuratus 70% ethanol extract of Example 1 or a compound isolated therefrom in 50.0 g of an excipient.
  • the compounding ratio may be arbitrarily modified, and the above components may be mixed and used in the manufacture according to a conventional feed composition manufacturing method.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Epidemiology (AREA)
  • Virology (AREA)
  • Medicines Containing Plant Substances (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)

Abstract

본 발명은 크레이스토카릭스 오페르쿠라투스 유래의 뉴라미니데이즈 효소(neuraminidase)를 저해하는 화합물 및 이를 유효성분으로 포함하는 조류 및 돼지 인플루엔자와 신종플루의 예방과 치료에 사용하는 조성물에 관한 것이다.

Description

크레이스토카릭스 오페르쿠라투스로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제
본 발명은 크레이스토카릭스 오페르쿠라투스(Cleistocalyx operculatus) 유래의 뉴라미니데이즈 효소(neuraminidase)를 저해하는 화합물 및 이를 유효성분으로 포함하는 조류 및 돼지 인플루엔자와 신종플루의 예방과 치료에 사용하는 조성물에 관한 것이다.
더욱 상세하게는 크레이스토카릭스 오페르쿠라투스를 에탄올 또는 메탄올로 추출 농축한 후 수용액에 포화시키고 에틸아세테이트로 분획한 분획 또는 이들 에틸아세테이트 분획으로부터 크로마토그래피를 이용하여 순수 분리 정제하여 얻은 하기 화학식 1로 표시되는 화합물 중 어느 하나를 포함하는 뉴라미니데이즈 저해 화합물과 이를 유효성분으로 함유하는 감기, 조류 및 돼지 인플루엔자, 신종플루 등과 같은 바이러스 뉴라미니데이즈 저해 관련 질환의 예방 및 치료용 조성물에 관한 것이다.
인플루엔자 바이러스는 '오르소믹소'과에 속하는 RNA 바이러스(Orthomyxovirus)로서 A, B, C형으로 분류된다. A형은 사람에게 주로 감염이 확인되며 B, C형에 비하여 돼지, 기타 포유류 및 다양한 야생조류에서 감염이 확인되고 있는 바이러스이다. 최근, 전 세계적으로 문제가 되고 있는 조류 인플루엔자(Avian influenza), 돼지 인플루엔자(Swine influenza) 및 신종플루(Novel flu) 등은 모두 A형 바이러스에 속한다.
인플루엔자 바이러스의 표면에는 헤마글루티닌(hemagglutinin, HA)과 뉴라미니데이즈(neuraminidase, NA)라는 두 가지 단백질이 존재하는데, 헤마글루티닌은 16종이 있고 뉴라미니데이즈는 9종이 있으므로 15×9=144 종류의 인플루엔자 바이러스가 발생할 수 있다. 조류에서의 인플루엔자 감염은 주로 H5형이나 H7형 및 H9형에 관련되며, 3종류의 헤마글루티닌(H1, H2, H3)과 2가지 형태의 뉴라미니데이즈(N1과 N2)만이 인간에서 인플루엔자 감염을 일으키므로 원칙적으로 인간은 조류인플루엔자에 감염되지 않았다. 그러나 최근에는 조류 인플루엔자 바이러스가 유전자 재조합 과정을 거치지 않고 직접 사람에게 전파된 예도 발생하고 있다.
조류 인플루엔자는 닭과 오리, 칠면조 등 가금류를 접촉하는 것 이외에도 야생조류와 우리나라에 온 철새들을 통해서 빠르게 전파된다. 조류 인플루엔자 바이러스는 조류 인플루엔자가 발생한 동남아로부터 주기적으로 유입되어 전파되며 특히 봄철 황사를 통해 중국으로부터도 전염이 가능하다. 세계적으로 문제가 되고 있는 동물의 바이러스 질환인 조류 인플루엔자는 국내에서 1996년 이후 발생해 530만 마리의 닭, 오리가 도살되는 등 1,500억 원 이상의 직접 피해가 발생하였으며, 아시아에서도 조류 인플루엔자를 통해 2억 마리 이상의 축산물이 도살되어 양계산업의 경제적 손실이 막대하다.
돼지 인플루엔자 바이러스(Swine influenza virus)는 1918년에 처음으로 보고되었으며 보통 돼지는 사람이 가지고 있는 인플루엔자 수용체(N-acetylneuraminic acid α2,6 galactose)와 조류들이 갖고 있는 인플루엔자 수용체(N-acetylneuraminic acid α2,3 galactose)를 동시에 가지고 있어 조류 인플루엔자 바이러스가 돼지의 몸 안에서 재조합(reassortment) 또는 적응(adaptation)을 통하여 사람에게 감염될 수 있도록 바이러스 혼합용기(mixing vessels)의 역할을 한다고 알려지고 있다.
2009년 멕시코에서 처음 발병하여 전 세계로 퍼지고 있는 신종플루(Novel flu)는 돼지 인플루엔자 바이러스인 H1N1이 돼지에게 감염되어 인간에게 전염이 가능한 질환으로 변이된 것으로 추정된다. 신종플루는 기본적으로 감기처럼 고열, 기침 등의 증상이 나타나는데 현재 상태보다 인간에게 치명적인 바이러스로 변할 가능성이 존재한다. 세계보건기구(WHO)가 집계하는 신종플루의 감염자 수는 2009년 10월 초까지 그 수가 34만 3200명에 달하였고, 사망자는 4000명에 달했었다. 신종플루의 일반적인 증상은 일반 독감과 구별하기가 매우 어렵다. 신종플루는 일반 독감과 비슷하게 발열, 인후통, 기침, 콧물 또는 코막힘의 증상을 보이고 있으며, 최근의 신종플루 관련 보고에 의하면 일반독감보다 심한 치명적인 폐 손상을 유발하는 특징을 보이고 있으므로 신종플루의 예방 및 치료는 매우 중요한 문제이다. 따라서 신종플루를 예방하기 위하여 백신의 확보가 필수적이다. 그러나, 예방적 차원의 백신 대책으로 매번 항원변이가 일어나는 RNA 바이러스를 모두 예방하는 백신을 만드는 것은 불가능에 가깝다. 따라서 조류 및 돼지 인플루엔자, 신종플루 또는 최악의 발병 가능성인 조류 인플루엔자와 신종플루가 섞인 새로운 병원체의 발생에 대비하기 위하여 이를 예방하고 치료할 수 있는 치료제의 개발은 필수적이다.
현재 조류 및 돼지 인플루엔자, 신종플루의 치료제는 바이러스 기원의 뉴라미니데이즈에 선택적인 저해물질로 개발된 경구용 치료제인 타미플루(oseltamivir phosphate)와 흡입형인 리렌자(zanamivir) 등이다. 경구용 치료제로서 많이 사용하고 있는 타미플루의 부작용으로는 오심, 구토, 신경계나 정신계의 이상이 보고되었으며, 일본의 경우 타미플루를 승인 후 확인된 소아환자의 사망예가 15건이 될 정도로 부작용을 갖고 있다. 또한, 경구용 치료제로 사용되고 있는 타미플루에 대한 내성 바이러스가 발병할 경우를 대비하여야 하는데, 이미 신종플루의 확산에 치명적인 타미플루에 대한 내성 바이러스의 출현이 보고되고 있으며, 타미플루 내성 바이러스의 인간 대 인간 전염조차도 발견되고 있는 실정이다. 따라서 조류 및 돼지 인플루엔자와 신종플루에 대한 바이러스 치료제의 개발은 인간의 보건안전에 필수적인 사항이다.
바이러스의 감염 및 증식과정을 살펴보면 바이러스는 세포에 감염 후 세포 내에서 새로운 바이러스를 만들고 다른 세포로 전파되기 위하여 세포 외부에 존재하는 시알릭산(siliac acid)을 바이러스가 만든 뉴라미니데이즈를 이용하여 절단하는 것이 필요하다. 타미플루 내성 조류 인플루엔자 바이러스는 보통 타미플루가 결합하는 타미플루의 수용체 단백질의 아미노산을 변화시키는 3개의 유전적 변이(Arg292Lys, Asn274Ser, His294Tyr)를 통해 발생하는 것으로 알려지고 있다. 3곳의 유전적 변이 중 타미플루 내성 조류 인플루엔자 바이러스의 변종으로 가장 많이 발현하는 294의 His가 Tyr으로 변화한 바이러스의 경우는 타미플루의 소수성 잔기(hydrophobic residue)가 타미플루 수용체에 결합하지 못하게 변이된 경우이다. 이는 미국과 유럽에서 2007~2008년 시즌에 10~25% 확률로 발견된 바이러스로서 향후의 신종플루에 대한 변이가능성에 대한 위험도를 증가시키고 있다. 따라서 이들 타미플루 내성 바이러스의 등장은 인간이 새로운 바이러스 치료제를 지속적으로 개발하여야 하는 당위성을 제공하고 있다.
본 발명에서는 조류 및 돼지 인플루엔자와 신종플루의 방어대책에 대한 시급성을 감안하여 효과가 확인되면 바로 적응이 가능한 식품 및 약용식물을 대상으로 하여 조류 및 돼지 인플루엔자와 신종플루에 대한 뉴라미니데이즈 저해물질을 탐색하였다. 일반적으로 새로운 성분의 약제를 개발하기 위해 기존 약제를 실험적으로 변형시키는 것보다는 전통 의학에서 사용되고 있는 천연물 약제들로부터 새로운 활성 성분을 찾는 것이 여러가지 면에서 장점이 많다. 특히 이러한 활성 성분들은 오랫동안 사용되어 왔기 때문에 약물들에 의한 독성 염려가 적다. 이러한 사실은 신종플루 치료제로서 사용되는 타미플루도 출발물질은 중국의 토착식물인 '스타아니스' 열매를 주원료로 개발한 것에서 확인할 수 있다.
본 발명의 대상인 크레이스토카릭스 오페르쿠라투스는 열대아시아로부터 호주의 북부지역까지 널리 분포되어 있는 6~12m 정도의 식물이다. 베트남이나 중국 서부 쪽에서 전통적으로 소화기 계통의 질환에 약재로 사용되는 식물인데, 크레이스토카릭스 오페르쿠라투스의 새싹은 누보이(nu voi)로 따로 불리며, 쇼크를 억제하거나 열을 내리는 데 주로 사용하였다(Loi, D.T. Medical Publishing House, Hanoi, Vietnam, 2001, 423~424). 크레이스토카릭스 오페르쿠라투스는 간 관련 질환이나 당뇨를 치료하는데도 효과적이라는 결과가 있으며(Lu, Y.H. et.al, Zhongguo Zhong Yao ZaZhi, 2003, 28, 964~966; Mai, T.T. et. al, Biosci. Biotechnol. Biochem. 2007, 71, 69~76), 항산화 또는 항염 작용을 하는 물질을 많이 포함하고 있다고 알려져 있다(Min, B.S. et. al, Chem. Pharm. Bull, 2008, 56, 1725~1728.; Dung, N.T. et.al, Food Chem. Toxicol. 2009, 47, 449~453). 또한 최근에는 크레이스토카릭스 오페르쿠라투스의 새싹의 에탄올 추출물이 항미생물 효과가 있다는 것이 밝혀진 바 있다(Dung, N.T. et. al. Food Chem. Toxicol, 2008, 46, 3632~3639.).
