WO2008100384A2 - Activin-actriia antagonists and uses for promoting bone growth in cancer patients - Google Patents

Activin-actriia antagonists and uses for promoting bone growth in cancer patients Download PDF

Info

Publication number
WO2008100384A2
WO2008100384A2 PCT/US2008/001354 US2008001354W WO2008100384A2 WO 2008100384 A2 WO2008100384 A2 WO 2008100384A2 US 2008001354 W US2008001354 W US 2008001354W WO 2008100384 A2 WO2008100384 A2 WO 2008100384A2
Authority
WO
WIPO (PCT)
Prior art keywords
actriia
fusion protein
amino acid
bone
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2008/001354
Other languages
English (en)
French (fr)
Other versions
WO2008100384A3 (en
Inventor
John Knopf
Jasbir Seehra
Ravindra Kumar
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Acceleron Pharma Inc
Original Assignee
Acceleron Pharma Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to HK10105092.4A priority Critical patent/HK1137366B/en
Priority to KR1020187020332A priority patent/KR20180083967A/ko
Priority to KR1020167029980A priority patent/KR20160129095A/ko
Priority to CN201410709284.1A priority patent/CN104548056B/zh
Priority to MX2009008510A priority patent/MX2009008510A/es
Priority to KR1020197006082A priority patent/KR20190026047A/ko
Priority to CA2677605A priority patent/CA2677605C/en
Priority to EP08725055A priority patent/EP2120999B1/en
Priority to HRP20120947AT priority patent/HRP20120947T1/hr
Priority to EP11195151.3A priority patent/EP2481415B1/en
Priority to ES08725055T priority patent/ES2394123T3/es
Priority to AU2008216896A priority patent/AU2008216896B2/en
Priority to KR1020097017745A priority patent/KR101670417B1/ko
Priority to DK08725055.1T priority patent/DK2120999T3/da
Priority to RS20120504A priority patent/RS52535B/sr
Priority to KR1020217019387A priority patent/KR20210082540A/ko
Priority to EA200970747A priority patent/EA018221B1/ru
Priority to CN200880011454.1A priority patent/CN101687016B/zh
Application filed by Acceleron Pharma Inc filed Critical Acceleron Pharma Inc
Priority to JP2009549079A priority patent/JP5574711B2/ja
Priority to SI200830820T priority patent/SI2120999T1/sl
Priority to BRPI0807506-9A priority patent/BRPI0807506B1/pt
Priority to PL08725055T priority patent/PL2120999T3/pl
Priority to KR1020157026929A priority patent/KR101672156B1/ko
Priority to KR1020207012421A priority patent/KR20200054317A/ko
Priority to MEP-2016-80A priority patent/ME02333B/me
Publication of WO2008100384A2 publication Critical patent/WO2008100384A2/en
Publication of WO2008100384A3 publication Critical patent/WO2008100384A3/en
Priority to IL200242A priority patent/IL200242B/en
Anticipated expiration legal-status Critical
Priority to IL257848A priority patent/IL257848B/en
Priority to IL281715A priority patent/IL281715A/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3061Blood cells
    • HELECTRICITY
    • H04ELECTRIC COMMUNICATION TECHNIQUE
    • H04WWIRELESS COMMUNICATION NETWORKS
    • H04W8/00Network data management
    • H04W8/02Processing of mobility data, e.g. registration information at HLR [Home Location Register] or VLR [Visitor Location Register]; Transfer of mobility data, e.g. between HLR, VLR or external networks
    • H04W8/08Mobility data transfer
    • H04W8/082Mobility data transfer for traffic bypassing of mobility servers, e.g. location registers, home PLMNs or home agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/179Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1796Receptors; Cell surface antigens; Cell surface determinants for hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/14Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/18Drugs for disorders of the endocrine system of the parathyroid hormones
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • HELECTRICITY
    • H04ELECTRIC COMMUNICATION TECHNIQUE
    • H04WWIRELESS COMMUNICATION NETWORKS
    • H04W40/00Communication routing or communication path finding
    • HELECTRICITY
    • H04ELECTRIC COMMUNICATION TECHNIQUE
    • H04WWIRELESS COMMUNICATION NETWORKS
    • H04W80/00Wireless network protocols or protocol adaptations to wireless operation
    • H04W80/04Network layer protocols, e.g. mobile IP [Internet Protocol]
    • HELECTRICITY
    • H04ELECTRIC COMMUNICATION TECHNIQUE
    • H04WWIRELESS COMMUNICATION NETWORKS
    • H04W84/00Network topologies
    • H04W84/18Self-organising networks, e.g. ad-hoc networks or sensor networks
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • HELECTRICITY
    • H04ELECTRIC COMMUNICATION TECHNIQUE
    • H04LTRANSMISSION OF DIGITAL INFORMATION, e.g. TELEGRAPHIC COMMUNICATION
    • H04L2212/00Encapsulation of packets

Definitions

  • disorders of the bone ranging from osteoporosis to fractures, represent a set of pathological states for which there are few effective pharmaceutical agents. Treatment instead focuses on physical and behavioral interventions, including immobilization, exercise and changes in diet. It would be beneficial to have therapeutic agents that promote bone growth and increase bone density for the purpose of treating a variety of bone disorders.
  • Bone growth and mineralization are dependent on the activities of two cell types, osteoclasts and osteoblasts, although chondrocytes and cells of the vasculature also participate in critical aspects of these processes.
  • Developmentally, bone formation occurs through two mechanisms, endochondral ossification and intramembranous ossification, with the former responsible for longitudinal bone formation and the later responsible for the formation of topologically flat bones, such as the bones of the skull.
  • Endochondral ossification requires the sequential formation and degradation of cartilaginous structures in the growth plates that serve as templates for the formation of osteoblasts, osteoclasts, the vasculature and subsequent mineralization.
  • intramembranous ossification bone is formed directly in the connective tissues. Both processes require the infiltration of osteoblasts and subsequent matrix deposition.
  • Fractures and other structural disruptions of bone are healed through a process that, at least superficially, resembles the sequence of developmental events of osteogenesis, including the formation of cartilaginous tissue and subsequent mineralization.
  • the process of fracture healing can occur in two ways. Direct or primary bone healing occurs without callus formation. Indirect or secondary bone healing occurs with a callus precursor stage. Primary healing of fractures involves the reformation of mechanical continuity across a closely-set disruption. Under suitable conditions, bone-resorbing cells surrounding the disruption show a tunnelling resorptive response and establish pathways for the penetration of blood vessels and subsequent healing. Secondary healing of bones follows a process of inflammation, soft callus formation, callus mineralisation and callus remodelling.
  • haematoma and haemorrhage formation results from the disruption of periosteal and endosteal blood vessels at the site of injury. Inflammatory cells invade the area. In soft callus formation stage, the cells produce new vessels, fibroblasts, intracellular material and supporting cells, forming granulation tissue in the space between the fracture fragments. Clinical union across the disruption is established by fibrous or cartilaginous tissue (soft callus). Osteoblasts are formed and mediate the mineralization of soft callus, which is then replaced by lamellar bone and subjected to the normal remodeling processes.
  • Bone loss is sometimes characterized as an imbalance in the normal bone remodeling process. Healthy bone is constantly subject to remodeling. Remodeling begins with resorption of bone by osteoclasts. The resorbed bone is then replaced by new bone tissue, which is characterized by collagen formation by osteoblasts, and subsequent calcification. In healthy individuals the rates of resorption and formation are balanced. Osteoporosis is a chronic, progressive condition, marked by a shift towards resorption, resulting in an overall decrease in bone mass and bone mineralization. Osteoporosis in humans is preceded by clinical osteopenia (bone mineral density that is greater than one standard deviation but less than 2.5 standard deviations below the mean value for young adult bone). Worldwide, approximately 75 million people are at risk for osteoporosis.
  • osteoporosis can be useful for promoting the healing of fractures and other damage to bone as well as the treatment of disorders, such as osteoporosis, associated with loss of bone mass and bone mineralization.
  • disorders such as osteoporosis, associated with loss of bone mass and bone mineralization.
  • osteoporosis estrogen, calcitonin, osteocalcin with vitamin K, or high doses of dietary calcium are all used as therapeutic interventions.
  • Other therapeutic approaches to osteoporosis include bisphosphonates, parathyroid hormone, calcimimetics, statins, anabolic steroids, lanthanum and strontium salts, and sodium fluoride. Such therapeutics, however, are often associated with undesirable side effects.
  • the disclosure demonstrates that molecules having activin or ActRIIa antagonist activity (“activin antagonists” and “ActRIIa antagonists”, collectively “activin- ActRIIa antagonists”) can be used to increase bone density, promote bone growth, and/or increase bone strength.
  • activin antagonists and “ActRIIa antagonists”, collectively “activin- ActRIIa antagonists”
  • a soluble form of ActRIIa acts as an inhibitor of activin-ActRIIa signaling and promotes increased bone density, bone growth, and bone strength in vivo.
  • the soluble ActRIIa protein exhibits dual activity, having both anti-catabolic and anabolic effects.
  • anti-catabolic agents also commonly referred to as "catabolic agents”
  • anabolic agents e.g., parathyroid hormone, PTH, when appropriately dosed
  • the disclosure establishes that antagonists of the activin-ActRIIa signaling pathway may be used to increase bone density and promote bone growth.
  • antagonists of the activin-ActRIIa signaling pathway may be used to increase bone density and promote bone growth.
  • soluble ActRIIa may affect bone through a mechanism other than activin antagonism, the disclosure nonetheless demonstrates that desirable therapeutic agents may be selected on the basis of an activin-ActRIIa antagonist activity.
  • the disclosure provides methods for using activin-ActRIIa antagonists, including, for example, activin-binding ActRIIa polypeptides, anti-activin antibodies, anti-ActRIIa antibodies, activin- or ActRIIa-targeted small molecules and aptamers, and nucleic acids that decrease expression of activin and ActRIIa, to treat disorders associated with low bone density or low bone strength, such as osteoporosis, or to promote bone growth in patients in need thereof, such as in patients having a bone fracture.
  • activin-ActRIIa antagonists including, for example, activin-binding ActRIIa polypeptides, anti-activin antibodies, anti-ActRIIa antibodies, activin- or ActRIIa-targeted small molecules and aptamers, and nucleic acids that decrease expression of activin and ActRIIa, to treat disorders associated with low bone density or low bone strength, such as osteoporosis, or to promote bone growth in patients in need thereof, such as in patients having a bone fracture.
  • activin-ActRIIa antagonists are effective in preventing and/or repairing bone damage caused by multiple myeloma tumors and breast tumors, and, additionally, that activin-ActRIIa antagonists diminish the tumor load in multiple myeloma.
  • Soluble ActRIIa polypeptide promotes bone growth without causing a consistently measurable increase in muscle mass.
  • the disclosure provides polypeptides comprising a soluble, activin- binding ActRIIa polypeptide that binds to activin.
  • ActRIIa polypeptides may be formulated as a pharmaceutical preparation comprising the activin-binding ActRIIa polypeptide and a pharmaceutically acceptable carrier.
  • the activin-binding ActRIIa polypeptide binds to activin with a K D less than 1 micromolar or less than 100, 10 or 1 nanomolar.
  • the activin-binding ActRIIa polypeptide selectively binds activin versus GDFl 1 and/or GDF8, and preferably with a K D that is at least 10-fold, 20-fold or 50-fold lower with respect to activin than with respect to GDFl 1 and/or GDF8. While not wishing to be bound to a particular mechanism of action, it is expected that this degree of selectivity for activin inhibition over GDFl 1/GDF8 inhibition accounts for the selective effect on bone without a consistently measurable effect on muscle. In many embodiments, an ActRIIa polypeptide will be selected for causing less than 15%, less than 10% or less than 5% increase in muscle at doses that achieve desirable effects on bone.
  • the composition is at least 95% pure, with respect to other polypeptide components, as assessed by size exclusion chromatography, and more preferably, the composition is at least 98% pure.
  • An activin- binding ActRIIa polypeptide for use in such a preparation may be any of those disclosed herein, such as a polypeptide having an amino acid sequence selected from SEQ ID NOs: 2, 3, 7 or 12, or having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 12 or 13.
  • An activin-binding ActRIIa polypeptide may include a functional fragment of a natural ActRIIa polypeptide, such as one comprising at least 10, 20 or 30 amino acids of a sequence selected from SEQ ID NOs: 1-3 or a sequence of SEQ ID NO: 2, lacking the C-terminal 10 to 15 amino acids (the "tail").
  • a soluble, activin-binding ActRIIa polypeptide may include one or more alterations in the amino acid sequence (e.g., in the ligand-binding domain) relative to a naturally occurring ActRIIa polypeptide. Examples of altered ActRIIa polypeptides are provided in WO 2006/012627, pp. 59-60, incorporated by reference herein.
  • the alteration in the amino acid sequence may, for example, alter glycosylation of the polypeptide when produced in a mammalian, insect or other eukaryotic cell or alter proteolytic cleavage of the polypeptide relative to the naturally occurring ActRIIa polypeptide.
  • An activin-binding ActRIIa polypeptide may be a fusion protein that has, as one domain, an ActRIIa polypeptide (e.g., a ligand-binding portion of an ActRIIa) and one or more additional domains that provide a desirable property, such as improved pharmacokinetics, easier purification, targeting to particular tissues, etc.
  • a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification. Dimerization or multimerization may provide increased ligand-binding affinity.
  • An activin-binding ActRIIa fusion protein may include an immunoglobulin Fc domain (wild-type or mutant) or a serum albumin or other polypeptide portion that provides desirable properties such as improved pharmacokinetics, improved solubility or improved stability.
  • an ActRIIa-Fc fusion protein will be produced as a homodimeric complex.
  • an ActRIIa-Fc fusion comprises a relatively unstructured linker positioned between the Fc domain and the extracellular ActRIIa domain.
  • This unstructured linker may correspond to the roughly 15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRIIa (the "tail"), or it may be an artificial sequence of 1 , 2, 3, 4 or 5 amino acids or a length of between 5 and 15, 20, 30, 50 or more amino acids that are relatively free of secondary structure, or a mixture of both.
  • a linker may be rich in glycine and proline residues and may, for example, contain a single sequence of threonine/serine and glycines or repeating sequences of threonine/serine and glycines (e.g., TG 4 or SG 4 singlets or repeats).
  • a fusion protein may include a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
  • a soluble ActRIIa polypeptide includes one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
  • a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat a bone disorder.
  • a pharmaceutical preparation is substantially pyrogen free.
  • an ActRIIa protein be expressed in a mammalian cell line that mediates suitably natural glycosylation of the ActRIIa protein so as to diminish the likelihood of an unfavorable immune response in a patient.
  • Human and CHO cell lines have been used successfully, and it is expected that other common mammalian expression systems will be useful.
  • ActRIIa proteins designated ActRIIa-Fc have desirable properties, including selective binding to activin versus GDF8 and/or GDFl 1, high affinity ligand binding and serum half life greater than two weeks in animal models.
  • the invention provides ActRIIa-Fc polypeptides and pharmaceutical preparations comprising such polypeptides and a pharmaceutically acceptable excipient.
  • the disclosure provides nucleic acids encoding a soluble activin- binding ActRIIa polypeptide.
  • An isolated polynucleotide may comprise a coding sequence for a soluble, activin-binding ActRIIa polypeptide, such as described above.
  • an isolated nucleic acid may include a sequence coding for an extracellular domain (e.g., ligand- binding domain) of an ActRIIa and a sequence that would code for part or all of the transmembrane domain and/or the cytoplasmic domain of an ActRIIa, but for a stop codon positioned within the transmembrane domain or the cytoplasmic domain, or positioned between the extracellular domain and the transmembrane domain or cytoplasmic domain.
  • an extracellular domain e.g., ligand- binding domain
  • an isolated polynucleotide may comprise a full-length ActRIIa polynucleotide sequence such as SEQ ID NO: 4 or 5, or a partially truncated version, said isolated polynucleotide further comprising a transcription termination codon at least six hundred nucleotides before the 3 '-terminus or otherwise positioned such that translation of the polynucleotide gives rise to an extracellular domain optionally fused to a truncated portion of a full-length ActRIIa.
  • a preferred nucleic acid sequence is SEQ ID NO: 14.
  • Nucleic acids disclosed herein may be operably linked to a promoter for expression, and the disclosure provides cells transformed with such recombinant polynucleotides.
  • the cell is a mammalian cell such as a CHO cell.
  • the disclosure provides methods for making a soluble, activin- binding ActRIIa polypeptide.
  • a method may include expressing any of the nucleic acids (e.g., SEQ ID NO: 4, 5 or 14) disclosed herein in a suitable cell, such as a Chinese hamster ovary (CHO) cell.
  • a suitable cell such as a Chinese hamster ovary (CHO) cell.
  • Such a method may comprise: a) culturing a cell under conditions suitable for expression of the soluble ActRIIa polypeptide, wherein said cell is transformed with a soluble ActRIIa expression construct; and b) recovering the soluble ActRIIa polypeptide so expressed.
  • Soluble ActRIIa polypeptides may be recovered as crude, partially purified or highly purified fractions.
  • Purification may be achieved by a series of purification steps, including, for example, one, two or three or more of the following, in any order: protein A chromatography, anion exchange chromatography (e.g., Q sepharose), hydrophobic interaction chromatography (e.g., phenylsepharose), size exclusion chromatography, and cation exchange chromatography.
  • anion exchange chromatography e.g., Q sepharose
  • hydrophobic interaction chromatography e.g., phenylsepharose
  • size exclusion chromatography e.g., cation exchange chromatography
  • an activin-ActRIIa antagonist disclosed herein such as a soluble, activin-binding ActRIIa polypeptide, may be used in a method for promoting bone growth or increasing bone density in a subject.
  • the disclosure provides methods for treating a disorder associated with low bone density, or to promote bone growth, in patients in need thereof.
  • a method may comprise administering to a subject in need thereof an effective amount of activin-ActRIIa antagonist.
  • the disclosure provides uses of activin-ActRIIa antagonist for making a medicament for the treatment of a disorder or condition as described herein.
  • the disclosure provides a method for identifying an agent that stimulates growth of, or increased mineralization of, bone.
  • the method comprises: a) identifying a test agent that binds to activin or a ligand-binding domain of an ActRIIa polypeptide; and b) evaluating the effect of the agent on growth of, or mineralization of, bone.
  • Figure 1 shows the purification of ActRIIa-hFc expressed in CHO cells. The protein purifies as a single, well-defined peak.
  • Figure 2 shows the binding of ActRIIa-hFc to activin and GDF-1 1 , as measured by BiaCoreTM assay.
  • FIG. 3 shows a schematic for the A-204 Reporter Gene Assay.
  • the figure shows the Reporter vector: pGL3(CAGA)12 (described in Dennler et al, 1998, EMBO 17: 3091- 3100.)
  • the CAGAl 2 motif is present in TGF-Beta responsive genes (PAI-I gene), so this vector is of general use for factors signaling through Smad 2 and 3.
  • Figure 4 shows the effects of ActRIIa-hFc (diamonds) and ActRIIa-mFc (squares) on
  • GDF-8 signaling in the A-204 Reporter Gene Assay Both proteins exhibited substantial inhibition of GDF-8 mediated signaling at picomolar concentrations.
  • Figure 5 shows the effects of three different preparations of ActRIIa-hFc on GDF-11 signaling in the A-204 Reporter Gene Assay.
  • Figure 6 shows examples of DEXA images of control- and ActRIIa-mFc-treated
  • Figure 7 shows a quantification of the effects of ActRIIa-mFc on bone mineral density in BALB/c mice over the 12-week period. Treatments were control (diamonds), 2 mg/kg dosing of ActRIIa-mFc (squares), 6 mg/kg dosing of ActRIIa-mFc (triangles) and 10 mg/kg dosing of ActRIIa-mFc (circles).
  • Figure 8 shows a quantification of the effects of ActRIIa-mFc on bone mineral content in BALB/c mice over the 12-week period. Treatments were control (diamonds), 2 mg/kg dosing of ActRIIa-mFc (squares), 6 mg/kg dosing of ActRIIa-mFc (triangles) and 10 mg/kg dosing of ActRIIa-mFc (circles).
  • Figure 9 shows a quantification of the effects of ActRIIa-mFc on bone mineral density of the trabecular bone in ovariectomized (OVX) or sham operated (SHAM) C57BL6 mice over after a 6-week period. Treatments were control (PBS) or 10 mg/kg dosing of ActRIIa-mFc (ActRIIa).
  • Figure 10 shows a quantification of the effects of ActRIIa-mFc on the trabecular bone in ovariectomized (OVX) C57BL6 mice over a 12-week period. Treatments were control (PBS; pale bars) or 10 mg/kg dosing of ActRIIa-mFc (ActRIIa; dark bars).
  • Figure 1 1 shows a quantification of the effects of ActRIIa-mFc on the trabecular bone in sham operated C57BL6 mice after 6 or 12 weeks of treatment period. Treatments were control (PBS; pale bars) or 10 mg/kg dosing of ActRIIa-mFc (ActRIIa; dark bars).
  • Figure 12 shows the results of pQCT analysis of bone density in ovariectomized mice over 12 weeks of treatment. Treatments were control (PBS; pale bars) or ActRIIa-mFc (dark bars), y-axis: mg/ccm
  • Figure 13 depicts the results of pQCT analysis of bone density in sham operated mice over 12 weeks of treatment. Treatments were control (PBS; pale bars) or ActRIIa-mFc (dark bars), y-axis; mg/ccm
  • Figures 14A and 14B show whole body DEXA analysis after 12 weeks of treatment (A) and ex vivo analysis of femurs (B). Light areas depict areas of high bone density.
  • Figure 15 shows ex vivo pQCT analysis of the femoral midshaft after twelve weeks of treatment. Treatments were vehicle control (PBS, dark bars) and ActRIIa-mFc (pale bars). The four bars to the left show total bone density while the four bars to the right show cortical bone density. The first pair of bars in each set of four bars represent data from ovariectomized mice while the second pair of bars represent data from sham operated mice.
  • Figure 16 shows ex vivo pQCT analysis and diaphyseal bone content of the femoral midshaft after twelve weeks of treatment.
  • Treatments were vehicle control (PBS, dark bars) or ActRIIa-mFc (pale bars).
  • the four bars to the left show total bone content while the four bars to the right show cortical bone content.
  • the first pair of bars in each set of four bars represent data from ovariectomized mice while the second pair of bars represent data from sham operated mice.
  • Figure 17 shows ex vivo pQCT analysis of the femoral midshaft and femoral cortical thickness.
  • Treatments were control (PBS, dark bars) and ActRIIa-mFc (pale bars).
  • the four bars to the left show endosteal circumference while the four bars to the right show periosteal circumference.
  • the first pair of bars in each set of four bars represent data from ovariectomized mice while the second pair of bars represent data from sham operated mice.
  • Figure 18 depicts the results of mechanical testing of femurs after twelve weeks of treatment.
  • Treatments were control (PBS, dark bars) and ActRIIa-mFc (pale bars).
  • the two bars to the left represent data from ovariectomized mice while the last two bars represent data from sham operated mice.
  • Figure 19 shows the effects of Actrlla-mFc on trabecular bone volume.
  • Figure 20 shows the effects of Actrlla-mFc on trabecular architecture in the distal femur.