본 발명은 크레이스토카릭스 오페르쿠라투스의 유기용매 추출액으로부터 화합물을 순수 분리하고 이들 화합물 각각을 조류 및 돼지 인플루엔자 바이러스, 신종플루 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈(His294Tyr)에 대하여 이들의 활성을 비교하여 본 발명의 화합물이 조류 및 돼지 인플루엔자, 신종플루에 대한 저해활성이 있음을 확인하였다.
본 발명의 목적은 조류 및 돼지 인플루엔자 바이러스, 신종플루 및 타미플루 내성 신종플루의 뉴라미니데이즈를 저해하여 조류 인플루엔자와 신종플루 관련 질환에 예방과 치료 효과를 나타내는 크레이스토카릭스 오페르쿠라투스로부터 순수하게 분리 정제하여 얻은 화합물들을 각각 혹은 2개 이상 혼합하여 유효성분으로 함유하는 조성물을 제공함에 있다.
본 발명자들은 상기와 같은 점을 감안하여 각종 자생식물 및 한약재를 채집하여 조류 및 돼지 인플루엔자 바이러스의 배양액을 사용하거나 신종플루 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 클로닝한 후 이들을 세포 내로 도입하여 뉴라미니데이즈 효소에 대한 저해 작용을 조사하여 크레이스토카릭스 오페르쿠라투스(Cleistocalyx operculatus)를 후보식물로 선정하였다. 이 후, 크레이스토카릭스 오페르쿠라투스로부터 유기용매 알코올(메탄올, 에탄올, 프로판올 등) 또는 수용성 알코올에 의한 추출, 유기용매와 물의 분배, 칼럼크로마토그래피에 의한 방법, 식물체 성분의 분리 추출에 이용되는 공지의 방법 등을 단독 또는 적합하게 조합하여 용이하게 얻을 수가 있다. 조추출물은 필요에 따라서 상법에 따라서 더욱 정제할 수 있다.
본 발명은 바람직하게 크레이스토카릭스 오페르쿠라투스를 알코올로 추출한 후 크로마토그래피를 이용하여 순수 분리 정제하고 화학구조 및 물리화학적 특성규명을 통하여 구조를 확인한 다수의 화합물 중 하기 화학식 1로 표시되는 화합물이 바이러스 기원 뉴라미니데이즈, 타미플루 내성 뉴라미니데이즈의 저해 작용을 측정하는 방법으로 활성을 확인한 후 본 발명을 완성하였다.
화학식 1
Figure PCTKR2010007442-appb-C000001
본 발명은 상기한 화합물 중 적어도 하나의 화합물을 유효성분으로 포함하여 뉴라미니데이즈를 저해하여 조류 및 돼지 인플루엔자, 신종플루 관련 질환을 예방 또는 치료하는 것을 특징으로 한다.
상기 화합물은 크레이스토카릭스 오페르쿠라투스의 유기용매 추출액으로부터 화합물을 순수 분리 분리 정제하는 단계; 상기 단계에서 얻은 화합물의 화학구조 및 물리화학적 특성을 조사하는 단계; 신종플루 바이러스의 뉴라미니데이즈, 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈(His294Tyr)를 만드는 단계; 상기 화합물의 조류 인플루엔자 바이러스(H9N2)와 돼지 인플루엔자 바이러스(H1N1)의 뉴라미니데이즈 및 신종플루 바이러스와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대한 저해 작용을 측정하는 단계를 통하여 활성이 존재함을 알았다.
본 발명에 따른 조류 인플루엔자 바이러스(H9N2)와 돼지 인플루엔자 바이러스(H1N1)의 뉴라미니데이즈 및 신종플루 바이러스와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대한 저해 화합물은 크레이스토카릭스 오페르쿠라투스로부터 유기용매(알코올, 알코올수용액, 에틸아세테이트, 에테르, 아세톤, 클로로포름 등)에 의한 추출, 헥산과 물의 분배, 디아이온 HP-20 레진과 같은 흡착수지 사용방법, 칼럼 크로마토그래피에 의한 방법 등 식물체 성분의 분리 추출에 이용되는 공지의 방법을 단독 또는 적합하게 조합하여 용이하게 얻을 수가 있다. 조추출물은 필요에 따라서 상법에 따라서 더욱 정제할 수 있다.
조추출물은 필요에 따라서 상법에 따라서 더욱 정제할 수 있다. 본 발명에서 사용하는 크로마토그래피에는 실리카겔 칼럼 크로마토그래피(silica gel column chromatography), 엘에이취-20 칼럼 크로마토그래피(LH-20 column chromatography), 박층 크로마토그래피(TLC; thin layer chromatography) 및 고성능 액체 크로마토그래피(high performance liquid chromatography) 등이 이용될 수 있다.
본 발명에 따른 크레이스토카릭스 오페르쿠라투스 추출물 또는 이로부터 분리한 화합물은 안정도가 높아 식품, 의약품의 첨가제로 이용할 수 있다.
본 발명에 따른 추출물 또는 화합물을 포함하는 약학조성물은, 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다. 상기 추출물 또는 화합물을 포함하는 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다. 제제화 할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 추출물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로스 또는 락토오스, 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 마그네슘 스테아레이트, 탈크 같은 윤활제들도 사용된다. 경구를 위한 액상 제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조 제제, 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다.
상기 추출물 또는 화합물의 투여량은 치료 받을 대상의 연령, 성별, 체중과, 치료할 특정 질환 또는 병리 상태, 질환 또는 병리 상태의 심각도, 투여경로 및 처방자의 판단에 따라 달라질 것이다. 이러한 인자에 기초한 투여량 결정은 당업자의 수준 내에 있으며, 일반적으로 투여량은 0.01㎎/㎏/일 내지 대략 2000㎎/㎏/일의 범위이다. 더 바람직한 투여량은 0.1㎎/㎏/일 내지 500㎎/㎏/일이다. 투여는 하루에 한번 투여할 수도 있고, 수회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다. 본 발명의 추출물 또는 화합물은 쥐, 가축, 인간 등의 포유동물에 다양한 경로로 투여될 수 있다. 투여의 모든 방식은 예상될 수 있는데, 예를 들면, 경구, 직장 또는 정맥, 근육, 피하, 자궁내 경막 또는 뇌혈관내 주사에 의해 투여될 수 있다. 본 발명의 추출물 또는 화합물은 독성 및 부작용은 거의 없으므로 예방 목적으로 장기간 복용시에도 안심하고 사용할 수 있는 약제이다.
또한, 본 발명은 상기 크레이스토카릭스 오페르쿠라투스 추출물 및 식품학적으로 허용 가능한 식품보조 첨가제를 포함하는 조류 및 돼지 인플루엔자와 신종플루 예방을 위한 건강기능식품을 제공한다. 본 발명의 건강기능식품은 정제, 캡슐제, 환제 또는 액제 등의 형태를 포함하며, 본 발명의 추출물을 첨가할 수 있는 식품으로는, 예를 들어, 상기 건강기능식품은 드링크제, 육류, 소세지, 빵, 캔디류, 스넥류, 면류, 아이스크림을 포함한 낙농제품, 스프, 이온음료 등을 포함한 음료수, 알코올 음료 및 비타민 복합제를 포함한 영양 공급용 제품 등이 있다. 상세하게는, 본 발명은 크레이스토카릭스 오페르쿠라투스 추출물 및 식품학적으로 허용 가능한 식품보조 첨가제를 포함하는 신종플루 관련 질환의 예방과 치료용 건강 기능 식품을 제공한다.
본 발명은 상기 크레이스토카릭스 오페르쿠라투스 추출물 및 크레이스토카릭스 오페르쿠라투스 유래 화합물을 포함하는 동물질병의 예방 및 치료할 목적으로 사료첨가제 및 치료물질로 사용 가능하다. 본 발명의 사료첨가제 및 치료물질은 동물과 인간에게서 공통적으로 발병하는 뉴라미니데이즈 관련 인수공통성 질환인 세균 감염에 의한 감염성 장염 등에도 사용가능하며, 특히 신종플루, 조류 및 돼지 인플루엔자와 관련한 질환의 예방과 치료용 동물사료 첨가제, 동물약품을 제공한다.
본 발명에 따른 크레이스토카릭스 오페르쿠라투스 추출물과 크레이스토카릭스 오페르쿠라투스 유래 화합물은 조류 및 돼지 인플루엔자 바이러스 또는 신종플루 바이러스 기원 뉴라미니데이즈 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 비경쟁적으로 저해하는 치료효과를 가지며 타미플루에 내성을 갖는 타미플루 내성 신종플루 바이러스에도 동일하게 뉴라미니데이즈를 저해할 수 있었다.
더욱이, 타미플루와 본 발명의 화합물을 조류 인플루엔자(H9N2), 돼지 인플루엔자(H1N1) 바이러스에 병용처리하였을 경우 타미플루의 사용량을 줄일 수 있었다. 즉, 화합물 4번 없이 타미플루를 조류 인플루엔자(H9N2)와 돼지 인플루엔자(H1N1) 바이러스에 대하여 단독 처리시 4.24±0.82ng/㎖과 39.04±1.03ng/㎖에서 50% 바이러스를 저해하였으나 화합물 4를 1㎍/㎖의 농도로 타미플루와 병용처리시 0.46±0.42ng/㎖과 10.51±0.64ng/㎖로 조류 인플루엔자(H9N2)의 경우 10배 정도의 타미플루에 대한 상승효과를 보여 주었고, 돼지 인플루엔자(H1N1) 바이러스의 경우 4배 정도 타미플루에 대한 상승효과를 보여 주었다.
이로써 본 발명에 따른 크레이스토카릭스 오페르쿠라투스 추출물과 이로부터 분리된 화합물은 조류 인플루엔자 바이러스와 돼지인플루엔자 바이러스, 신종플루 바이러스 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 저해하여 조류 인플루엔자와 신종플루 관련 질환의 예방과 치료의 효과를 기대할 수 있다. 또한 세포 독성이 적어 의약품, 화장품, 건강식품, 동물사료, 동물약품 등에 매우 유용하게 사용 및 응용될 수 있다.
도 1은 크레이스토카릭스 오페르쿠라투스로부터 분리한 화합물을 분리하여 구조를 확인한 후, HPLC 상에서 나타나는 피크와 화합물을 도시한 HPLC 분석 스펙트럼을 나타낸 것이다.
도 2는 크레이스토카릭스 오페르쿠라투스로부터 분리한 화합물 중 강한 저해활성을 보여주는 화합물 4가 비경쟁적 저해제임을 나타내는 Lineweaver Burk plots 그림이다.
도 3은 크레이스토카릭스 오페르쿠라투스로부터 분리한 화합물 중 강한 저해활성을 보여주는 화합물 5가 비경쟁적 저해제임을 나타내는 Lineweaver Burk plots 그림이다.
도 4는 크레이스토카릭스 오페르쿠라투스로부터 분리한 화합물 중 강한 저해활성을 보여주는 화합물 8이 비경쟁적 저해제임을 나타내는 Lineweaver Burk plots 그림이다.
도 5는 크레이스토카릭스 오페르쿠라투스로부터 분리한 화합물 중 강한 저해활성을 보여주는 화합물 14가 비경쟁적 저해제임을 나타내는 Lineweaver Burk plots 그림이다.