  • Figure 21 shows the effects of Actrlla-mFc on cortical bone.
  • Figure 22 shows the effects of Actrlla-mFc on the mechanical strength of bone.
  • Figure 23 shows the effects of different doses of ActRIIa-mFc on bone characteristics at three different dosages.
  • Figure 24 shows bone histomorphometry indicating that ActRIIa-mFc has dual anabolic and anti-resorptive activity.
  • Figure 25 shows additional histomorphometric data.
  • Figure 26 shows images of mouse femurs from naive and tumor-carrying mice, and the effects of ActRIIa-mFc treatment on bone morphology in the multiple myeloma model. Mice carrying multiple myeloma tumors (5T2) show marked pitting and degradation in the bone relative to normal mice (naive). Treatment with ActRIIa-mFc eliminates this effect.
  • Figure 27 shows results from the human clinical trial described in Example 5, where the area-under-curve (AUC) and administered dose of ActRIIa-hFc have a linear correlation, regardless of whether ActRIIa-hFc was administered intravenously (IV) or subcutaneously (SC).
  • AUC area-under-curve
  • IV intravenously
  • SC subcutaneously
  • Figure 28 shows a comparison of serum levels of ActRIIa-hFc in patients administered IV or SC.
  • Figure 29 shows bone alkaline phosphatase (BAP) levels in response to different dose levels of ActRIIa-hFc.
  • BAP is a marker for anabolic bone growth.
  • Figure 30 shows the cooperative effects of ActRIIa-mFc (RAP-01 1) and a bisphosphonate agent (zoledronate) in mice.
  • RAP-011 ActRIIa-mFc
  • zoledronate bisphosphonate agent
  • TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis, cardiogenesis, hematopoiesis, neurogenesis, and epithelial cell differentiation. The family is divided into two general branches: the BMP/GDF and the TGF-beta/Activin/BMP 10 branches, whose members have diverse, often complementary effects.
  • Activins are dimeric polypeptide growth factors that belong to the TGF-beta superfamily. There are three principle activin forms (A, B, and AB) that are homo/heterodimers of two closely related ⁇ subunits (P A P A , P B P B , and P A P B )- The human genome also encodes an activin C and an activin E, which are primarily expressed in the liver.
  • activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos (DePaolo et al., 1991 , Proc Soc Ep Biol Med. 198:500-512; Dyson et al., 1997, Curr Biol. 7:81 -84; Woodruff, 1998, Biochem Pharmacol. 55:953-963).
  • erythroid differentiation factor isolated from the stimulated human monocytic leukemic cells was found to be identical to activin A (Murata et al., 1988, PNAS, 85:2434). It has been suggested that activin A acts as a natural, positive regulator of erythropoiesis in the bone marrow. In several tissues, activin signaling is antagonized by its related heterodimer, inhibin. For example, during the release of follicle- stimulating hormone (FSH) from the pituitary, activin promotes FSH secretion and synthesis, while inhibin prevents FSH secretion and synthesis.
  • FSH follicle- stimulating hormone
  • TGF- ⁇ signals are mediated by heteromeric complexes of type I and type II serine/ threonine kinase receptors, which phosphorylate and activate downstream Smad proteins upon ligand stimulation (Massague, 2000, Nat. Rev. MoI. Cell Biol. 1 : 169-178).
  • type I and type II receptors are transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
  • Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors.
  • Type I and II activin receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
  • ActRIIa and ActRIIb Two related type II receptors, ActRIIa and ActRIIb, have been identified as the type II receptors for activins (Mathews and Vale, 1991 , Cell 65:973-982; Attisano et al., 1992, Cell 68: 97-108). Besides activins, ActRIIa and ActRIIb can biochemically interact with several other TGF- ⁇ family proteins, including BMP7, Nodal, GDF8, and GDFl 1 (Yamashita et al., 1995, J. Cell Biol. 130:217-226; Lee and McPherron, 2001, Proc. Natl. Acad. Sci. 98:9306- 931 1 ; Yeo and Whitman, 2001 , MoI.
  • BMP7, Nodal, GDF8, and GDFl 1 Yamashita et al., 1995, J. Cell Biol. 130:217-226; Lee and McPherron,
  • ALK4 is the primary type I receptor for activins, particularly for activin A, and ALK-7 may serve as a receptor for activins as well, particularly for activin B.
  • sActRIIa a soluble ActRIIa polypeptide
  • GDF8 or GDFl 1 TGF-beta family members
  • ActRIIa-activin antagonists do increase bone density in normal mice, in mouse models for osteoporosis and in a mouse model of multiple myeloma.
  • bone is a dynamic tissue, with growth or shrinkage and increased or decreased density depending on a balance of factors that produce bone and stimulate mineralization (primarily osteoblasts) and factors that destroy and demineralize bone (primarily osteoclasts).
  • Bone growth and mineralization may be increased by increasing the productive factors, by decreasing the destructive factors, or both.
  • the terms "promote bone growth” and "increase bone mineralization” refer to the observable physical changes in bone and are intended to be neutral as to the mechanism by which changes in bone occur.
  • mice models for osteoporosis and bone growth/density that were used in the studies described herein are considered to be highly predictive of efficacy in humans, and therefore, this disclosure provides methods for using ActRIIa polypeptides and other activin- ActRIIa antagonists to promote bone growth and increase bone density in humans.
  • Activin- ActRIIa antagonists include, for example, activin-binding soluble ActRIIa polypeptides, antibodies that bind to activin (particularly the activin A or B subunits, also referred to as ⁇ A or ⁇ B) and disrupt ActRIIa binding, antibodies that bind to ActRIIa and disrupt activin binding, non-antibody proteins selected for activin or ActRIIa binding (see e.g., WO/2002/088171 , WO/2006/055689, and WO/2002/032925 for examples of such proteins and methods for design and selection of such non-antibody affinity binding reagents), and randomized peptides selected for activin or ActRIIa binding, often affixed to an Fc domain.
  • activin binders that block the type I (e.g., a soluble type I activin receptor) and type II (e.g., a soluble type II activin receptor) binding sites, respectively, may be linked together to create a bifunctional binding molecule.
  • activin-ActRIIa antagonist activity including inhibin (i.e., inhibin alpha subunit), although inhibin does not universally antagonize activin in all tissues, follistatin (e.g., follistatin-288 and follistatin-315), FSRP, activin C, alpha(2)-macroglobulin, and an M108A (methionine to alanine change at position 108) mutant activin A.
  • inhibin i.e., inhibin alpha subunit
  • follistatin e.g., follistatin-288 and follistatin-315
  • FSRP follistatin
  • activin C alpha(2)-macroglobulin
  • M108A methionine to alanine change at position 108 mutant activin A.
  • alternative forms of activin particularly those with alterations in the type I receptor binding domain can bind to type II receptors and fail to form an active ternary complex, thus acting as antagonists
  • nucleic acids such as antisense molecules, siRNAs or ribozymes that inhibit activin A, B, C or E, or, particularly, ActRIIa expression
  • the activin- ActRIIa antagonist to be used will exhibit selectivity for inhibiting activin-mediated signaling versus other members of the TGF-beta family, and particularly with respect to GDF8 and GDFl 1.
  • Soluble ActRIIb proteins do bind to activin, however, the wild type protein does not exhibit significant selectivity in binding to activin versus GDF8/1 1 , and preliminary experiments suggest that this protein does not provide the desired effects on bone, while also causing substantial muscle growth.
  • ActRIIb with different binding properties have been identified (see, e.g., WO 2006/012627, pp. 55-59, incorporated herein by reference) and these proteins may achieve the desired effects on bone.
  • Native or altered ActRIIb may be given added specificity for activin by coupling with a second, activin- selective binding agent.
  • the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably within 5- fold and more preferably within 2-fold of a given value. Numerical quantities given herein are approximate unless stated otherwise, meaning that the term “about” or “approximately” can be inferred when not expressly stated.
  • the methods of the invention may include steps of comparing sequences to each other, including wild-type sequence to one or more mutants (sequence variants).
  • Such comparisons typically comprise alignments of polymer sequences, e.g., using sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
  • sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
  • sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
  • sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
  • sequence similarity when modified with an adverb such as “highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
  • ActRIIa refers to a family of activin receptor type Ha (ActRIIa) proteins from any species and variants derived from such ActRIIa proteins by mutagenesis or other modification. Reference to ActRIIa herein is understood to be a reference to any one of the currently identified forms. Members of the ActRIIa family are generally transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
  • ActRIIa polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIa family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
  • ActRIIa polypeptides include polypeptides derived from the sequence of any known ActRIIa having a sequence at least about 80% identical to the sequence of an ActRIIa polypeptide, and preferably at least 85%, 90%, 95%, 97%, 99% or greater identity.
  • an ActRIIa polypeptide of the invention may bind to and inhibit the function of an ActRIIa protein and/or activin.
  • an ActRIIa polypeptide promotes bone growth and bone mineralization.
  • Examples of ActRIIa polypeptides include human ActRIIa precursor polypeptide (SEQ ID NO: 1) and soluble human ActRIIa polypeptides (e.g., SEQ ID NOs: 2, 3, 7 and 12).
  • the human ActRIIa precursor protein sequence is as follows: MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEP CYGDKDKRRHCFATWKHISGSIEIVKQGCWLDDINCYDRTDCVEKKDSP EVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNILLYSLVPL
  • the signal peptide is single underlined; the extracellular domain is in bold and the potential N-linked glycosylation sites are double underlined.
  • the human ActRIIa soluble (extracellular), processed polypeptide sequence is as follows:
  • nucleic acid sequence encoding human ActRIIa precursor protein is as follows(nucleotides 164-1705 of Genbank entry NMJ)Ol 616):
  • the nucleic acid sequence encoding a human ActRIIa soluble (extracellular) polypeptide is as follows:
  • the invention relates to soluble ActRIIa polypeptides.
  • soluble ActRIIa polypeptide generally refers to polypeptides comprising an extracellular domain of an ActRIIa protein.
  • soluble ActRIIa polypeptide includes any naturally occurring extracellular domain of an ActRIIa protein as well as any variants thereof (including mutants, fragments and peptidomimetic forms).
  • An activin-binding ActRIIa polypeptide is one that retains the ability to bind to activin, particularly activin AA, AB or BB.
  • an activin-binding ActRIIa polypeptide will bind to activin AA with a dissociation constant of 1 nM or less.
  • Amino acid sequences of human ActRIIa precursor protein is provided below.
  • the extracellular domain of an ActRIIa protein binds to activin and is generally soluble, and thus can be termed a soluble, activin-binding ActRIIa polypeptide.
  • Examples of soluble, activin-binding ActRIIa polypeptides include the soluble polypeptide illustrated in SEQ ID NOs: 2, 3, 7, 12 and 13.
  • SEQ ID NO:7 is referred to as ActRIIa-hFc, and is described further in the Examples.
  • soluble, activin-binding ActRIIa polypeptides comprise a signal sequence in addition to the extracellular domain of an ActRIIa protein, for example, the honey bee mellitin leader sequence (SEQ ID NO: 8), the tissue plaminogen activator (TPA) leader (SEQ ID NO: 9) or the native ActRIIa leader (SEQ ID NO: 10).
  • the ActRIIa-hFc polypeptide illustrated in SEQ ID NO: 13 uses a TPA leader.
  • Functionally active fragments of ActRIIa polypeptides can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRIIa polypeptide.
  • fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry.
  • the fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments that can function as antagonists (inhibitors) of ActRIIa protein or signaling mediated by activin.
  • a functional variant of the ActRIIa polypeptides can be obtained by screening libraries of modified polypeptides recombinantly produced from the corresponding mutagenized nucleic acids encoding an ActRIIa polypeptide. The variants can be produced and tested to identify those that can function as antagonists (inhibitors) of ActRIIa protein or signaling mediated by activin.
  • a functional variant of the ActRIIa polypeptides comprises an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 2 or 3. In certain cases, the functional variant has an amino acid sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 2 or 3.
  • Functional variants may be generated by modifying the structure of an ActRIIa polypeptide for such purposes as enhancing therapeutic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
  • modified ActRIIa polypeptides when selected to retain activin binding, are considered functional equivalents of the naturally-occurring ActRIIa polypeptides.
  • Modified ActRIIa polypeptides can also be produced, for instance, by amino acid substitution, deletion, or addition.
  • the present invention contemplates specific mutations of the ActRIIa polypeptides so as to alter the glycosylation of the polypeptide. Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
  • Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine (or asparagines-X-serine) (where
  • X is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
  • the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type ActRIIa polypeptide (for O- linked glycosylation sites).
  • a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
  • Another means of increasing the number of carbohydrate moieties on an ActRIIa polypeptide is by chemical or enzymatic coupling of glycosides to the ActRIIa polypeptide.
  • the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine.
  • Removal of one or more carbohydrate moieties present on an ActRIIa polypeptide may be accomplished chemically and/or enzymatically.
  • Chemical deglycosylation may involve, for example, exposure of the ActRIIa polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetyl glucosamine or N- acetylgalactosamine), while leaving the amino acid sequence intact.
  • Chemical deglycosylation is further described by Hakimuddin et al. (1987) Arch. Biochem. Biophys. 259:52 and by Edge et al. (1981) Anal. Biochem. 118:131.
  • Enzymatic cleavage of carbohydrate moieties on ActRIIa polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. (1987) Meth. Enzymol. 138:350.
  • the sequence of an ActRIIa polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
  • ActRIIa proteins for use in humans will be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines, yeast cell lines with engineered glycosylation enzymes and insect cells are expected to be useful as well.
  • This disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of an ActRIIa polypeptide, as well as truncation mutants; pools of combinatorial mutants are especially useful for identifying functional variant sequences.
  • the purpose of screening such combinatorial libraries may be to generate, for example, ActRIIa polypeptide variants which can act as either agonists or antagonist, or alternatively, which possess novel activities all together.
  • an ActRIIa polypeptide variant may be screened for ability to bind to an ActRIIa ligand, to prevent binding of an ActRIIa ligand to an ActRIIa polypeptide or to interfere with signaling caused by an ActRIIa ligand.
  • an ActRIIa polypeptide or its variants may also be tested in a cell- based or in vivo assay. For example, the effect of an ActRIIa polypeptide variant on the expression of genes involved in bone production or bone destruction may be assessed. This may, as needed, be performed in the presence of one or more recombinant ActRIIa ligand proteins (e.g., activin), and cells may be transfected so as to produce an ActRIIa polypeptide and/or variants thereof, and optionally, an ActRIIa ligand. Likewise, an ActRIIa polypeptide may be administered to a mouse or other animal, and one or more bone properties, such as density or volume may be assessed. The healing rate for bone fractures may also be evaluated.
  • ActRIIa polypeptide may be administered to a mouse or other animal, and one or more bone properties, such as density or volume may be assessed. The healing rate for bone fractures may also be evaluated.
  • Dual-energy x-ray absorptiometry is a well-established, non-invasive, quantitative technique for assessing bone density in an animal.
  • central DEXA systems may be used to evaluate bone density in the spine and pelvis. These are the best predictors of overall bone density.
  • Peripheral DEXA systems may be used to evaluate bone density in peripheral bones, including, for example, the bones of the hand, wrist, ankle and foot.
  • Traditional x-ray imaging systems, including CAT scans may be used to evaluate bone growth and fracture healing. The mechanical strength of bone may also be evaluated.
  • Combinatorially-derived variants can be generated which have a selective or generally increased potency relative to a naturally occurring ActRIIa polypeptide.
  • mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding a wild-type ActRIIa polypeptide.
  • the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction of, or otherwise inactivation of a native ActRIIa polypeptide.
  • Such variants, and the genes which encode them can be utilized to alter ActRIIa polypeptide levels by modulating the half-life of the ActRIIa polypeptides.
  • a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ActRIIa polypeptide sequences.
  • a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ActRIIa polypeptide nucleotide sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display).
  • the library of potential homologs can be generated from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes then be ligated into an appropriate vector for expression.
  • ActRIIa polypeptide variants can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis and the like (Ruf et al., (1994) Biochemistry 33:1565-1572; Wang et al., (1994) J. Biol. Chem. 269:3095-3099; Balint et al., (1993) Gene 137:109-118; Grodberg et al., (1993) Eur. J. Biochem. 218:597- 601 ; Nagashima et al., (1993) J. Biol. Chem.
  • a wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations and truncations, and, for that matter, for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of ActRIIa polypeptides.
  • the most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
  • Preferred assays include activin binding assays and activin-mediated cell signaling assays.
  • the ActRIIa polypeptides of the invention may further comprise post-translational modifications in addition to any that are naturally present in the ActRIIa polypeptides.
  • modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
  • the modified ActRIIa polypeptides may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a ActRIIa polypeptide may be tested as described herein for other ActRIIa polypeptide variants.
  • an ActRIIa polypeptide When an ActRIIa polypeptide is produced in cells by cleaving a nascent form of the ActRIIa polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
  • Different cells such as CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ActRIIa polypeptides.
  • fusion proteins having at least a portion of the ActRIIa polypeptides and one or more fusion domains.
  • fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
  • a fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
  • matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
  • Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners.
  • a fusion domain may be selected so as to facilitate detection of the ActRIIa polypeptides. Examples of such detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
  • fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
  • an ActRIIa polypeptide is fused with a domain that stabilizes the ActRIIa polypeptide in vivo (a "stabilizer" domain).
  • stabilizing is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin can confer desirable properties. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, such as further stimulation of bone growth or muscle growth, as desired).
  • the present invention provides a fusion protein comprising a soluble extracellular domain of ActRIIa fused to an Fc domain (e.g., SEQ ID NO: 6).
  • the Fc domain has one or more mutations at residues such as Asp-265, lysine 322, and Asn-434.
  • the mutant Fc domain having one or more of these mutations e.g., Asp-265 mutation
  • the mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I- related Fc-receptor (FcRN) relative to a wildtype Fc domain.
  • an ActRIIa polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an ActRIIa polypeptide.
  • the ActRIIa polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
  • the ActRIIa polypeptides of the present invention contain one or more modifications that are capable of stabilizing the ActRIIa polypeptides.
  • Such modifications enhance the in vitro half life of the ActRIIa polypeptides, enhance circulatory half life of the ActRIIa polypeptides or reduce proteolytic degradation of the ActRIIa polypeptides.
  • stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ActRIIa polypeptide and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to an ActRIIa polypeptide), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from an ActRIIa polypeptide).
  • an ActRTIa polypeptide is fused to a stabilizer domain such as an IgG molecule (e.g., an Fc domain).
  • a stabilizer domain such as an IgG molecule
  • the term "stabilizer domain” not only refers to a fusion domain (e.g., Fc) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous polymer, such as polyethylene glycol.
  • the present invention makes available isolated and/or purified forms of the ActRIIa polypeptides, which are isolated from, or otherwise substantially free of, other proteins.
  • ActRIIa polypeptides will generally be produced by expression from recombinant nucleic acids. 3. Nucleic Acids Encoding ActRlIa Polypeptides
  • the invention provides isolated and/or recombinant nucleic acids encoding any of the ActRIIa polypeptides (e.g., soluble ActRIIa polypeptides), including fragments, functional variants and fusion proteins disclosed herein.
  • SEQ ID NO: 4 encodes the naturally occurring human ActRIIa precursor polypeptide
  • SEQ ID NO: 5 encodes the processed extracellular domain of ActRIIa.
  • the subject nucleic acids may be single-stranded or double stranded.
  • Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ActRIIa polypeptides or as direct therapeutic agents (e.g., in a gene therapy approach).
  • the subject nucleic acids encoding ActRIIa polypeptides are further understood to include nucleic acids that are variants of SEQ ID NO: 4 or 5.
  • Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants.
  • the invention provides isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 4 or 5.
  • nucleic acid sequences complementary to SEQ ID NO: 4 or 5, and variants of SEQ ID NO: 4 or 5 are also within the scope of this invention.
  • the nucleic acid sequences of the invention can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
  • nucleic acids of the invention also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NO: 4 or 5, complement sequence of SEQ ID NO: 4 or 5, or fragments thereof.
  • appropriate stringency conditions which promote DNA hybridization can be varied.
  • appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 °C, followed by a wash of 2.0 x SSC at 50 °C.
  • the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 0 C to a high stringency of about 0.2 x
  • the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 0 C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
  • the invention provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
  • Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 4 or 5 due to degeneracy in the genetic code are also within the scope of the invention.
  • a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
  • CAU and CAC are synonyms for histidine
  • nucleotides up to about 3-5% of the nucleotides
  • nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this invention.
  • the recombinant nucleic acids of the invention may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
  • Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
  • said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the invention.
  • the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
  • An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
  • the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
  • the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an ActRIIa polypeptide and operably linked to at least one regulatory sequence. Regulatory sequences are art-recognized and are selected to direct expression of the ActRIIa polypeptide.
  • regulatory sequence includes promoters, enhancers, and other expression control elements.
  • Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990).
  • any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRIIa polypeptide.
  • Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast ⁇ -mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
  • the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
  • a recombinant nucleic acid of the invention can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
  • Expression vehicles for production of a recombinant ActRIIa polypeptide include plasmids and other vectors.
  • suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL- derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E.
  • Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
  • the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
  • vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
  • bacterial plasmids such as pBR322
  • derivatives of viruses such as the bovine papilloma virus (BPV-I), or Epstein- Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
  • BBV-I bovine papilloma virus
  • pHEBo Epstein- Barr virus
  • examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
  • the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
  • baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
  • pVL-derived vectors such as pVL1392, pVL1393 and pVL941
  • pAcUW-derived vectors such as pAcUWl
  • pBlueBac-derived vectors such as the ⁇ -gal containing pBlueBac III.
  • a vector will be designed for production of the subject ActRIIa polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
  • a Pcmv-Script vector (Stratagene, La Jolla, Calif)
  • pcDNA4 vectors Invitrogen, Carlsbad, Calif.
  • pCI-neo vectors Promega, Madison, Wise
  • This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence (e.g., SEQ ID NO: 4 or 5) for one or more of the subject ActRIIa polypeptides.
  • the host cell may be any prokaryotic or eukaryotic cell.
  • an ActRIIa polypeptide of the invention may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
  • the present invention further pertains to methods of producing the subject ActRIIa polypeptides.
  • a host cell transfected with an expression vector encoding an ActRIIa polypeptide can be cultured under appropriate conditions to allow expression of the ActRIIa polypeptide to occur.
  • the ActRIIa polypeptide may be secreted and isolated from a mixture of cells and medium containing the ActRIIa polypeptide.
  • the ActRIIa polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
  • a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
  • the subject ActRIIa polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffinity purification with antibodies specific for particular epitopes of the ActRIIa polypeptides and affinity purification with an agent that binds to a domain fused to the
  • ActRIIa polypeptide e.g., a protein A column may be used to purify an ActRIIa-Fc fusion.
  • the ActRIIa polypeptide is a fusion protein containing a domain which facilitates its purification.
  • purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography, and cation exchange chromatography. The purification could be completed with viral filtration and buffer exchange.
  • ActRIIa-hFc protein was purified to a purity of >98% as determined by size exclusion chromatography and >95% as determined by SDS PAGE. This level of purity was sufficient to achieve desirable effects on bone in mice and an acceptable safety profile in mice, rats and non-human primates.
  • a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ActRIIa polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin.
  • the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRIIa polypeptide (e.g., see Hochuli et al., (1987) J. Chromatography 41 1 :177; and Janknecht et al., PNAS USA 88:8972).
  • fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992).
  • activin- ActRIIa signaling can be used to promote bone growth and bone mineralization.
  • soluble ActRIIa polypeptides, and particularly Actrlla-Fc are preferred antagonists, and although such antagonists may affect bone through a mechanism other than activin antagonism (e.g., activin inhibition may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of molecules, including, perhaps, other members of the TGF-beta superfamily, and such collective inhibition may lead to the desired effect on bone)
  • other types of activin- ActRIIa antagonists are expected to be useful, including anti-activin (e.g., A, B, C or E) antibodies, anti-ActRIIa antibodies, antisense, RNAi or ribozyme nucleic acids that inhibit the production of ActRIIa and other inhibitors of activin or ActRIIa, particularly those that disrupt activin-ActRIIa binding.
  • an antibody that is specifically reactive with an ActRIIa polypeptide e.g., a soluble ActRIIa polypeptide
  • an antibody that is specifically reactive with an activin A polypeptide and which disrupts ActRIIa binding may be used as an antagonist.
  • an antibody that is specifically reactive with an activin A polypeptide and which disrupts ActRIIa binding may be used as an antagonist.
  • a mammal such as a mouse, a hamster or rabbit can be immunized with an immunogenic form of the ActRIIa polypeptide, an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
  • Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
  • An immunogenic portion of an ActRIIa or activin polypeptide can be administered in the presence of adjuvant. The progress of immunization can be monitored by detection of antibody titers in plasma or serum. Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibodies.
  • antibody-producing cells can be harvested from an immunized animal and fused by standard somatic cell fusion procedures with immortalizing cells such as myeloma cells to yield hybridoma cells.
  • Such techniques are well known in the art, and include, for example, the hybridoma technique (originally developed by Kohler and Milstein, (1975) Nature, 256: 495-497), the human B cell hybridoma technique (Kozbar et al., (1983) Immunology Today, 4: 72), and the EBV- hybridoma technique to produce human monoclonal antibodies (Cole et al., (1985)
  • Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with an ActRIIa polypeptide and monoclonal antibodies isolated from a culture comprising such hybridoma cells.
  • antibody as used herein is intended to include fragments thereof which are also specifically reactive with a subject polypeptide.
  • Antibodies can be fragmented using conventional techniques and the fragments screened for utility in the same manner as described above for whole antibodies. For example, F(ab)2 fragments can be generated by treating antibody with pepsin. The resulting F(ab)2 fragment can be treated to reduce disulfide bridges to produce Fab fragments.
  • the antibody of the present invention is further intended to include bispecific, single-chain, chimeric, humanized and fully human molecules having affinity for an ActRIIa or activin polypeptide conferred by at least one CDR region of the antibody.
  • An antibody may further comprise a label attached thereto and able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co- factor).
  • the antibody is a recombinant antibody, which term encompasses any antibody generated in part by techniques of molecular biology, including CDR-grafted or chimeric antibodies, human or other antibodies assembled from library- selected antibody domains, single chain antibodies and single domain antibodies (e.g., human V H proteins or camelid V HH proteins).
  • an antibody of the invention is a monoclonal antibody
  • the invention makes available methods for generating novel antibodies.
  • a method for generating a monoclonal antibody that binds specifically to an ActRIIa polypeptide or activin polypeptide may comprise administering to a mouse an amount of an immunogenic composition comprising the antigen polypeptide effective to stimulate a detectable immune response, obtaining antibody-producing cells (e.g., cells from the spleen) from the mouse and fusing the antibody-producing cells with myeloma cells to obtain antibody-producing hybridomas, and testing the antibody-producing hybridomas to identify a hybridoma that produces a monocolonal antibody that binds specifically to the antigen.
  • antibody-producing cells e.g., cells from the spleen
  • a hybridoma can be propagated in a cell culture, optionally in culture conditions where the hybridoma-derived cells produce the monoclonal antibody that binds specifically to the antigen.
  • the monoclonal antibody may be purified from the cell culture.
  • the adjective "specifically reactive with” as used in reference to an antibody is intended to mean, as is generally understood in the art, that the antibody is sufficiently selective between the antigen of interest (e.g., an ActRIIa polypeptide) and other antigens that are not of interest that the antibody is useful for, at minimum, detecting the presence of the antigen of interest in a particular type of biological sample. In certain methods employing the antibody, such as therapeutic applications, a higher degree of specificity in binding may be desirable. Monoclonal antibodies generally have a greater tendency (as compared to polyclonal antibodies) to discriminate effectively between the desired antigens and cross- reacting polypeptides. One characteristic that influences the specificity of an antibody:antigen interaction is the affinity of the antibody for the antigen.
  • antibodies will have an affinity (a dissociation constant) of about 10 "6 , 10 ⁇ 7 , 10 " , 10 " or less. Given the extraordinarily tight binding between activin and ActRIIa, it is expected that a neutralizing anti-activin or anti-ActRIIa antibody would generally have a dissociation constant of 10 "10 or less.
  • the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained. For example, if an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding.
  • a variety of different techniques are available for testing interaction between antibodies and antigens to identify particularly desirable antibodies. Such techniques include ELISAs, surface plasmon resonance binding assays (e.g., the BiacoreTM binding assay, Biacore AB, Uppsala, Sweden), sandwich assays (e.g., the paramagnetic bead system of IGEN International, Inc., Gaithersburg, Maryland), western blots, immunoprecipitation assays, and immunohi stochemi stry .
  • a nucleic acid compound may be single or double stranded.
  • a double stranded compound may also include regions of overhang or non-complementarity, where one or the other of the strands is single stranded.
  • a single stranded compound may include regions of self-complementarity, meaning that the compound forms a so-called "hairpin” or "stem-loop” structure, with a region of double helical structure.
  • a nucleic acid compound may comprise a nucleotide sequence that is complementary to a region consisting of no more than 1000, no more than 500, no more than 250, no more than 100 or no more than 50, 35, 30, 25, 22, 20 or 18 nucleotides of the full-length ActRIIa nucleic acid sequence or activin ⁇ A or activin ⁇ B nucleic acid sequence.
  • the region of complementarity will preferably be at least 8 nucleotides, and optionally at least 10 or at least 15 nucleotides, and optionally between 15 and 25 nucleotides.
  • a region of complementarity may fall within an intron, a coding sequence or a noncoding sequence of the target transcript, such as the coding sequence portion.
  • a nucleic acid compound will have a length of about 8 to about 500 nucleotides or base pairs in length, and optionally the length will be about 14 to about 50 nucleotides.
  • a nucleic acid may be a DNA (particularly for use as an antisense), RNA or RNA:DNA hybrid. Any one strand may include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
  • a double stranded compound may be DNA:DNA, DNA:RNA or RNA:RNA, and any one strand may also include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
  • a nucleic acid compound may include any of a variety of modifications, including one or modifications to the backbone (the sugar-phosphate portion in a natural nucleic acid, including internucleotide linkages) or the base portion (the purine or pyrimidine portion of a natural nucleic acid).
  • An antisense nucleic acid compound will preferably have a length of about 15 to about 30 nucleotides and will often contain one or more modifications to improve characteristics such as stability in the serum, in a cell or in a place where the compound is likely to be delivered, such as the stomach in the case of orally delivered compounds and the lung for inhaled compounds.
  • the strand complementary to the target transcript will generally be RNA or modifications thereof.
  • the other strand may be RNA, DNA or any other variation.
  • the duplex portion of double stranded or single stranded "hairpin" RNAi construct will preferably have a length of 18 to 40 nucleotides in length and optionally about 21 to 23 nucleotides in length, so long as it serves as a Dicer substrate.
  • Catalytic or enzymatic nucleic acids may be ribozymes or DNA enzymes and may also contain modified forms.
  • Nucleic acid compounds may inhibit expression of the target by about 50%, 75%, 90% or more when contacted with cells under physiological conditions and at a concentration where a nonsense or sense control has little or no effect. Preferred concentrations for testing the effect of nucleic acid compounds are 1, 5 and 10 micromolar. Nucleic acid compounds may also be tested for effects on, for example, bone growth and mineralization.
  • the present invention relates to the use of ActRIIa polypeptides (e.g., soluble ActRIIa polypeptides) and activin polypeptides to identify compounds (agents) which are agonist or antagonists of the activin-ActRIIa signaling pathway.
  • Compounds identified through this screening can be tested to assess their ability to modulate bone growth or mineralization in vitro.
  • these compounds can further be tested in animal models to assess their ability to modulate tissue growth in vivo.
  • high- throughput screening of compounds can be carried out to identify agents that perturb activin or ActRIIa-mediated effects on bone.
  • the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ActRIIa polypeptide to activin.
  • the assay can be used to identify compounds that enhance binding of an ActRIIa polypeptide to activin.
  • the compounds can be identified by their ability to interact with an activin or ActRIIa polypeptide.
  • a variety of assay formats will suffice and, in light of the present disclosure, those not expressly described herein will nevertheless be comprehended by one of ordinary skill in the art.
  • the test compounds (agents) of the invention may be created by any combinatorial chemical method.
  • the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
  • Test compounds contemplated by the present invention include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
  • the test agent is a small organic molecule having a molecular weight of less than about 2,000 daltons.
  • test compounds of the invention can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry.
  • libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds.
  • Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
  • the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