도 6은 화합물 4(1㎍/㎖)와 병행한 타미플루 농도(ng/㎖)에 따른 돼지 인플루엔자 바이러스의 뉴라미니데이즈 활성 저해율을 나타낸 것이다.
도 7은 화합물 4(1㎍/㎖)와 병행한 타미플루 농도(ng/㎖)에 따른 조류 인플루엔자 바이러스의 뉴라미니데이즈 활성 저해율을 나타낸 것이다.
이하 본 발명의 바람직한 실시예를 상세히 설명하기로 한다. 그러나, 본 발명은 여기서 설명되는 실시예에 한정되지 않고 다른 형태로 구체화될 수도 있다. 오히려, 여기서 소개되는 내용이 철저하고 완전해질 수 있도록 그리고 당업자에게 본 발명의 사상이 충분히 전달될 수 있도록 하기 위해 제공되는 것이다.
<실시예 1 : 크레이스토카릭스 오페르쿠라투스로부터 활성 화합물의 용매 추출조건의 검토>
크레이스토카릭스 오페르쿠라투스로부터 활성물질의 용매 추출정도를 비교하기 위하여, 증류수, 30 내지 100% 에탄올 수용액, 메탄올, 아세톤, 에틸아세테이트, 클로로포름의 용매를 사용하여 활성성분의 추출정도를 비교하기 위하여 건조된 크레이스토카릭스 오페르쿠라투스 새싹 100g에 대해 상기 해당용매 500㎖을 사용하여 2시간 동안 3회에 걸쳐 초음파 추출한 후 추출액을 감압 농축하였다. 추출된 추출물질의 양을 비교한 결과, 4.2g(아세톤)부터 15.7g(증류수)의 추출량을 보여 주었다. 이 후 이들 추출물의 뉴라미니데이즈에 대한 활성정도를 비교하기 위하여 각각의 추출물을 최종농도 20㎍/㎖의 농도로 하여 실시예 4-2의 바이러스 배양액과 실시예 6의 방법으로 각각 추출물의 활성정도를 측정하였다. 표 1에서 보여준 결과에서 볼 수 있는 바와 같이, 추출물은 50~100% 에탄올, 메탄올 추출액에서 활성이 좋았으나, 인체에게 허용되는 추출용매 및 각 용매조건에서 추출된 양과 활성정도를 비교하여 70% 에탄올 추출물을 최적 추출조건으로 설정하였다.
표 1
Figure PCTKR2010007442-appb-T000001
<실시예 2 : 크레이스토카릭스 오페르쿠라투스로부터 용매 추출물과 화합물의 분리>
건조된 크레이스토카릭스 오페르쿠라투스 1.5㎏을 70% 에탄올 10ℓ를 사용하여 4시간 동안 3회 걸쳐 초음파 추출하였다. 상기 70% 에탄올 추출물(이하, 'A 분획'이라 칭함)을 감압 농축한 후 이 추출물 170g을 물(2ℓ)로 현탁한 후 n-헥산(2ℓ) 추출물(이하, 'B 분획'이라 칭함), 에틸 아세테이트(2ℓ) 추출물(이하, 'C 분획'이라 칭함), 부탄올(2ℓ) 추출물(이하, 'D 분획'이라 칭함)로 순차적으로 용매 분획한 다음 각각의 용매 분획의 감압농축물에 대하여 조류 인플루엔자 바이러스, 돼지 인플루엔자 바이러스 뉴라미니데이즈 활성을 측정한 결과, 에틸아세테이트 분획에서 강한 활성을 나타내었다.
에틸아세테이트 분획 75g을 헥산-아세톤 4:1 → 0:1의 용매 구배 조건으로 실리카겔 컬럼크로마토그래피를 실시하여 9개의 분획을 얻었다(fr.1~9). 이 분획들 중 강한 활성을 나타내는 분획 3(2.5g)을 세파덱스 LH-20(Sephadex LH-20) 레진에 로딩한 후 메탄올로 용출하여 화합물 5(2',4'-dihydroxy-6'-methoxy-3',5'-dimethylchalcone) 750mg을 얻을 수 있었다. 분획 4(4.2g)를 MeOH-H2O 혼합용매로 사용하여 2:1부터 10:1까지 순차적으로 증가시키는 조건을 사용하여 역상(RP-18) 컬럼크로마토그래피를 실시하여 다시 5개의 소분획을 얻었다(fr.4.1-4.5). 소분획 F4.2(160mg)를 MeOH-H2O(0-65min: 63% MeOH, 65-70min : 100% MeOH, 70-80min : 100% MeOH)을 사용하여 HPLC[YMC Pak C18 column 10×250mm; 10μm 입자 크기 2㎖/min; UV detection: 205-254nm]를 실시하여 화합물 1(7-hydroxy-5-methoxy-6,8-dimethylisoflavone, t R=45.0min, 3.5㎎), 화합물 6(5-hydroxy-7-methoxy-6,8-dimethylflavanone, t R=49.0min, 13.5㎎), 화합물 7(7-hydroxy-5-methoxy-6,8-dimethylflavone, t R=63.0min, 4.5mg)을 얻었다. 소분획 F4.3(220mg)을 MeOH-H2O (0-55min: 65% MeOH, 60min: 100% MeOH)을 사용하여 소분획 F3.2를 분리한 동일조건의 HPLC를 실시하여 화합물 8(2',4'-dihydroxy-3'-methyl-6'-methoxychalcone, t R=31.0min, 19.5mg), 화합물 9(6-formyl-8-methyl-7-O-methylpinocembrin, t R=45.0min, 9.5mg)와 화합물 10[(2S)-8-formyl-5-hydroxy-7-methoxy-6-methylflavanone, t R=48.0min, 14.0mg]을 얻었다.
분획물 F5는 세파덱스 LH-20(Sephadex LH-20) 레진에 로딩한 후 메탄올로 용출하여 4개의 소분획을 얻었다(fr.5.1-5.5). 소분획 F5.3은 다시 MeOH-H2O 혼합용매로 사용하여 1:1부터 10:1까지 순차적으로 증가시키는 조건을 사용하여 역상(RP-18) 컬럼크로마토그래피를 실시하여 5개로 분획되었다.(F5.3.1F5.3.5) 소분획 F5.3.2(150mg)는 MeOH-H2O(0-45min: 58% MeOH, 50min: 100% MeOH)을 사용하여 HPLC[YMC Pak C18 column 20×150mm; 4μm 입자 크기 3㎖/min; UV detection: 254nm]를 실시하여 화합물 2(5,7-dihydroxy-6,8 -dimethyldihydroflavonol, t R=28.0min, 4.5mg)와 화합물 11(7-hydroxy-5 -methoxy-8-methylflavanone, t R=40.0min, 14mg)을 분리하였다.
소분획 F5.3.3(170mg)에서도 MeOH-H2O(0-65min: 62% MeOH, 70min: 100% MeOH)을 사용하여 HPLC [YMC Pak C18 column 20×150mm; 4μm 입자 크기 3㎖/min; UV detection: 254nm]를 실시하여 화합물 3(2,7-dihydroxy-5 -methoxy-6,8-dimethylflavanone, t R=33.0min, 3.0mg), 화합물 12(8- methylpinocembrin, t R=42.0min, 8.5mg), 화합물 13(5,7-dihydroxy-6,8 -dimethylflavanone, t R=56.0min, 15.5mg)가 분리되었다.
마지막으로, 소분획 F5.3.4(110mg)에서 MeOH-H2O(0-45min: 65% MeOH, 50min: 100% MeOH)을 사용하여 HPLC [YMC Pak C18 column 20×150mm; 4μm 입자 크기 3㎖/min; UV detection: 254nm]를 실시하여 화합물 4(4,2',4'-trihydroxy-6'-methoxy-3',5'-dimethylchalcone, t R=29.0min, 6.5mg)와 화합물 14(2,2',4'-trihydroxy-6'-methoxy-3',5'-dimethylchalcone, t R=37.5min, 9.5mg)가 분리되었다.
상기 화합물들의 뉴라미니데이즈 활성은 실시예 6과 실시예 7의 방법으로 확인하였고, 표 2 및 표 3에 결과를 나타내었다.
<실시예 3 : 크레이스토카릭스 오페르쿠라투스 유래 화합물의 물리 화학적 특성 및 화학구조 분석>
상기 실시예 2에서 크레이스토카릭스 오페르쿠라투스로부터 분리된 화합물의 구조를 분석하였다. 화합물의 화학적 구조를 ESI 질량분석기(Electrospray Ionization mass spectrometer)을 사용하여 얻은 분자량 및 핵자기 공명 분석의 1H 및 13C-NMR 분석 결과를 토대로 화합물의 구조를 분석하였다.
그 결과, 구조 결정된 화합물은 상기 화학식 1에서 보여준 구조를 가졌으며, 분리된 화합물의 화학적 특성 및 1H, 13C-NMR 결과값을 정리하여 하기에 표시하였다.
화합물 1(7-Hydroxy-5-methoxy-6,8-dimethylisoflavone): yellow amorphous powder; UV(MeOH) λmax nm(log ε): 255(4.32), 298(3.79); IR(KBr) ν max 3386(OH), 2926, 1637(C=O), 1591, 1447, 1230, 1136 cm-1; EIMS m/z (rel.int.): 296[M]+, 100, 295(31), 281(89), 278(57), 265(22), 250(17), 195(18), 77(19); HREIMS m/z 296.1047 [M]+(calcd for C18H16O4, 296.1049); 1H-NMR (CD3COCD3, 500 MHz) δ 7.88(1H, s, H-2), 7.51(2H, d, J = 8.4 Hz, H-2', H-6'), 7.34(3H, m, H-3', H-4', H-5'), 3.81(3H, s, 5-OCH3), 2.28(3H, s, 8-CH3), 2.23(3H, s, 6-CH3); 13C-NMR (CD3COCD3, 125 MHz) δ 175.4(C=O), 156.7(C-7), 156.3(C-5), 154.9(C-9), 151.0(C-2), 132.2(C-1'), 129.2(C-2, C-6), 128.4(C-3', C-5'), 127.9(C-4'), 125.7(C-3), 115.5(C-6), 113.1(C-10), 106.9(C-8), 61.7(5-OCH3), 8.2(6-CH3), 8.1(8-CH3).
화합물 2(5,7-Dihydroxy-6,8-dimethyldihydroflavonol): brown amorphous powder; [α] -24.0°(c 0.08, MeOH); UV(MeOH) λmax nm(log ε): 297(4.45), 340(3.84); IR(KBr) ν max 3423(OH), 2927, 1639(C=O), 1469, 1282, 1123 cm-1; EIMS m/z(rel.int.): 300[M]+,67, 271(14), 181(100), 152(49), 77(10); HREIMS m/z 300.0999 [M]+(calcd for C17H16O5, 300.0998); 1H-NMR(CD3COCD3, 500 MHz) δ 7.56(2H, d, J = 8.0 Hz, H-2', H-6'), 7.41(3H, m, H-3', H-4', H-5'), 5.04(1H, d, J = 11.0 Hz, H-2), 4.51(1H, d, J = 11.0 Hz, H-3), 2.02(3H, s, 8-CH3), 1.97(3H, s, 6-CH3); 13C-NMR(CD3COCD3, 125 MHz) δ 198.9(C=O), 164.7(C-7), 160.3(C-9), 158.9(C-5), 139.1(C-2), 129.9(C-4'), 129.6(C-3', C-5'), 129.0(C-2', C-6'), 105.5(C-8), 104.5(C-6), 101.8(C-10), 85.0(C-2), 74.1(C-3), 8.1(8-CH3), 7.6(6-CH3).