  • Non- limiting examples of derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S transferase (GST), photoactivatible crosslinkers or any combinations thereof.
  • high throughput assays are desirable in order to maximize the number of compounds surveyed in a given period of time.
  • Assays which are performed in cell-free systems, such as may be derived with purified or semi-purified proteins are often preferred as "primary" screens in that they can be generated to permit rapid development and relatively easy detection of an alteration in a molecular target which is mediated by a test compound.
  • test compound can be generally ignored in the in vitro system, the assay instead being focused primarily on the effect of the drug on the molecular target as may be manifest in an alteration of binding affinity between an ActRIIa polypeptide and activin.
  • the compound of interest is contacted with an isolated and purified ActRIIa polypeptide which is ordinarily capable of binding to activin.
  • an isolated and purified ActRIIa polypeptide which is ordinarily capable of binding to activin.
  • a composition containing an ActRIIa ligand is then added to the mixture of the compound and ActRIIa polypeptide.
  • Detection and quantification of ActRIIa/activin complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the ActRIIa polypeptide and activin.
  • the efficacy of the compound can be assessed by generating dose response curves from data obtained using various concentrations of the test compound.
  • a control assay can also be performed to provide a baseline for comparison.
  • a composition containing the ActRIIa polypeptide for example, isolated and purified activin is added to a composition containing the ActRIIa polypeptide, and the formation of ActRIIa/activin complex is quantitated in the absence of the test compound.
  • reactants may be admixed can be varied, and can be admixed simultaneously.
  • cellular extracts and lysates may be used to render a suitable cell- free assay system.
  • Complex formation between the ActRIIa polypeptide and activin may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIa polypeptide or activin, by immunoassay, or by chromatographic detection.
  • the present invention contemplates the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ActRIIa polypeptide and its binding protein.
  • FRET fluorescence resonance energy transfer
  • an interaction trap assay also known as the "two hybrid assay," for identifying agents that disrupt or potentiate interaction between an ActRIIa polypeptide and its binding protein. See for example, U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem 268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; and Iwabuchi et al. (1993) Oncogene 8:1693-1696).
  • the present invention contemplates the use of reverse two hybrid systems to identify compounds (e.g., small molecules or peptides) that dissociate interactions between an ActRIIa polypeptide and its binding protein. See for example, Vidal and Legrain, (1999) Nucleic Acids Res 27:919-29; Vidal and Legrain, (1999) Trends Biotechnol 17:374-81 ; and U.S. Pat. Nos. 5,525,490; 5,955,280; and 5,965,368.
  • compounds e.g., small molecules or peptides
  • the subject compounds are identified by their ability to interact with an ActRIIa or activin polypeptide of the invention.
  • the interaction between the compound and the ActRIIa or activin polypeptide may be covalent or non-covalent.
  • such interaction can be identified at the protein level using in vitro biochemical methods, including photo-crosslinking, radiolabeled ligand binding, and affinity chromatography (Jakoby WB et al., 1974, Methods in Enzymology 46: 1).
  • the compounds may be screened in a mechanism based assay, such as an assay to detect compounds which bind to an activin or ActRIIa polypeptide. This may include a solid phase or fluid phase binding event.
  • the gene encoding an activin or ActRIIa polypeptide can be transfected with a reporter system (e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library preferably by a high throughput screening or with individual members of the library.
  • a reporter system e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein
  • Other mechanism based binding assays may be used, for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric or fluorescence or surface plasmon resonance.
  • the present invention provides methods and agents for modulating (stimulating or inhibiting) bone formation and increasing bone mass. Therefore, any compound identified can be tested in whole cells or tissues, in vitro or in vivo, to confirm their ability to modulate bone growth or mineralization. Various methods known in the art can be utilized for this purpose.
  • the effect of the ActRIIa or activin polypeptides or test compounds on bone or cartilage growth can be determined by measuring induction of Msx2 or differentiation of osteoprogenitor cells into osteoblasts in cell based assays (see, e.g., Daluiski et al., Nat Genet. 2001, 27(l):84-8; Hino et al., Front Biosci. 2004, 9: 1520-9).
  • cell-based assays includes analyzing the osteogenic activity of the subject ActRIIa or activin polypeptides and test compounds in mesenchymal progenitor and osteoblastic cells.
  • recombinant adenoviruses expressing an activin or ActRIIa polypeptide can be constructed to infect pluripotent mesenchymal progenitor C3 H 1OT 1/2 cells, preosteoblastic C2C12 cells, and osteoblastic TE-85 cells. Osteogenic activity is then determined by measuring the induction of alkaline phosphatase, osteocalcin, and matrix mineralization (see, e.g., Cheng et al., J bone Joint Surg Am. 2003, 85-A(8): 1544-52). The present invention also contemplates in vivo assays to measure bone or cartilage growth.
  • Namkung-Matthai et al., Bone, 28:80-86 discloses a rat osteoporotic model in which bone repair during the early period after fracture is studied.
  • Kubo et al. Steroid Biochemistry & Molecular Biology, 68:197-202 (1999) also discloses a rat osteoporotic model in which bone repair during the late period after fracture is studied.
  • Andersson et al., J. Endocrinol. 170:529-537 describe a mouse osteoporosis model in which mice are ovariectomized, which causes the mice to lose substantial bone mineral content and bone mineral density, with the trabecular bone losing roughly 50% of bone mineral density.
  • Bone density could be increased in the ovariectomized mice by administration of factors such as parathyroid hormone.
  • the present invention makes use of fracture healing assays that are known in the art. These assays include fracture technique, histological analysis, and biomechanical analysis, which are described in, for example, U.S. Pat. No. 6,521,750, which is incorporated by reference in its entirety for its disclosure of experimental protocols for causing as well as measuring the extent of fractures, and the repair process.
  • activin-ActRIIa antagonists e.g., ActRIIa polypeptides
  • activin-ActRIIa antagonists can be used for treating or preventing a disease or condition that is associated with bone damage, whether, e.g., through breakage, loss or demineralization.
  • activin-ActRIIa antagonists, and particularly ActRIIa-Fc constructs are effective in treating or preventing cancer-related bone loss.
  • the present invention provides methods of treating or preventing bone damage in an individual in need thereof through administering to the individual a therapeutically effective amount of an activin-ActRIIa antagonist, particularly an ActRIIa polypeptide.
  • the present invention provides methods of promoting bone growth or mineralization in an individual in need thereof through administering to the individual a therapeutically effective amount of an activin-ActRIIa antagonist, particularly an ActRIIa polypeptide. These methods are preferably aimed at therapeutic and prophylactic treatments of animals, and more preferably, humans.
  • the disclosure provides for the use of activin-ActRIIa antagonists (particularly soluble ActRIIa polypeptides and neutralizing antibodies targeted to activin or ActRIIa) for the treatment of disorders associated with low bone density or decreased bone strength.
  • a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
  • treating includes prophylaxis of the named condition or amelioration or elimination of the condition once it has been established. In either case, prevention or treatment may be discerned in the diagnosis provided by a physician and the intended result of administration of the therapeutic agent.
  • the disclosure provides methods of inducing bone and/or cartilage formation, preventing bone loss, increasing bone mineralization or preventing the demineralization of bone.
  • the subject activin-ActRIIa antagonists have application in treating osteoporosis and the healing of bone fractures and cartilage defects in humans and other animals.
  • ActRIIa or activin polypeptides may be useful in patients that are diagnosed with subclinical low bone density, as a protective measure against the development of osteoporosis.
  • methods and compositions of the present invention may find medical utility in the healing of bone fractures and cartilage defects in humans and other animals.
  • the subject methods and compositions may also have prophylactic use in closed as well as open fracture reduction and also in the improved fixation of artificial joints.
  • the subject activin-ActRIIa antagonists may provide an environment to attract bone-forming cells, stimulate growth of bone-forming cells or induce differentiation of progenitors of bone-forming cells.
  • Activin-ActRIIa antagonists of the invention may also be useful in the treatment of osteoporosis.
  • Methods and compositions of the invention can be applied to conditions characterized by or causing bone loss, such as osteoporosis (including secondary osteoporosis), hyperparathyroidism, Cushing's disease, Paget' s disease, thyrotoxicosis, chronic diarrheal state or malabsorption, renal tubular acidosis, or anorexia nervosa.
  • bone loss such as osteoporosis (including secondary osteoporosis), hyperparathyroidism, Cushing's disease, Paget' s disease, thyrotoxicosis, chronic diarrheal state or malabsorption, renal tubular acidosis, or anorexia nervosa.
  • Osteoporosis may be caused by, or associated with, various factors. Being female, particularly a post-menopausal female, having a low body weight, and leading a sedentary lifestyle are all risk factors for osteoporosis (loss of bone mineral density, leading to fracture risk).
  • Persons having any of the following profiles may be candidates for treatment with an ActRIIa antagonist: a post-menopausal woman and not taking estrogen or other hormone replacement therapy; a person with a personal or maternal history of hip fracture or smoking; a post-menopausal woman who is tall (over 5 feet 7 inches) or thin (less than 125 pounds); a man with clinical conditions associated with bone loss; a person using medications that are known to cause bone loss, including corticosteroids such as PrednisoneTM, various antiseizure medications such as DilantinTM and certain barbiturates, or high-dose thyroid replacement drugs; a person having type 1 diabetes, liver disease, kidney disease or a family history of osteoporosis; a person having high bone turnover (e.g., excessive collagen in urine samples); a person with a thyroid condition, such as hyperthyroidism; a person who has experienced a fracture after only mild trauma; a person who has had x-ray evidence of vertebral fracture or other signs of osteoporosis
  • osteoporosis can also result as a condition associated with another disorder or from the use of certain medications. Osteoporosis resulting from drugs or another medical condition is known as secondary osteoporosis. In a condition known as Cushing's disease, the excess amount of Cortisol produced by the body results in osteoporosis and fractures.
  • the most common medications associated with secondary osteoporosis are the corticosteroids, a class of drugs that act like Cortisol, a hormone produced naturally by the adrenal glands. Although adequate levels of thyroid hormones (which are produced by the thyroid gland) are needed for the development of the skeleton, excess thyroid hormone can decrease bone mass over time.
  • Antacids that contain aluminum can lead to bone loss when taken in high doses by people with kidney problems, particularly those undergoing dialysis.
  • Other medications that can cause secondary osteoporosis include phenytoin (Dilantin) and barbiturates that are used to prevent seizures; methotrexate (Rheumatrex, Immunex, Folex PFS), a drug for some forms of arthritis, cancer, and immune disorders; cyclosporine
  • CTIBL cancer therapy induced bone loss
  • activin-ActRIIa antagonists particularly a soluble ActRIIa, disclosed herein may be used in cancer patients.
  • Patients having certain tumors e.g. prostate, breast, multiple myeloma or any tumor causing hyperparathyroidism
  • Such patients may be treated with activin-ActRIIa antagonists even in the absence of evidence of bone loss or bone metastases.
  • Patients may also be monitored for evidence of bone loss or bone metastases, and may be treated with activin-ActRIIa antagonists in the event that indicators suggest an increased risk.
  • BSAP Bone specific alkaline phosphatase
  • Blood levels of BSAP are increased in patients with bone metastasis and other conditions that result in increased bone remodeling.
  • Osteocalcin and procollagen peptides are also associated with bone formation and bone metastases. Increases in BSAP have been detected in patients with bone metastasis caused by prostate cancer, and to a lesser degree, in bone metastases from breast cancer.
  • Bone Morpho genetic Protein-7 (BMP-7) levels are high in prostate cancer that has metastasized to bone, but not in bone metastases due to bladder, skin, liver, or lung cancer.
  • Type I Carboxy-terminal telopeptide (ICTP) is a crosslink found in collagen that is formed during to the resorption of bone. Since bone is constantly being broken down and reformed, ICTP will be found throughout the body. However, at the site of bone metastasis, the level will be significantly higher than in an area of normal bone. ICTP has been found in high levels in bone metastasis due to prostate, lung, and breast cancer.
  • Another collagen crosslink, Type I N-terminal telopeptide (NTx) is produced along with ICTP during bone turnover.
  • NTx The amount of NTx is increased in bone metastasis caused by many different types of cancer including lung, prostate, and breast cancer. Also, the levels of NTx increase with the progression of the bone metastasis. Therefore, this marker can be used to both detect metastasis as well as measure the extent of the disease. Other markers of resorption include pyridinoline and deoxypyridinoline. Any increase in resorption markers or markers of bone metastases indicate the need for activin-ActRIIa antagonist therapy in a patient.
  • Activin-ActRIIa antagonists may be conjointly administered with other pharmaceutical agents. Conjoint administration may be accomplished by administration of a single co-formulation, by simultaneous administration or by administration at separate times. Activin-ActRIIa antagonists may be particularly advantageous if administered with other bone-active agents. A patient may benefit from conjointly receiving activin-ActRIIa antagonist and taking calcium supplements, vitamin D, appropriate exercise and/or, in some cases, other medication. Examples of other medications incude, bisphosphonates (alendronate, ibandronate and risedronate), calcitonin, estrogens, parathyroid hormone and raloxifene.
  • the bisphosphonates (alendronate, ibandronate and risedronate), calcitonin, estrogens and raloxifene affect the bone remodeling cycle and are classified as anti-resorptive medications.
  • Bone remodeling consists of two distinct stages: bone resorption and bone formation. Anti-resorptive medications slow or stop the bone-resorbing portion of the bone- remodeling cycle but do not slow the bone-forming portion of the cycle. As a result, new formation continues at a greater rate than bone resorption, and bone density may increase over time.
  • Teriparatide a form of parathyroid hormone, increases the rate of bone formation in the bone remodeling cycle.
  • Alendronate is approved for both the prevention (5 mg per day or 35 mg once a week) and treatment (10 mg per day or 70 mg once a week) of postmenopausal osteoporosis. Alendronate reduces bone loss, increases bone density and reduces the risk of spine, wrist and hip fractures. Alendronate also is approved for treatment of glucocorticoid-induced osteoporosis in men and women as a result of long-term use of these medications (i.e., prednisone and cortisone) and for the treatment of osteoporosis in men.
  • these medications i.e., prednisone and cortisone
  • Alendronate plus vitamin D is approved for the treatment of osteoporosis in postmenopausal women (70 mg once a week plus vitamin D), and for treatment to improve bone mass in men with osteoporosis.
  • Ibandronate is approved for the prevention and treatment of postmenopausal osteoporosis. Taken as a once-a-month pill (150 mg), ibandronate should be taken on the same day each month. Ibandronate reduces bone loss, increases bone density and reduces the risk of spine fractures.
  • Risedronate is approved for the prevention and treatment of postmenopausal osteoporosis.
  • risedronate slows bone loss, increases bone density and reduces the risk of spine and non-spine fractures.
  • Risedronate also is approved for use by men and women to prevent and/or treat glucocorticoid-induced osteoporosis that results from long-term use of these medications (i.e., prednisone or cortisone).
  • Calcitonin is a naturally occurring hormone involved in calcium regulation and bone metabolism. In women who are more than 5 years beyond menopause, calcitonin slows bone loss, increases spinal bone density, and may relieve the pain associated with bone fractures. Calcitonin reduces the risk of spinal fractures.
  • Calcitonin is available as an injection (50-100 IU daily) or nasal spray (200 IU daily).
  • Estrogen therapy (ET)/Hormone therapy (HT) is approved for the prevention of osteoporosis.
  • ET has been shown to reduce bone loss, increase bone density in both the spine and hip, and reduce the risk of hip and spinal fractures in postmenopausal women.
  • ET is administered most commonly in the form of a pill or skin patch that delivers a low dose of approximately 0.3 mg daily or a standard dose of approximately 0.625 mg daily and is effective even when started after age 70. When estrogen is taken alone, it can increase a woman's risk of developing cancer of the uterine lining (endometrial cancer).
  • Raloxifene 60 mg a day, is approved for the prevention and treatment of postmenopausal osteoporosis. It is from a class of drugs called Selective Estrogen Receptor Modulators (SERMs) that have been developed to provide the beneficial effects of estrogens without their potential disadvantages. Raloxifene increases bone mass and reduces the risk of spine fractures.
  • SERMs Selective Estrogen Receptor Modulators
  • raloxifene can reduce the risk of hip and other non-spine fractures.
  • Teriparatide a form of parathyroid hormone, is approved for the treatment of osteoporosis in postmenopausal women and men who are at high risk for a fracture. This medication stimulates new bone formation and significantly increases bone mineral density.
  • fracture reduction was noted in the spine, hip, foot, ribs and wrist.
  • fracture reduction was noted in the spine, but there were insufficient data to evaluate fracture reduction at other sites.
  • Teriparatide is self-administered as a daily injection for up to 24 months.
  • activin-ActRIIa antagonists e.g., ActRIIa polypeptides
  • a pharmaceutically acceptable carrier for example, an ActRIIa polypeptide can be administered alone or as a component of a pharmaceutical formulation (therapeutic composition).
  • the subject compounds may be formulated for administration in any convenient way for use in human or veterinary medicine.
  • the therapeutic method of the invention includes administering the composition systemically, or locally as an implant or device.
  • the therapeutic composition for use in this invention is in a pyrogen-free, physiologically acceptable form.