화합물 3(2,7-Dihydroxy-5-methoxy-6,8-dimethylflavanone): brown amorphous powder; UV(MeOH) λmax nm(log ε): 294(4.47), 338(3.87); IR(KBr) ν max 3391(OH), 2926, 1681(C=O), 1621, 1410, 1338, 1114 cm-1; EIMS m/z(rel.int.); 314[M]+, 24, 223(77), 195(100), 152(17), 77(8); HREIMS m/z 314.1152 [M]+(calcd for C18H18O5, 314.1154); 1H-NMR(CD3COCD3, 500 MHz) δ 7.29(2H, d, J = 8.0 Hz, H-2', H-6'), 7.25(2H, m, H-3', H-5'), 7.23(1H, m, H-4'), 3.97(3H, s, 5-OCH3), 3.24(1H, d, J = 13.5 Hz, H-3eq), 3.16(1H, d, J = 13.5 Hz, H-3ax), 2.09(3H, s, 8-CH3), 2.03(3H, s, 6-CH3); 13C-NMR(CD3COCD3, 125 MHz) δ 193.7(C=O), 167.9(C-9), 162.3(C-7), 155.2(C-5), 132.9(C-1'), 130.6(C-2', C-6'), 128.3(C-3', C-5'), 127.4(C-4'), 109.3(C-6), 104.8(C-10), 103.8(C-2), 101.6(C-8), 61.7(5-OCH3), 42.0(C-3), 7.9(8-CH3), 7.2(6-CH3).
화합물 4(4,2',4'-Trihydroxy-6'-methoxy-3',5'-dimethylchalcone): yellow amorphous powder; UV(MeOH) λmax nm(log ε): 298(3.91), 362(4.47); IR(KBr) ν max 3385(OH), 2931, 1605(C=O), 1545, 1437, 1229, 1164 cm1; 314[M]+, 78, 313(18), 221(10), 194(100), 166(19), 136(20); HREIMS m/z 314.1156 [M]+(calcd for C18H18O5, 314.1154); 1H-NMR(CD3COCD3, 500 MHz) δ 13.96(1H, s, 2'-OH), 7.92(1H, d, J = 15.5 Hz, H-α), 7.82(1H, d, J = 15.5 Hz, H-β), 7.65(2H, d, J = 8.5 Hz, H-2, H-6), 6.94(2H, d, J = 8.5 Hz, H-3, H-5), 3.69(3H, s, 6'-OCH3), 2.15(3H, s, 5'-CH3), 2.09(3H, s, 3'-CH3); 13C-NMR(CD3COCD3, 125 MHz) δ 193.8(C=O), 162.7(C-2'), 161.4(C-4'), 160.7(C-4), 159.8(C-6'), 144.3(C-β), 131.4(C-2, C-6), 128.1(C-1), 124.4(C-α), 116.9(C-3, C-5), 110.6(C-5'), 109.2(C-1'), 107.9(C-3'), 62.6(6'-OCH3), 9.0(5'-CH3), 8.3(3'-CH3).
화합물 5(2',4'-Dihydroxy-6'-methoxy-3',5'-dimethylchalcone): orange needles; UV(MeOH) λmax: 205, 340 nm; EI-MS m/z 298 [M]+, 221, 206, 194, 166, 131, 103, 91, 77; 1H-NMR(CD3COCD3, 500 MHz) δ 13.82(1H, s, 2'-OH), 8.05(1H, d, J = 16.0 Hz, H-β), 7.82(1H, d, J = 16.0 Hz, H-α), 7.73(2H, d, J = 8.0 Hz, H-2, H-6), 7.45(3H, m, H-3, H-4, H-5), 3.68(3H, s, 6'-OCH3), 2.16(3H, s, 5'-CH3), 2.11(3H, s, 3'-CH3); 13C-NMR(CD3COCD3, 125 MHz) δ 193.9(C=O), 162.8(C-2'), 161.8(C-4'), 159.9(C-6'), 143.4(C-β), 136.4(C-1), 131.2(C-4), 129.9(C-3, C-5), 127.8(C-α, C-2, C-6), 110.7(C-1'), 109.2(C-5'), 107.9(C-3'), 62.4(6'-OCH3), 9.0(5'-CH3), 8.3(3'-CH3).
화합물 7(7-Hydroxy-5-methoxy-6,8-dimethylfavanone): yellow powder 1H-NMR(CDCl3, 500 MHz) δ 7.90(2H, m, H-2', H-6'), 7.52(3H, m, H-3', H-4', H-5'), 6.71(1H, s, H-3), 3.87 (3H, s, 5-OCH3), 2.44(3H, s, 8-CH3), 2.26(3H, s, 6-CH3); 13C-NMR(CDCl3, 125 MHz) δ 177.8(C=O), 160.9(C-2), 156.9(C-7), 155.8(C-5), 154.9(C-9), 131.9(C-1'), 131.2(C-4'), 129.0(C-3', C-5'), 126.0(C-2', C-6'), 115.3(C-6), 112.3(C-10), 108.2(C-3), 107.2(C-8), 61.8(5-OCH3), 8.6(8-CH3), 8.3(6-CH3).
화합물 8(2',4'-Dihydroxy-3'-methyl-6'-methoxychalcone): yellow oil; UV (MeOH) λmax: 310, 348 nm; EI-MS m/z 284 [M]+, 207, 181, 122, 77; 1H-NMR(CD3OD, 500 MHz) δ 8.01(1H, d, J = 15.5 Hz, H-β), 7.78(1H, d, J = 15.5 Hz, H-α), 7.67(2H, d, J = 8.5 Hz, H-2, H-6), 7.42(3H, m, H-3, H-4, H-5), 6.17(1H, s, H-5'), 3.68(3H, s, 6'-OCH3), 2.08(3H, s, 3'-CH3); 13C-NMR(CD3OD, 125 MHz) δ 194.4(C=O), 165.4(C-4'), 165.3(C-2'), 162.8(C-6'), 143.9(C-β), 136.9(C-1), 131.5(C-4), 130.2(C-2, C-6), 129.5(C-3, C-5), 128.0(C-α), 112.3(C-1'), 109.7(C-3'), 99.0(C-5'), 62.7(6'-OCH3), 8.6(3'-CH3).
화합물 9(6-Formyl-8-methyl-7-O-methylpinocembrin): orange needles; UV (MeOH) λmax: 258, 345 nm; EI-MS m/z 312 [M]+, 297, 284, 235, 208, 207, 180, 152, 104, 77; 1H-NMR(CDCl3, 500 MHz) δ 10.23(1H, s, 6-CHO), 7.45(2H, m, H-2', H-6'), 7.42(3H, m, H-3', H-4', H-5'), 5.54(1H, dd, J = 12.5, 2.5 Hz, H-2), 3.91(3H, s, 7-OCH3), 3.07(1H, dd, J = 17.0, 12.5 Hz, H-3), 2.88(1H, dd, J = 17.0, 2.5 Hz, H-3), 2.09(3H, s, 8-CH3); 13C-NMR (CDCl3, 125 MHz) δ 192.7(6-CHO), 187.4(C=O), 167.9(C-5), 166.3(C-7), 165.1(C-9), 137.7(C-1'), 129.1(C-4'), 128.9(C-3', C-5'), 126.0(C-2', C-6'), 114.0(C-8), 107.5(6-CHO), 106.6(C-10), 79.9(C-2), 61.8(7-OCH3), 44.9(C-3), 7.1 (8-CH3).
화합물 10[(2S)-8-Formyl-5-hydroxy-7-methoxy-6-methylflavanone]: yellow needles; UV(MeOH) λmax: 267, 335 nm; EI-MS m/z 312 [M]+, 311, 235, 208, 180, 104; 1H-NMR(CDCl3, 500 MHz) δ 12.67(1H, s, 5-OH), 10.21(1H, s, 8-CHO), 7.46(2H, m, H-2', H-6'), 7.40(3H, m, H-3', H-4', H-5'), 5.52(1H, dd, J = 12.5, 2.5 Hz, H-2), 4.03(3H, s, 7-OCH3), 3.01(1H, dd, J = 17.0, 12.5 Hz, H-3), 2.90(1H, dd, J = 17.0, 2.5 Hz, H-3), 2.09(1H, s, 6-CH3); 13C-NMR(CDCl3, 125 MHz) δ 193.9(8-CHO), 188.4(C=O), 166.3(C-9), 166.0(C-7), 165.5(C-5), 138.1(C-1'), 128.9(C-4'), 128.8(C-3', C-5'), 125.8(C-2', C-6'), 110.0(C-8), 109.3(C-6), 107.6(C-10), 78.7(C-2), 64.6(7-OCH3), 45.2(C-3), 7.3(6-CH3).
화합물 13(5,7-Dihydroxy-6,8-dimethylfavanone): yellow oil; UV(MeOH) λmax: 297, 344 nm; EI-MS m/z 284[M]+, 266, 207, 180, 152; 1H-NMR(CD3COCD3, 500 MHz) δ 12.50(2H, s, 5-OH, 5-OH), 7.67(2H, d, J = 8.0 Hz, H-2', H-6'), 7.54(3H, m, H-3', H-4', H-5'), 5.62(1H, dd, J = 12.5, 2.5 Hz, H-2), 3.19(1H, dd, J = 17.0, 12.5 Hz, H-3), 2.93(1H, dd, J = 17.0, 2.5 Hz, H-3), 2.15(3H, s, 8-CH3), 2.13(3H, s, 6-CH3); 13C-NMR(CD3COCD3, 125 MHz) δ 197.4(C=O), 163.1(C-7), 160.1(C-5), 158.6(C-9), 140.1(C-1'), 129.6(C-3', C-5'), 129.3(C-4'), 127.1(C-2', C-6'), 104.5(C-8), 103.5(C-6), 103.2(C-10), 79.6(C-2), 43.7(C-3), 8.3(8-CH3), 7.6(6-CH3).