  • Therapeutically useful agents other than the ActRIIa antagonists which may also optionally be included in the composition as described above, may be administered simultaneously or sequentially with the subject compounds (e.g., ActRIIa polypeptides) in the methods of the invention.
  • ActRIIa antagonists will be administered parentally, and particularly intravenously or subcutaneously.
  • Pharmaceutical compositions suitable for parenteral administration may comprise one or more ActRIIa polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
  • aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions of the present invention may include a matrix capable of delivering one or more therapeutic compounds (e.g., ActRIIa polypeptides) to a target tissue site (e.g., bone), providing a structure for the developing tissue and optimally capable of being resorbed into the body.
  • the matrix may provide slow release of the ActRIIa polypeptides.
  • Such matrices may be formed of materials presently in use for other implanted medical applications.
  • matrix material is based on biocompatibility, biodegradability, mechanical properties, cosmetic appearance and interface properties.
  • Potential matrices for the compositions may be biodegradable and chemically defined calcium sulfate, tricalciumphosphate, hydroxyapatite, polylactic acid and polyanhydrides.
  • Other potential materials are biodegradable and biologically well defined, such as bone or dermal collagen.
  • Further matrices are comprised of pure proteins or extracellular matrix components.
  • Other potential matrices are non-biodegradable and chemically defined, such as sintered hydroxyapatite, bioglass, aluminates, or other ceramics.
  • Matrices may be comprised of combinations of any of the above mentioned types of material, such as polylactic acid and hydroxyapatite or collagen and tricalciumphosphate.
  • the bioceramics may be altered in composition, such as in calcium-aluminate-phosphate and processing to alter pore size, particle size, particle shape, and biodegradability.
  • methods of the invention can be administered for orally, e.g., in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an agent as an active ingredient.
  • An agent may also be administered as a bolus, electuary or paste.
  • one or more therapeutic compounds of the present invention may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as
  • the pharmaceutical compositions may also comprise buffering agents.
  • Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
  • Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
  • the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
  • Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • the compositions of the invention may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like.
  • isotonic agents such as sugars, sodium chloride, and the like into the compositions.
  • prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin.
  • the dosage regimen will be determined by the attending physician considering various factors which modify the action of the subject compounds of the invention (e.g., ActRIIa polypeptides).
  • the various factors include, but are not limited to, amount of bone weight desired to be formed, the degree of bone density loss, the site of bone damage, the condition of the damaged bone, the patient's age, sex, and diet, the severity of any disease that may be contributing to bone loss, time of administration, and other clinical factors.
  • the dosage may vary with the type of matrix used in the reconstitution and the types of compounds in the composition.
  • the addition of other known growth factors to the final composition may also affect the dosage. Progress can be monitored by periodic assessment of bone growth and/or repair, for example, X-rays (including DEXA), histomorphometric determinations, and tetracycline labeling.
  • the observed serum half-life of the molecule is between about 25 and 35 days, substantially longer than most Fc fusion proteins, and thus a sustained effective serum level may be achieved, for example, by dosing with about 0.05 to 0.5 mg/kg on a weekly or biweekly basis, or higher doses may be used with longer intervals between dosings.
  • doses of 0.1, 0.3, 0.5, 0.7, 1, 2 or 3 mg/kg, or values in between might be used on a monthly or bimonthly basis, and the effect on bone may be sufficiently durable that dosing is necessary only once every 3, 4, 5, 6, 9, 12 or more months. Longer intervals between doses are further supported by the duration of the pharmacodynamic effect, which is longer than the duration of drug in the serum. PD effects are observed for at least 120 days in human patients.
  • the present invention also provides gene therapy for the in vivo production of ActRIIa polypeptides.
  • Such therapy would achieve its therapeutic effect by introduction of the ActRIIa polynucleotide sequences into cells or tissues having the disorders as listed above.
  • Delivery of ActRIIa polynucleotide sequences can be achieved using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system.
  • Preferred for therapeutic delivery of ActRIIa polynucleotide sequences is the use of targeted liposomes.
  • RNA virus such as a retrovirus
  • retroviral vector is a derivative of a murine or avian retrovirus.
  • retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV).
  • MoMuLV Moloney murine leukemia virus
  • HaMuSV Harvey murine sarcoma virus
  • MuMTV murine mammary tumor virus
  • RSV Rous Sarcoma Virus
  • Retroviral vectors can be made target- specific by attaching, for example, a sugar, a glycolipid, or a protein. Preferred targeting is accomplished by using an antibody.
  • specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing the ActRIIa polynucleotide.
  • the vector is targeted to bone or cartilage.
  • tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
  • colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • the preferred colloidal system of this invention is a liposome.
  • Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see e.g., Fraley, et al., Trends Biochem. ScL, 6:77, 1981).
  • compositions of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
  • the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
  • lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
  • Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine, and distearoylphosphatidylcholine.
  • the targeting of liposomes is also possible based on, for example, organ-specificity, cell-specificity, and organelle-specificity and is known in the art. EXEMPLIFICATION
  • Applicants constructed a soluble ActRIIa fusion protein that has the extracellular domain of human ActRIIa fused to a human or mouse Fc domain with a minimal linker in between.
  • the constructs are referred to as ActRIIa-hFc and ActRIIa-mFc, respectively.
  • ActRIIa-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 7):
  • the ActRIIa-hFc and ActRIIa-mFc proteins were expressed in CHO cell lines. Three different leader sequences were considered:
  • Tissue Plasminogen Activator Tissue Plasminogen Activator: MD AMKRGLCCVLLLCGA VFVSP (SEQ ID NO: 9)
  • ActRIIa-hFc and ActRIIa-mFc showed a high affinity for ligands, particularly activin A.
  • GDF-11 or Activin A (“ActA") were immobilized on a Biacore CM5 chip using standard amine coupling procedure.
  • ActA Activin A
  • ActA Activin A
  • ActIa-hFc and ActRIIa-mFc proteins were loaded onto the system, and binding was measured.
  • ActRIIa-hFc bound to activin with a dissociation constant (K 0 ) of 5xlO "12 , and the protein bound to GDFl 1 with a K 0 of 9.96xlO "9 . See figure 2.
  • ActRIIa-mFc behaved similarly.
  • An A-204 Reporter Gene Assay was used to evaluate the effects of ActRIIa-hFc proteins on signaling by GDF-1 1 and Activin A.
  • Cell line Human Rhabdomyosarcoma (derived from muscle).
  • Reporter vector pGL3(CAGA)12 (Described in Dennler et al, 1998, EMBO 17: 3091-3100.) See Figure 3.
  • the CAGAl 2 motif is present in TGF-Beta responsive genes ( PAI-I gene) , so this vector is of general use for factors signaling through Smad2 and 3.
  • Day 1 Split A-204 cells into 48-well plate.
  • Activin A shows roughly 10 fold stimulation of reporter gene expression and an ED50 ⁇ 2 ng/ml.
  • GDF-1 1 16 fold stimulation, ED50: ⁇ 1.5 ng/ml.
  • GDF-8 shows an effect similar to GDF-I l .
  • ActRIIa-hFc and ActRIIa-mFc inhibit GDF-8 mediated signaling at picomolar concentrations.
  • three different preparations of ActRIIa-hFc inhibited GDF-1 1 signaling with an IC50 of approximately 200 pM.
  • the ActRIIa-hFc was very stable in pharmacokinetic studies. Rats were dosed with 1 mg/kg, 3 mg/kg or 10 mg/kg of ActRIIa-hFc protein and plasma levels of the protein were measured at 24, 48, 72, 144 and 168 hours. In a separate study, rats were dosed at 1 mg/kg, 10 mg/kg or 30 mg/kg.
  • ActRIIa-hFc had an 11-14 day serum half life and circulating levels of the drug were quite high after two weeks (11 ⁇ g/ml, 1 10 ⁇ g/ml or 304 ⁇ g/ml for initial administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg, respectively.)
  • the plasma half life was substantially greater than 14 days and circulating levels of the drug were 25 ⁇ g/ml, 304 ⁇ g/ml or 1440 ⁇ g/ml for initial administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg, respectively.
  • Preliminary results in humans suggests that the serum half life is between about 20 and 30 days.
  • mice Normal female mice (BALB/c) were dosed with ActRIIa-mFc at a level of 1 mg/kg/dose, 3 mg/kg/dose or 10 mg/kg/dose, with doses given twice weekly. Bone mineral density and bone mineral content were determined by DEXA, see figure 6.
  • antagonism of ActRIIa caused increased bone density and content in normal female mice.
  • ActRIIa-mFc effect of ActRIIa-mFc on bone in a mouse model for osteoporosis was tested.
  • OVX mice ovariectomized (OVX) or sham operated mice as described above were treated with ActRIIa-mFc (10 mg/kg, twice weekly) or control (PBS) over twelve weeks. Similar to the results described above for ActRIIa-mFc, OVX mice receiving ActRIIa-mFc exhibited an increase in trabecular bone density of 15% by as early as four weeks and 25% after 12 weeks of treatment ( Figure 12). Sham operated mice receiving ActRIIa-mFc similarly showed an increase in trabecular bone density of 22% by as early as four weeks and of 32% after 12 weeks of treatment ( Figure 13). After twelve weeks of treatment with ActRIIa-mFc, whole body and ex vivo femur
  • Ex vivo pQCT analysis of the femoral midshaft demonstrated a significant increase in both total and cortical bone content after twelve weeks of treatment with ActRIIa-mFc while both ovariectomized and sham operated vehicle control-treated mice exhibited comparable bone content (Figure 16).
  • Ex vivo pQCT analysis of the femoral midshaft also showed that ActRIIa-mFc treated mice did not show a change in periosteal circumference; however ActRIIa-mFc treatment resulted in a decrease in endosteal circumference indicating an increase in cortical thickness due to growth on the inner surface of the femur ( Figure 17).
  • mice were ovariectomized or sham operated at 4 weeks, and beginning at 12 weeks received either placebo or ActRIIa-mFc (2 times/week, lOmg/kg) (also referred to as RAP-11 in Figures 19-24), for a further period of 12 weeks.
  • ActRIIa-mFc increased vertebral trabecular bone volume to total volume ratios (BV/TV) in both the OVX and SHAM operated mice.
  • ActRIIa-mFc also improved the trabecular architecture ( Figure 20), increased cortical thickness (Figure 21) and improved bone strength (Figure 22).
  • ActRIIa-mFc produced desirable effects at a range of doses from lmg/kg to 10 mg/kg.
  • Ms/Bs is the mineralizing surface/bone surface ratio, which is an indicator of bone growth, or anabolic effect.
  • mineral apposition rate (MAR) and bone formation rate per bone surface per day (BFR/BSd) indicate bone growth.
  • Measures of osteoblasts (Nob/BPm) and osteoclasts (Noc/BPm) are taken in order to probe the mechanism of action.
  • a second bone histomorphometry experiment was conducted in female C57BL/6 mice, beginning at an age of twelve weeks. Mice were dosed intraperitoneally twice per week with 10 mg/kg ActRIIa-mFc for two weeks, four weeks, eight weeks or twelve weeks. Each group was sacrificed five days after the last dose and bones taken for analysis. Mice were calcein labeled nine days and two days prior to euthanasia. As shown in Figure 25, the metrics show that ActRIIa-mFc promotes bone growth and mineralization and has both anabolic and anti-catabolic effects. See for example the BV/TV ratio, the ES/BS ratio and the MS/BS ratio. The anabolic effects appear to persist throughout the dosing regimen, while the anti-resorptive effects appear to be shorter lived in the mice.
  • Example 3 ActRIIa-mFc ameliorates or prevents bone damage in a murine model of multiple myeloma
  • Multiple myeloma patients exhibit a bone loss disorder characterized by increased osteoclast activity and decreased bone formation by osteoblasts.
  • the 5T2MM model of myeloma in mice is based on the use of tumor cells (5T2MM cells) from a type of spontaneous tumor that develops in aged mice and causes effects in mice that are similar to those seen in human multiple myeloma patients. See, e.g., Vanderkerken et al., Methods MoI Med. 2005;l 13:191-205. ActRIIa-mFc was tested for effects in this model.
  • 5T2MM cells injected into C57Bl/KaLwRij mice promoted an increase in osteoclast surface, the formation of osteolytic lesions and caused a decrease in bone area. Bone disease was associated with a decrease in osteoblast number, osteoblast surface and a reduction in mineralization.
  • Mice bearing 5T2MM cells were treated with ActRIIa-mFc (RAP-Ol 1) (10mg/kg, i.p. twice weekly), or a vehicle, from the time of 5T2MM injection, for a total of 12 weeks.
  • MicroCT analysis of the proximal tibia and lumbar vertebrae demonstrated a 39% and 21% reduction in cancellous bone volume (p ⁇ 0.001 and p ⁇ 0.01) and a 37% and 15% reduction in trabecular number (p ⁇ 0.01 and p ⁇ 0.05) in 5T2MM-bearing mice compared to na ⁇ ve mice.
  • RAP-01 1 completely prevented 5T2MM-induced decreases in trabecular volume and number in both tibia (p ⁇ 0.001 and p ⁇ 0.05) and vertebrae (p ⁇ 0.01 and p ⁇ 0.05) when compared to vehicle treated mice.
  • RAP-01 1 prevented the development of osteolytic bone lesions (p ⁇ 0.05). This effect is illustrated in Figure 26. While a preliminary assessment of the data failed to identify significant effects on serum paraprotein (a biomarker of multiple myeloma tumor cells) or myeloma burden in this study, a further analysis indicated that serum paraprotein was substantially decreased in all but one of the treated animals, and further that the volume of healthy bone marrow was substantially increased, indicating a decrease in the myeloma tumor cell burden.
  • ActRIIa-mFc may be used to decrease the effects of bone disease resulting from multiple myeloma and to treat the tumor cells themselves.
  • ActRIIa-hFc fusion protein was expressed in stably transfected CHO-DUKX Bl 1 cells from a pAID4 vector (SV40 ori/enhancer, CMV promoter), using a tissue plasminogen leader sequence of SEQ ID NO:9.
  • the protein purified as described above in Example 1 , had a sequence of SEQ ID NO:7.
  • the Fc portion is a human IgGl Fc sequence, as shown in SEQ ID NO:7.
  • Sialic acid analysis showed that the protein contained, on average, between about 1.5 and 2.5 moles of sialic acid per molecule of ActRIIa-hFc fusion protein.
  • This purified protein showed a remarkably long serum half-life in all animals tested, including a half-life of 25-32 days in human patients (see Example 5, below). Additionally, the CHO cell expressed material has a higher affinity for activin B ligand than that reported for an ActRIIa-hFc fusion protein expressed in human 293 cells (del Re et al., J Biol Chem. 2004 Dec 17;279(51):53126-35.) Additionally, the use of the tPa leader sequence provided greater production than other leader sequences and, unlike ActRIIa-Fc expressed with a native leader, provided a highly pure N-terminal sequence. Use of the native leader sequence resulted in two major species of ActRIIa-Fc, each having a different N-terminal sequence.
  • Example 4 The protein described in Example 4 was administered to human patients in a randomized, double-blind, placebo-controlled study that was conducted to evaluate, primarily, the safety of the protein in healthy, postmenopausal women. Forty-eight subjects were randomized in cohorts of 6 to receive either a single dose of ActRIIa-hFc or placebo (5 active: 1 placebo). Dose levels ranged from 0.01 to 3.0 mg/kg intravenously (IV) and 0.03 to 0.1 mg/kg subcutaneously (SC). All subjects were followed for 120 days. Subjects were excluded from study participation if they took medications affecting bone metabolism within 6 months of study entry. Safety evaluations were conducted following each cohort to determine dose escalation.
  • AEs Adverse events
  • PK analysis of ActRIIa-hFc displayed a linear profile with dose, and a mean half-life of approximately 25-32 days.
  • the area-under-curve (AUC) for ActRIIa-hFc was linearly related to dose, and the absorption after SC dosing was essentially complete (see Figures 27 and 28).
  • ActRIIa-hFc caused a rapid, sustained dose-dependent increase in serum levels of bone-specific alkaline phosphatase (BAP), which is a marker for anabolic bone growth, and a dose- dependent decrease in C-terminal type 1 collagen telopeptide and tartrate-resistant acid phosphatase 5b levels, which are markers for bone resorption.
  • BAP bone-specific alkaline phosphatase
  • Other markers, such as PlNP showed inconclusive results.
  • BAP levels showed near saturating effects at the highest dosage of drug, indicating that half-maximal effects on this anabolic bone biomarker could be achieved at a dosage of 0.3 mg/kg, with increases ranging up to 3 mg/kg.
  • the EC50 is 51,465 (day*ng/ml). See Figure 29. These bone biomarker changes were sustained for approximately 120 days at the highest dose levels tested. There was also a dose-dependent decrease in serum FSH levels consistent with inhibition of activin.
  • ActRIIa-hFc is an osteoanabolic agent with biological evidence of both an increase in bone formation and a decrease in bone resorption.
  • Bisphosphonates are a class of drugs that are widely used to treat disorders associated with low bone mineral density, including osteoporosis and cancer-related bone loss. Bisphosphonates have a potent anti-resorptive activity, inhibiting osteoclasts. Perhaps because osteoclasts are required both for bone breakdown and bone growth, bisphosphonates appear to diminish the effects of parathyroid hormone (PTH), one of the only known anabolic bone growth agents (Black et al., N Engl J Med. 2003 Sep 25;349(13):1207-15; Samadfam et al., Endocrinology.
  • PTH parathyroid hormone
  • mice were tested with combined ActRIIa-mFc and zoledronate, a bisphosphonate compound. 12 week old C57BL/6N mice were treated as follows:
  • ZOL Zoledronic Acid
  • Example 7 ActRIIa-Fc Ameliorates or Prevents Bone Loss Caused by Breast Cancer Metastases
  • MDA-MB-231 clone 2287
  • MDA-MB-231 is a cell line that is highly competent for seeding into bone and causing bone damage similar to that caused by bone metastases. 10 ml of cells were injected into the tibia of 6 week old female athymic nude mice on study day 0.
  • PIXIMus dual energy x-ray absorptiometry
  • MicroCT analysis of the proximal tibia demonstrated a 62%, reduction in cancellous bone volume in the MDA-MB-231 bearing tibiae compared to the untumored tibia in PBS vehicle treated mice.
  • ActRIIa-mFc treatment led to an increase of 70% or 147% in the na ⁇ ve or tumor bearing tibia respectively compared to vehicle (PO.01 for both).
  • ActRIIa-mFc is able to eliminate the bone damage associated with the presence of breast tumor cells in the bone.
  • Example 8 Alternative ActRIIa-Fc Proteins
  • An alternative construct may have a deletion of the C-terminal tail (the final 15 amino acids of the extracellular domain of ActRIIa.
  • the sequence for such a construct is presented below (Fc portion underlined)(SEQ ID NO: 12): ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCF ATWKNISGSIEIVKQG CWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMTGGGTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEOYNSTYRVVSVLTVLHODWLNGKEYKCKVSNKALPVPIEKTISKAKGQPRE POVYTLPPSREEMTKNOVSLTCLVKGFYPSDIAVEWESNGOPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWOOGNVFSCSVMHEALHNHYTOKSLS