화합물 14(2,2',4'-Trihydroxy-6'-methoxy-3',5'-dimethylchalcone): orange powder; UV(MeOH) λmax: 300, 366 nm; 1H-NMR(CD3COCD3, 500 MHz) δ 8.20(1H, d, J = 16.0 Hz, H-β), 8.15(1H, d, J = 16.0 Hz, H-α), 7.67(1H, d, J = 8.0 Hz, H-6), 7.27(1H, m, H-4), 6.97(1H, m, H-5), 6.92(1H, m, H-3), 3.09(3H, s, 6'-OCH3), 2.14(3H, s, H-5'), 2.08(3H, s, H-3'); 13C-NMR(CD3COCD3, 125 MHz) δ 194.2(C=O), 163.2(C-2'), 159.8(C-4'), 158.7(C-6'), 157.8(C-2), 139.4(C-β), 132.4(C-4), 129.6(C-6), 127.1(C-α), 123.2(C-1), 120.9(C-5), 117.1(C-3), 110.5(C-1'), 109.1 (C-5'), 107.8(C-3'), 62.6(6'-OCH3), 8.9(5'-CH3), 8.2(3'-CH3).
<실시예 4 : 인플루엔자 바이러스의 준비>
4-1. 조류 인플루엔자(H9N2) 바이러스
실험에 사용한 조류 인플루엔자 바이러스는 저병원성 조류 인플루엔자 바이러스인 A/chicken/Korea/01310/2001(H9N2)를 사용하였다. 이것을 10일령의 SPF(Specific-Pathogen Free) 수정란의 요막강(Allantoic Cavity)에 접종하고 2일 후 채독하여 바이러스를 신장 세포에 속하는 MDCK(Madin-Darby canine kidney)에 접종하여 5일간 배양하여 원심분리 후 상등액층의 배양액을 H9N2 기원의 바이러스 뉴라미니데이즈의 활성 측정에 사용하였다.
4-2. 돼지인플루엔자(H1N1) 바이러스
실험에 사용한 돼지 인플루엔자 바이러스는 중앙백신연구소의 돼지 인플루엔자 바이러스인 A/Sw/Kor/CAN1/04(H1N1, KCTC 11165BP)를 사용하였다. 이 바이러스를 10일령의 Specific-Pathogen Free(SPF) Egg 요막강(Allantoic Cavity)에 접종하고 2일 후 채독하여 씨드 바이러스(seed virus)를 증식시켰다. 이후 배양된 씨드 바이러스를 SPF 달걀의 요막강에 재접종하여 바이러스 배양액을 얻은 후 H1N1 기원의 바이러스 뉴라미니데이즈의 활성 측정에 사용하였다.
<실시예 5 : 뉴라미니데이즈 클로닝>
신종플루 바이러스는 전염성이 강하고 감염될 경우에는 질환으로 사망할 가능성이 높기 때문에 일차적으로 신종플루 바이러스 자체를 이용하여 효과가 있는 활성물질을 검색하고 확인하기보다는 신약의 표적이 되는 신종플루 바이러스의 뉴라미니데이즈만을 동물 세포주에서 발현시켜서 신약 후보 물질의 활성을 검증하는 방법을 사용하였다. 신종플루 바이러스의 뉴라미니데이즈 유전자서열을 NCBI의 유전자은행으로부터 확인하여 신종플루 바이러스의 뉴라미니데이즈를 클로닝(cloning)하였으며, 타미플루에 내성을 가지는 신종플루 바이러스의 뉴라미니데이즈 점 돌연변이체를 인위적으로 제작하여 천연물의 활성 탐색에 사용하였다. 이하 클로닝에 사용된 각 염기서열은 다음과 같다.
* 사용된 신종플루 뉴라미니데이즈 펩타이드 서열 *
5-1. 신종플루(H1N1) 바이러스의 뉴라미니데이즈 펩타이드 서열
MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
5-2. 타미플루에 내성을 가지는 신종플루 바이러스의 뉴라미니데이즈 펩타이드
밑줄 처진 부분이 점돌연변이에 의해서 바뀌는 부분임 (H → Y)
MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNY Y YEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
상기의 서열로 각각의 유전자를 클로닝 한 후 신종플루 바이러스의 뉴라미니데이즈에 해당하는 유전자를 PCR 증폭 방법을 이용하였고, 증폭된 산물은 인비트로젠(Invitrogen)사의 pcDNA3.1/V5-His Topo 벡터에 클로닝하였다. 클로닝의 확인은 제한효소 절단(restriction enzyme cutting)을 통해서 일차적으로 확인하고, 염기서열 분석법(DNA sequencing)을 통해서 최종 확인하였다. 또한, 타미플루에 내성을 가지는 뉴라미니데이즈를 문헌조사를 통해 중간의 히스티딘(Histidine) 아미노산을 티로신(Tyrosine)으로 치환함으로써 획득하였다. 사용한 방법은 PCR을 이용하는 퀵체인지(Quick change)방법을 이용하였다. 이 방법은 치환하려고 하는 부분에 해당하는 올리고뉴클레오티드(oligonucleotide)를 제작한 후, PCR 효소를 사용하여 플라스미드를 시험관 내에서 증폭시켰으며, 기존의 염기서열을 가진 플라스미드를 제거하기 위해서 메틸레이션(methylation)되어 있는 플라스미드만 절단하는 DpnI 효소를 처리하였다. 돌연변이가 일어난 플라스미드는 박테리아에서 증폭하였으며, 염기서열 분석법(DNA sequencing)을 통해서 아미노산 치환을 최종 확인하여 실험에 사용하였다.
<실시예 6 : 뉴라미니데이즈의 활성 측정>
뉴라미니데이즈 활성은 정확한 저해율을 측정하기 위하여 메이어(Myers) 등이 고안한 방법을 변경하여 사용하였다. 각각의 뉴라미니데이즈가 포함된 샘플에 0.04 M sodium acetate 완충액(pH 5.0) 20㎕와 0.04mM 4-methylumbelliferyl-α-D-N-acetylneuraminic acid(Sigma M8639) 80㎕를 혼합하여 10분간 반응시킨 후 0.1M glycine-NaOH 완충액 100㎕을 첨가하여 반응을 중지시킨 후 형광광도계를 이용하여 360nm/440nm에서의 형광차이를 이용하여 활성을 측정하였다. 이 때 타미플루, 화합물이나 각각의 용매 및 분획 추출물은 세포에 미리 처리하거나 바이러스를 배양할 때 같이 투여되어 활성억제가 되도록 하였다(화합물을 샘플에 직접 처리하려면 상기 형광 반응에 1㎕의 화합물을 넣으면 된다). 또한, 시료의 발광도를 보정하기 위하여 측정 발광도를 A, 시료를 녹인 용매의 발광도를 C, 시료 혼합액의 발광도를 B로 하여 저해율을 계산하였다.
저해율 : {C-(A-B)/C}×100
화합물의 Kinetic 연구를 위하여 4-methoxyumbelliferone의 농도를 반응을 중지시키기 위하여 넣는 0.1M glycine-NaOH buffer를 첨가하기 전에 측정되었으며, Sigmaplot 11.0(SPCC Inc., Chicago, IL)에서 계산하였다. 또한 효소의 가역반응을 측정하기 위하여, 효소와 저해물질이 들어간 반응액을 희석하는 방법을 사용하여 측정하였다.
<실시예 7 : 바이러스 배양액을 이용한 뉴라미니데이즈의 활성 측정>
바이러스 기원의 뉴라미니데이즈 활성을 측정하기 위하여 조류 인플루엔자 바이러스(H9N2)와 돼지 인플루엔자 바이러스(H1N1)에서 유래한 바이러스 배양액으로부터 뉴라미니데이즈 활성을 측정하는 방법을 사용하였다.
바이러스 배양액을 이용한 뉴라미니데이즈의 활성은 실시예 4-1 및 실시예 4-2의 바이러스 배양액을 이용하여 실시예 6의 방법으로 측정하였고 에탄올 추출물의 각 분획 및 화합물 1 내지 화합물 14를 사용하여 뉴라미니데이즈의 활성을 측정한 결과 표 2와 표 3에 나타내었다. 표 2에서 보여준 바와 같이 에탄올 추출물 및 용매 분획물의 뉴라미니데이즈에 대한 활성정도를 비교하기 위하여 각각의 추출물을 최종농도 20㎍/㎖의 농도로 바이러스 배양액으로부터 얻은 뉴라미니데이즈에 대한 각각 추출물의 활성정도를 측정하였다. 표 2에서 보여준 결과에서 볼 수 있는 바와 같이, 추출물은 70% 에탄올 추출물과 에틸아세테이트 분획에서 활성이 우수함을 확인하였으며 표 3의 결과로, 본 발명의 화합물들이 조류 인플루엔자와 돼지 인플루엔자 바이러스에 대한 뉴라미니데이즈에 대해 저해활성이 있음을 확인하였다.
표 2
Figure PCTKR2010007442-appb-T000002
표 3
Figure PCTKR2010007442-appb-T000003
표 3에서 볼 수 있는 바와 같이 타미플루는 조류 인플루엔자 바이러스 기원의 뉴라미니데이즈에 대한 저해활성(4.24±0.82ng/㎖)이 돼지 인플루엔자 바이러스 기원의 뉴라미니데이즈에 대한 저해활성(39.04±1.03ng/㎖) 보다 좋음을 확인할 수 있었다. 이러한 결과는 타미플루가 조류 인플루엔자에 선택적으로 작용하며 돼지 인플루엔자나 신종플루에 대한 활성이 적을 수 있음을 예시한다. 그러나, 본 특허의 화합물 1 내지 화합물 14는 표 3에서 보여주는 바와 같이 조류 인플루엔자 및 돼지 인플루엔자 바이러스 기원의 뉴라미니데이즈에게 둘 다 비슷한 농도에서 저해함을 확인하였다.
타미플루는 조류 인플루엔자의 뉴라미니데이즈 단백질 구조를 확인한 후 활성잔기에 선택적으로 결합하는 화합물을 합성하여 만든 것이다. 즉, 타미플루는 뉴라미니데이즈의 경쟁적 저해제(competitive inhibitor)로 활성잔기에 작용한다. 그러나, 최근 타미플루에 대한 내성 바이러스는 타미플루가 작용하는 활성잔기를 변형시키는 방법을 사용하여 내성작용을 획득하였다. 발명자들은 칼콘 계열의 화합물의 저해양식을 결정하기 위하여 활성화합물 중 하나인 화합물 4의 농도를 변화시키는 방법을 사용하여 저해형식을 검토하였다. 크레이스토카릭스 오페르쿠라투스의 주 화합물 중 하나인 화합물 4는 비경쟁적 저해제로 돼지 인플루엔자 바이러스 기원의 뉴라미니데이즈를 가역적으로 저해한다. 이러한 결과는 칼콘 계열의 화합물이 비경쟁적으로 뉴라미니데이즈에 작용하므로 내성 바이러스의 등장에도 불구하고 단독, 혹은 타미플루와 병용하여 광범위하게 사용할 수 있음을 확인시켜 준다.
<실시예 8 : 뉴라미니데이즈를 직접 발현하는 세포의 파쇄액에서 뉴라미니데이즈의 활성 측정>
신종플루 바이러스 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 직접 발현하는 세포파괴액에서 뉴라미니데이즈의 활성을 측정하기 위해 인간 신장세포인 HEK293T 세포에 0.25%의 트립신(trypsin)을 처리하여 모은 후, 상층액을 제거한 뒤 우혈청이 제거된 DMEM 배지로 현탁하였다. 그리고 우혈청이 포함되지 않는 DMEM 100㎕에 3㎕의 리포펙타민(Lipofectamin, Invitrogen, Inc)을 세포 현탁액에 점적한 후 천천히 섞어 15분간 실온에 방치하였다. 이후, 신종플루 바이러스의 뉴라미니데이즈(실시예 5-1), 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈(실시예 5-2)를 발현하는 플라스미드를 트랜스펙션(transfection, DNA를 동물 세포에 유입하는 방법)하기 위하여 미세 원침 튜브에 30초에 걸쳐 1㎍씩의 각각의 플라스미드를 천천히 점적하면서 혼합하여 실온에서 다시 15분간 방치하였다. 리포펙타민과 DNA-플라스미드의 혼합액과 HEK293T 세포주를 천천히 섞어 현탁액 상태로 20분간 실온에서 배양한 후 35mm 배양용기에 분주하고 CO2 배양기에서 24시간 동안 배양하였다. HEK293T 세포를 PBS로 2회 세척하고 각각의 배양용기에 500㎕의 추출용액을 가하여 세포를 파괴한 뒤 14,000rpm에서 5분간 원심분리 하였고, 얻어진 상층액을 실시예 6의 방법을 이용하여 뉴라미니데이즈 활성 실험에 사용하였다.
표 4는 크레이스토카릭스 오페르쿠라투스 추출물로부터 분리한 화합물 1 내지 화합물 14 중 바이러스 기원의 뉴라미니데이즈에 대한 활성이 강하며 주성분인 화합물 4, 화합물 5, 화합물 8 및 화합물 14를 대상으로 신종플루 바이러스의 뉴라미니데이즈와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대하여 활성을 측정한 결과이다.
화합물 4, 화합물 5, 화합물 8 및 화합물 14가 신종플루 바이러스의 뉴라미니데이즈 뿐만 아니라 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대해서도 뛰어난 저해활성이 있음을 확인할 수 있었다. 반면, 타미플루는 신종플루 바이러스의 뉴라미니데이즈에 대하여 21.13±1.36ng/㎖ 정도에서 IC50 값을 보여 주었으나, 인위적으로 발생시킨 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대하여 5.04±0.41μg/㎖ 에서 IC50 값을 보일 정도로 활성이 적었다. 이는 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈의 발생시 위험도를 보여주는 것으로, 본 발명의 화합물 4, 화합물 5, 화합물 8 및 화합물 14가 신종플루 바이러스의 뉴라미니데이즈와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대한 사용 가능성을 나타낸다.
표 4
Figure PCTKR2010007442-appb-T000004
<실시예 9 : 바이러스 배양액을 이용한 타미플루와 화합물 4의 병용사용으로 뉴라미니데이즈의 활성 측정>
실시예 7에서 확인한 돼지 인플루엔자 바이러스의 뉴라미니데이즈에 대한 타미플루의 50% 저해율은 39.04±1.03ng/㎖이었고, 조류 인플루엔자 바이러스의 뉴라미니데이즈에 대한 타미플루의 50% 저해율은 4.24±0.82ng/㎖로 타미플루는 경쟁적 저해제로 확인되었다. 실시예 7에서 확인된 결과로 본 발명의 화합물 중 하나인 화합물 4는 비경쟁적 저해제(noncompetitive inhibitor)로 돼지 인플루엔자에 대하여 50% 저해율을 보이는 농도가 6.42±0.43㎍/㎖이었다.
경쟁적 저해제는 뉴라미니데이즈 효소가 화합물과 결합하는 효소 작용점(active pocket)에서 작용하므로 비경쟁적 저해제로서 뉴라미니데이즈 효소의 다른 부위에서 작용하는 화합물 4를 첨가한다면 타미플루의 활성을 증가시킬 수 있다는 가정하에 화합물 4를 이용하여 타미플루의 저해율을 계산하였다. 이를 위해 크레이스토카릭스 오페르쿠라투스로부터 나온 화합물 4의 농도를 1㎍/㎖로 고정한 후 실시예 4-1 및 실시예 4-2의 바이러스 배양액을 이용하여 돼지 인플루엔자 바이러스와 조류 인플루엔자 바이러스 기원의 뉴라미니데이즈에 대한 타미플루의 50% 저해율을 실시예 6의 방법으로 측정한 결과, 도 6 및 도 7의 결과처럼 돼지 인플루엔자 바이러스에 대한 타미플루의 50% 저해율은 10.51±0.64ng/㎖로 측정되어 타미플루와 화합물 4를 병용시 타미플루의 활성을 약 3.71배 정도 증가시킬 수 있었으며, 조류 인플루엔자 바이러스의 경우 0.46±0.42ng/㎖로 약 9.22배 정도 활성을 증가시킬 수 있었다. 현재 신종플루나 조류 인플루엔자의 대유행에 대하여 권장되고 있는 치료방법으로 타미플루 단독, 타미플루와 아만타딘(주로 rimantidine, 리만티딘), 잔나비르 등의 처방이 권장되고 있는 실정이나 아만타딘 계열은 높은 독성을 갖고 있다. 따라서 본 발명의 화합물과 타미플루의 병용 치료법은 내성 바이러스 치료에 효과적인 전략이다.
<실시예 10. 독성실험>
10-1. 급성독성
크레이스토카릭스 오페르쿠라투스로부터 추출된 70% 에탄올 추출물과 에틸아세테이트 활성분획을 단기간에 과량을 섭취하였을 시 급성적(24시간 이내)으로 동물체내에 미치는 독성을 조사하고, 치사율을 결정하기 위하여 본 실험을 수행하였다. 일반적인 마우스인 ICR 마우스 계통 20 마리를 대조군은 10마리, 실험군은 10마리씩 배정하였다. 대조군에는 용매만을 투여하고, 실험군은 크레이스토카릭스 오페르쿠라투스로부터 추출된 에틸아세테이트 활성분획을 4.0g/㎏(일반적인 동물실험에서 사용되는 양의 100배 정도)의 농도로 경구 투여하였다. 투여 24시간 후에 각각의 치사율을 조사한 결과, 대조군과 4.0g/㎏ 농도의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물과 화합물 1 내지 화합물 14를 함유한 에틸아세테이트 활성분획을 투여한 실험군에서는 모두 생존하였다.
10-2 . 실험군 및 대조군의 장기 및 조직 독성 실험
장기 독성 실험은 C57BL/6J 생쥐를 대상으로 동물의 각 장기(조직)에 미치는 영향을 조사하기 위하여 화합물 1 내지 화합물 14를 함유한 70% 에탄올 추출물을 투여한 실험군과 용매만을 투여한 대조군의 동물들로부터 8주 후 혈액을 채취하여 GPT(glutamate-pyruvate transferase) 및 BUN(Blood Urea Nitrogen)의 혈액 내 농도를 Select E(Vital Scientific NV, Netherland) 기기를 이용하여 측정하였다. 그 결과, 간독성과 관계있는 것으로 알려진 GPT와 신장독성과 관계있는 것으로 알려진 BUN의 경우, 대조군과 비교하여 실험군은 별다른 차이를 보이지 않았다. 또한, 각 동물로부터 간과 신장을 정취하여 통상적인 조직절편 제작과정을 거쳐 광학현미경으로 조직학적 관찰을 시행하였으며 특이한 이상이 관찰되지 않았다.
<사용예 1. 약학적 제제예>
1-1. 정제의 제조
본 발명에 따른 실시예 1 크레이스토카릭스 오페르쿠라투스의 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 200g을 락토오스 175.9g, 감자전분 180g 및 콜로이드성 규산 32g과 혼합하였다. 이 혼합물에 10% 젤라틴 용액을 첨가시킨 후, 분쇄해서 14 메쉬체를 통과시켰다. 이것을 건조시키고 여기에 감자전분 160g, 활석 50g 및 스테아린산 마그네슘 5g을 첨가해서 얻은 혼합물을 정제로 만들었다.
1-2. 주사액제의 제조
본 발명에 따른 실시예 1 크레이스토카릭스 오페르쿠라투스의 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 1g, 염화나트륨 0.6g 및 아스코르브산 0.1g을 증류수에 용해시켜서 100㎖를 만들었다. 이 용액을 병에 넣고 20℃에서 30분간 가열하여 멸균시켰다.
<사용예 2. 식품 제조예>
2-1. 조리용 양념의 제조
본 발명에 따른 실시예 1의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물 또는 이로부터 분리된 화합물을 각각 0.2~10 중량%로 하여 건강 증진용 조리용 양념을 제조하였다.
2-2. 밀가루 식품의 제조
본 발명에 따른 실시예 1의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물 또는 이로부터 분리된 화합물을 각각 0.1~5.0 중량%로 하여 밀가루에 첨가하고, 이 혼합물을 이용하여 빵, 케이크, 쿠키, 크래커 및 면류를 제조하여 건강 증진용 식품을 제조하였다.
2-3. 스프 및 육즙(gravies)의 제조
본 발명에 따른 실시예 1의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물 또는 이로부터 분리된 화합물을 각각 0.1~1.0 중량%로 하여 스프 및 육즙에 첨가하여 건강 증진용 육가공 제품, 면류의 수프 및 육즙을 제조하였다.
2-4. 유제품(dairy products)의 제조
본 발명에 따른 실시예 1의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물 또는 이로부터 분리된 화합물을 각각 0.1~1.0 중량%로 하여 우유에 첨가하고, 상기 우유를 이용하여 버터 및 아이스크림과 같은 다양한 유제품을 제조하였다.
<사용예 3. 음료 제조예>
3-1. 야채쥬스 제조
본 발명에 따른 실시예 1의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 0.5g을 토마토 또는 당근 쥬스 1,000㎖에 가하여 건강 증진용 야채쥬스를 제조하였다.
3-2. 과일쥬스 제조
본 발명에 따른 실시예 1의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 0.1g을 사과 또는 포도 쥬스 1,000㎖에 가하여 건강 증진용 과일쥬스를 제조하였다.
<사용예 4. 사료첨가제 제조예>
본 발명에 따른 실시예 1의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 10.0g을 부형제를 50.0g에 섞어 사료첨가제를 제조하였다. 그러나, 그 배합비를 임의로 변형 실시하여도 무방하며, 통상의 사료조성물 제조방법에 따라 상기의 성분을 혼합하여 제조에 사용할 수 있다.
<사용예 5. 소독물의 제조>
본 발명에 따른 실시예 1의 크레이스토카릭스 오페르쿠라투스 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 3.0g을 첨가한 후 정제수를 1,000㎖에 가하여 무 방부제용 천연 소독제를 제조하였다.