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Cell Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Endocrinology (AREA)
  • Rheumatology (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Toxicology (AREA)
  • Oncology (AREA)
  • Computer Networks & Wireless Communication (AREA)
  • Signal Processing (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Urology & Nephrology (AREA)
PCT/US2008/001354 2007-02-09 2008-02-01 Activin-actriia antagonists and uses for promoting bone growth in cancer patients Ceased WO2008100384A2 (en)

Priority Applications (28)

Application Number Priority Date Filing Date Title
EA200970747A EA018221B1 (ru) 2007-02-09 2008-02-01 АНТАГОНИСТЫ АКТИВИНА-ActRIIa И ПРИМЕНЕНИЕ ДЛЯ СТИМУЛЯЦИИ РОСТА КОСТИ У БОЛЬНЫХ РАКОМ
KR1020167029980A KR20160129095A (ko) 2007-02-09 2008-02-01 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도
CN201410709284.1A CN104548056B (zh) 2007-02-09 2008-02-01 活化素-actriia拮抗剂和促进癌症患者骨骼生长的用途
MX2009008510A MX2009008510A (es) 2007-02-09 2008-02-01 Antagonistas de activina-actriia y usos para promover el crecimiento de huesos en pacientes con cancer.
KR1020197006082A KR20190026047A (ko) 2007-02-09 2008-02-01 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도
CA2677605A CA2677605C (en) 2007-02-09 2008-02-01 Activin-actriia antagonists and uses for promoting bone growth in cancer patients
EP08725055A EP2120999B1 (en) 2007-02-09 2008-02-01 Pharmaceutical compositions comprising Activin-ActRIIA antagonists and use thereof in preventing or treating multiple myeloma
HRP20120947AT HRP20120947T1 (hr) 2007-02-09 2008-02-01 FARMACEUTSKE SMJESE KOJE SADRŽE AKTIVIN-ActRIIA ANTAGONISTE I NJIHOVA UPORABA U PREVENCIJI ILI LIJEÄŚENJU MULTIPLOG MIJELOMA
EP11195151.3A EP2481415B1 (en) 2007-02-09 2008-02-01 Pharmaceutical compositions comprising Activin-ActRIIA antagonists
ES08725055T ES2394123T3 (es) 2007-02-09 2008-02-01 Composiciones farmacéuticas que comprenden antagonistas de Activina-Actrlla y uso de las mismas en la prevención o el tratamiento de mieloma múltiple
AU2008216896A AU2008216896B2 (en) 2007-02-09 2008-02-01 Activin-actriia antagonists and uses for promoting bone growth in cancer patients
KR1020097017745A KR101670417B1 (ko) 2007-02-09 2008-02-01 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도
DK08725055.1T DK2120999T3 (da) 2007-02-09 2008-02-01 Farmaceutiske sammensætninger omfattende Activin-ActRIIA antagonister samt anvendelse deraf ved forebyggelse eller behandling af multipelt myelom
RS20120504A RS52535B (sr) 2007-02-09 2008-02-01 FARMACEUTSKE SMEŠE KOJE SADRŽE AKTIVIN-ActRIIA ANTAGONISTE I NJIHOVA UPOTREBA U PREVENCIJI ILI LEČENJU MULTIPLOG MIJELOMA
KR1020217019387A KR20210082540A (ko) 2007-02-09 2008-02-01 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도
HK10105092.4A HK1137366B (en) 2007-02-09 2008-02-01 Pharmaceutical compositions comprising activin-actriia antagonists and use thereof in preventing or treating multiple myeloma
KR1020187020332A KR20180083967A (ko) 2007-02-09 2008-02-01 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도
CN200880011454.1A CN101687016B (zh) 2007-02-09 2008-02-01 活化素-actriia拮抗剂和促进癌症患者骨骼生长的用途
JP2009549079A JP5574711B2 (ja) 2007-02-09 2008-02-01 癌患者における骨成長を促進するためのアクチビン−actriiaアンタゴニストおよびその使用
SI200830820T SI2120999T1 (sl) 2007-02-09 2008-02-01 FARMACEVTSKI SESTAVKI, KI VSEBUJEJO AKTIVIN-ActRIIA ANTAGONISTE IN NJIHOVA UPORABA PRI PREPREÄŚEVANJU ALI ZDRAVLJENJU MULTIPLEGA MIELOMA
BRPI0807506-9A BRPI0807506B1 (pt) 2007-02-09 2008-02-01 Uso de uma proteína de fusão actriia-fc para a fabricação de um medicamento para tratar ou previnir mieloma múltiplo
PL08725055T PL2120999T3 (pl) 2007-02-09 2008-02-01 KOMPOZYCJE FARMACEUTYCZNE ZAWIERAJĄCE ANTAGONISTÓW AKTYWINY-ActRIIA I ICH ZASTOSOWANIE W ZAPOBIEGANIU LUB LECZENIU SZPICZAKA MNOGIEGO
KR1020157026929A KR101672156B1 (ko) 2007-02-09 2008-02-01 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도
KR1020207012421A KR20200054317A (ko) 2007-02-09 2008-02-01 액티빈-ActRⅡA 길항제 및 암 환자에서 골 생장을 촉진시키기 위한 이의 용도
MEP-2016-80A ME02333B (me) 2007-02-09 2008-02-01 FARMACEUTSKE SMEŠE KOJE SADRŽE AKTIVIN-ActRIIA ANTAGONISTE I NJIHOVA UPOTREBA U PREVENCIJI ILI LEČENJU MULTIPLOG MIJELOMA
IL200242A IL200242B (en) 2007-02-09 2009-08-05 Actriia-fc fusion proteins for use in reducing tumor burden in multifocal myeloma
IL257848A IL257848B (en) 2007-02-09 2018-03-04 Activin-actriia antagonists and their use to increase bone growth in cancer patients
IL281715A IL281715A (en) 2007-02-09 2021-03-22 Activin-ActrIIA antagonists and their use to increase bone growth in cancer patients