Claims (14)

  1. 크레이스토카릭스 오페르쿠라투스(Cleistocalyx operculatus)를 에탄올 또는 메탄올 중에서 선택된 1종 이상의 추출용매 또는 이들 추출용매의 수용액으로 추출하여
    7-Hydroxy-5-methoxy-6,8-dimethylisoflavone,
    5,7-Dihydroxy-6,8-dimethyldihydroflavonol,
    2,7-Dihydroxy-5-methoxy-6,8-dimethylflavanone,
    4,2',4'-Trihydroxy-6'-methoxy-3',5'-dimethylchalcone,
    2',4'-Dihydroxy-6'-methoxy-3',5'-dimethylchalcone,
    7-Hydroxy-5-methoxy-6,8-dimethylfavanone
    2',4'-Dihydroxy-3'-methyl-6'-methoxychalcone,
    6-Formyl-8-methyl-7-O-methylpinocembrin,
    (2S)-8-Formyl-5-hydroxy-7-methoxy-6-methylflavanone,
    5,7-Dihydroxy-6,8-dimethylfavanone,
    2,2',4'-Trihydroxy-6'-methoxy-3',5'-dimethylchalcone
    의 화합물 중 적어도 한 가지 이상 포함된 것을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 크레이스토카릭스 오페르쿠라투스 추출물.
  2. 제 1 항에 있어서,
    추출용매는 50 내지 100% 에탄올 수용액인 것을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 크레이스토카릭스 오페르쿠라투스 추출물.
  3. 제 1 항의 크레이스토카릭스 오페르쿠라투스 추출물을 포함하는 것을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 개선용 건강기능식품.
  4. 제 3 항에 있어서,
    상기 건강기능식품은 드링크제, 육류, 소세지, 빵, 캔디류, 스넥류, 면류, 아이스크림을 포함한 낙농제품, 스프, 이온음료 등을 포함한 음료수, 알코올 음료 및 비타민 복합제를 포함한 영양 공급용 제품으로 구성되는 군으로부터 선택되는 것을 특징으로 하는 건강기능식품.
  5. 제 1 항의 크레이스토카릭스 오페르쿠라투스 추출물을 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 약학조성물.
  6. 7-Hydroxy-5-methoxy-6,8-dimethylisoflavone,
    5,7-Dihydroxy-6,8-dimethyldihydroflavonol,
    2,7-Dihydroxy-5-methoxy-6,8-dimethylflavanone,
    4,2',4'-Trihydroxy-6'-methoxy-3',5'-dimethylchalcone,
    2',4'-Dihydroxy-6'-methoxy-3',5'-dimethylchalcone,
    7-Hydroxy-5-methoxy-6,8-dimethylfavanone,
    2',4'-Dihydroxy-3'-methyl-6'-methoxychalcone,
    6-Formyl-8-methyl-7-O-methylpinocembrin,
    (2S)-8-Formyl-5-hydroxy-7-methoxy-6-methylflavanone,
    5,7-Dihydroxy-6,8-dimethylfavanone,
    2,2',4'-Trihydroxy-6'-methoxy-3',5'-dimethylchalcone
    의 화합물 중 적어도 한 가지 이상 포함된 것을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 약학조성물.
  7. 제 6 항에 있어서,
    상기 조성물은 조류 인플루엔자 바이러스의 뉴라미니데이즈, 신종플루 바이러스의 뉴라미니데이즈 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈 효소의 활성을 저해시키는 것임을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 약학조성물.
  8. 제 6 항의 화합물과 타미플루를 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 약학조성물.
  9. 제 1 항의 크레이스토카릭스 오페르쿠라투스 추출물을 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 질환의 예방 또는 치료용 동물약품 및 사료 첨가제.
  10. 제 1 항의 크레이스토카릭스 오페르쿠라투스 추출물을 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 천연소독제.
  11. 크레이스토카릭스 오페르쿠라투스(Cleistocalyx operculatus)에서 분리한 7-Hydroxy-5-methoxy-6,8-dimethylisoflavone.
  12. 크레이스토카릭스 오페르쿠라투스(Cleistocalyx operculatus)에서 분리한 5,7-Dihydroxy-6,8-dimethyldihydroflavonol.
  13. 크레이스토카릭스 오페르쿠라투스(Cleistocalyx operculatus)에서 분리한 2,7-Dihydroxy-5-methoxy-6,8-dimethylflavanone.
  14. 크레이스토카릭스 오페르쿠라투스에서 분리한 4,2,4'-Trihydroxy-6'-methoxy-3',5'-dimethylchalcone.
PCT/KR2010/007442 2010-08-17 2010-10-28 크레이스토카릭스 오페르쿠라투스로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제 WO2012023660A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US12/954,331 US20120046353A1 (en) 2010-08-17 2010-11-24 Cleistocalyx operculatus-derived compounds having inhibitory activities against avian and swine influenza viruses or novel influenza virus

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2010-0079391 2010-08-17
KR1020100079391A KR101021830B1 (ko) 2010-08-17 2010-08-17 크레이스토카릭스 오페르쿠라투스로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US12/954,331 Continuation US20120046353A1 (en) 2010-08-17 2010-11-24 Cleistocalyx operculatus-derived compounds having inhibitory activities against avian and swine influenza viruses or novel influenza virus

Publications (1)

Publication Number Publication Date
WO2012023660A1 true WO2012023660A1 (ko) 2012-02-23

Family

ID=43938844

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2010/007442 WO2012023660A1 (ko) 2010-08-17 2010-10-28 크레이스토카릭스 오페르쿠라투스로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제

Country Status (2)

Country Link
KR (1) KR101021830B1 (ko)
WO (1) WO2012023660A1 (ko)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105943525A (zh) * 2016-06-02 2016-09-21 中国药科大学 一种保肝药物组合物
WO2022060169A1 (ko) * 2020-09-18 2022-03-24 서울대학교 산학협력단 디메틸칼콘 유도체를 포함하는 대사질환 예방 또는 치료용 조성물

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101252467B1 (ko) * 2010-12-17 2013-04-16 서울대학교산학협력단 크레이스토카릭스 오페르쿠라투스로부터 얻은 피피에이알-감마 작용제 및 이를 유효성분으로 포함하는 당뇨병 예방 또는 치료용 조성물
KR101334143B1 (ko) * 2012-06-12 2013-11-28 주식회사 중앙백신연구소 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물을 함유하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 치료용 조성물
KR101934350B1 (ko) 2017-02-20 2019-01-02 주식회사 중앙백신연구소 흰반점 바이러스에 대한 항바이러스 활성을 갖는 조성물
KR102393639B1 (ko) * 2019-09-27 2022-05-04 중앙대학교 산학협력단 다이메틸칼콘 유도체 및 이의 제조방법
KR102579726B1 (ko) 2020-11-30 2023-09-19 서울대학교산학협력단 백지(Angelica dahurica), 울금(Curcuma longa) 및 송지(Resina Pini) 추출물을 유효성분으로 포함하는 인플루엔자 바이러스 감염의 예방 또는 치료용 조성물
KR102578233B1 (ko) 2021-01-13 2023-09-15 서울대학교산학협력단 백지(Angelica dahurica), 울금(Curcuma longa) 및 송지(Resina Pini) 추출물을 유효성분으로 포함하는 조류 인플루엔자 바이러스 감염의 예방 또는 치료용 조성물
WO2023177194A1 (ko) * 2022-03-15 2023-09-21 중앙대학교 산학협력단 신규한 디메틸칼콘 유도체
KR20240045546A (ko) 2022-09-30 2024-04-08 (주)예스킨 항 인플루엔자 바이러스제

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
CHUN-LIN YE ET AL.: "Antioxidation and anticancer activity of 3'-formyl-4',6'-dihydroxy-2'-methoxy-5'-methylchalcone and (2S)-8-formyl-5-hydroxy-7-methoxy-6-methylflavanone", JOURNAL OF PHARMACY AND PHARMACOLOGY, vol. 59, 2007, pages 553 - 559 *
CHUN-LIN YE ET AL.: "Flavonoids from Cleistocalyx operculatus", PHYTOCHEMISTRY, vol. 65, 2004, pages 445 - 447 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105943525A (zh) * 2016-06-02 2016-09-21 中国药科大学 一种保肝药物组合物
WO2022060169A1 (ko) * 2020-09-18 2022-03-24 서울대학교 산학협력단 디메틸칼콘 유도체를 포함하는 대사질환 예방 또는 치료용 조성물

Also Published As

Publication number Publication date
KR101021830B1 (ko) 2011-03-17

Similar Documents

Publication Publication Date Title
WO2012023660A1 (ko) 크레이스토카릭스 오페르쿠라투스로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제
WO2011049348A2 (ko) 울금으로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제
KR100950445B1 (ko) 감초로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제
KR101334143B1 (ko) 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물을 함유하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 치료용 조성물
KR101782532B1 (ko) 백지 추출물 또는 이로부터 분리된 퓨라노쿠마린을 함유하는 조류 인플루엔자, 돼지 인플루엔자 또는 코로나 바이러스의 예방 또는 치료용 조성물
WO2022050516A1 (ko) 담팔수 추출물을 유효성분으로 포함하는 코로나 바이러스 치료제
KR101317318B1 (ko) 신종인플루엔자, 조류인플루엔자, 일반 및 독감감기, ｓａｒｓ 바이러스 억제 효능을 갖는 오배자 추출물 또는 이로부터 분리된 화합물을 유효성분으로 함유하는 약학 조성물
KR101612051B1 (ko) 단삼 추출물을 포함하는 코로나 바이러스 감염의 예방 또는 치료용 조성물
WO2011055931A2 (ko) 인플루엔자 바이러스 유래 질병의 예방 또는 치료용 조성물
WO2014042325A1 (ko) 아포-9&#39;-푸코잔티논 화합물을 유효성분으로 포함하는 염증질환 또는 면역질환의 예방 및 치료용 조성물
WO2023249392A1 (ko) 한약재 추출물을 유효성분으로 포함하는 코로나바이러스 감염증의 예방, 개선 또는 치료용 조성물
WO2023249393A1 (ko) 한약재 추출물을 유효성분으로 포함하는 코로나바이러스 감염증의 예방, 개선 또는 치료용 조성물
KR20150055683A (ko) 진세노사이드를 함유하는 감기, 조류 인플루엔자 또는 돼지 인플루엔자의 예방 또는 치료용 조성물
WO2013062247A2 (ko) 포볼 타입의 디테르펜 화합물 및 이를 포함하는 바이러스 감염 질환의 치료 또는 예방용 약학적 조성물
WO2018088777A1 (ko) 감태 추출물 또는 이로부터 분리한 플로로탄닌계 화합물을 유효성분으로 포함하는 인플루엔자의 예방 또는 치료용 조성물
KR101189823B1 (ko) 폴리페놀성 화합물을 포함하는 인플루엔자 바이러스 감염의 예방 및 치료용 조성물 및 뉴라미니데이즈 활성의 억제용 조성물
KR101427096B1 (ko) 관중 추출물 또는 이로부터 분리된 플로로글루시놀 유도체를 함유하는 코로나 바이러스 관련 질환의 예방 또는 치료용 조성물
US20120046353A1 (en) Cleistocalyx operculatus-derived compounds having inhibitory activities against avian and swine influenza viruses or novel influenza virus
WO2012173392A9 (ko) 인플루엔자 바이러스 감염의 예방 또는 치료용 커큐미노이드계 화합물/스테비오사이드 함유 복합체
KR102456749B1 (ko) 울금 (Curcuma longa) 추출물 또는 이로부터 분리한 세스퀴테르페노이드계 화합물을 유효성분으로 포함하는 돼지 인플루엔자 바이러스 감염의 예방 또는 치료용 조성물
KR20150095605A (ko) 진세노사이드를 함유하는 감기, 조류 인플루엔자 또는 돼지 인플루엔자의 예방 또는 치료용 조성물
KR20210133861A (ko) 소나무 송지 추출물 또는 이로부터 분리한 다이테르페노이드계 화합물을 유효성분으로 포함하는 돼지 인플루엔자 바이러스 감염의 예방 또는 치료용 조성물
WO2022173246A2 (ko) 구아바(Psidiuma guajava) 추출물 또는 이의 페오피틴화 분획물 또는 이로부터 분리한 메로테르페노이드계 화합물을 유효성분으로 포함하는 신종코로나 바이러스 감염의 예방 또는 치료용 조성물
WO2023022523A1 (ko) 구아바(Psidiuma guajava) 잎 추출물 또는 이의 분획물로부터 수득한 세스퀴테르페노이드계 화합물을 유효성분으로 포함하는 신종코로나 바이러스 감염증의 예방 또는 치료용 조성물
EP4151226A1 (en) Coronavirus therapeutic agent comprising zanthoxylum piperitum leaf extract as active ingredient

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10856202

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 10856202

Country of ref document: EP

Kind code of ref document: A1