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US90058007P 2007-02-09 2007-02-09
US60/900,580 2007-02-09
US93276207P 2007-05-31 2007-05-31
US60/932,762 2007-05-31
US93736507P 2007-06-26 2007-06-26
US60/937,365 2007-06-26
US52807P 2007-10-25 2007-10-25
US61/000,528 2007-10-25

Publications (2)

Publication Number Publication Date
WO2008100384A2 true WO2008100384A2 (en) 2008-08-21
WO2008100384A3 WO2008100384A3 (en) 2008-12-11

Family

ID=39690668

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2008/001354 Ceased WO2008100384A2 (en) 2007-02-09 2008-02-01 Activin-actriia antagonists and uses for promoting bone growth in cancer patients

Country Status (24)

Country Link
US (4) US8173601B2 (enExample)
EP (3) EP2484372A1 (enExample)
JP (6) JP5574711B2 (enExample)
KR (7) KR20190026047A (enExample)
CN (3) CN104548056B (enExample)
AR (1) AR065289A1 (enExample)
AU (1) AU2008216896B2 (enExample)
BR (1) BRPI0807506B1 (enExample)
CA (3) CA3039330C (enExample)
CY (1) CY1113963T1 (enExample)
DK (1) DK2120999T3 (enExample)
EA (3) EA201690994A1 (enExample)
ES (2) ES2756725T3 (enExample)
HR (1) HRP20120947T1 (enExample)
IL (3) IL200242B (enExample)
ME (1) ME02333B (enExample)
MX (2) MX368173B (enExample)
PL (1) PL2120999T3 (enExample)
PT (1) PT2120999E (enExample)
RS (1) RS52535B (enExample)
SI (1) SI2120999T1 (enExample)
TR (1) TR200906329T1 (enExample)
TW (7) TWI525102B (enExample)
WO (1) WO2008100384A2 (enExample)

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009038745A1 (en) * 2007-09-18 2009-03-26 Acceleron Pharma Inc. Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion
WO2009158035A2 (en) 2008-06-26 2009-12-30 Acceleron Pharma Inc. Methods for dosing an activin-actriia antagonist and monitoring of treated patients
WO2009158033A2 (en) 2008-06-26 2009-12-30 Acceleron Pharma Inc. Antagonists of activin-actriia and uses for increasing red blood cell levels
US7842663B2 (en) 2007-02-02 2010-11-30 Acceleron Pharma Inc. Variants derived from ActRIIB and uses therefor
US7951771B2 (en) 2005-11-23 2011-05-31 Acceleron Pharma Inc. Activin-ActRIIa antagonists and uses for promoting bone growth
US7988973B2 (en) 2006-12-18 2011-08-02 Acceleron Pharma Inc. Activin-ActRII antagonists and uses for increasing red blood cell levels
US8058229B2 (en) 2008-08-14 2011-11-15 Acceleron Pharma Inc. Method of increasing red blood cell levels or treating anemia in a patient
US8128933B2 (en) 2005-11-23 2012-03-06 Acceleron Pharma, Inc. Method of promoting bone growth by an anti-activin B antibody
US8138142B2 (en) 2009-01-13 2012-03-20 Acceleron Pharma Inc. Methods for increasing adiponectin in a patient in need thereof
US8178488B2 (en) 2009-06-08 2012-05-15 Acceleron Pharma, Inc. Methods for increasing thermogenic adipocytes
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
US8252900B2 (en) 2004-07-23 2012-08-28 Acceleron Pharma Inc. Actriib-Fc polynucleotides, polypeptides, and compositions
US8293881B2 (en) 2009-06-12 2012-10-23 Acceleron Pharma Inc. Isolated nucleic acid encoding a truncated ActRIIB fusion protein
US8710016B2 (en) 2009-11-17 2014-04-29 Acceleron Pharma, Inc. ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy
US9493556B2 (en) 2010-11-08 2016-11-15 Acceleron Pharma Inc. Actriia binding agents and uses thereof
US9526759B2 (en) 2007-02-01 2016-12-27 Acceleron Pharma Inc. Activin-actriia antagonists and uses for treating or preventing breast cancer
US9572865B2 (en) 2005-11-23 2017-02-21 Acceleron Pharma Inc. Activin-actriia antagonists and uses for treating multiple myeloma
US9850298B2 (en) 2014-06-13 2017-12-26 Acceleron Pharma Inc. Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide
US10093707B2 (en) 2006-12-18 2018-10-09 Acceleron Pharma Inc. Antagonists of activin-ActRIIa and uses for increasing red blood cell levels
US10195249B2 (en) 2012-11-02 2019-02-05 Celgene Corporation Activin-ActRII antagonists and uses for treating bone and other disorders
WO2019094751A1 (en) 2017-11-09 2019-05-16 Keros Therapeutics, Inc. Activin receptor type iia variants and methods of use thereof
US11013785B2 (en) 2016-11-10 2021-05-25 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
US11407799B2 (en) 2016-11-29 2022-08-09 Pharmafox Therapeutics Ag Muscle performance improvement compounds comprising C-terminus agrin fragment and an ACTR2B inhibitor
US11471510B2 (en) 2014-12-03 2022-10-18 Celgene Corporation Activin-ActRII antagonists and uses for treating anemia
US11813308B2 (en) 2014-10-09 2023-11-14 Celgene Corporation Treatment of cardiovascular disease using ActRII ligand traps
US11834508B2 (en) 2017-03-24 2023-12-05 Novartis Ag Method of treating structural and/or functional cardiac abnormalities by administering an anti-ActRII receptor antibody
US11884715B2 (en) 2018-01-12 2024-01-30 Keros Therapeutics, Inc. Activin receptor type IIB variants and methods of use thereof
US12365725B2 (en) 2013-03-20 2025-07-22 Genzyme Corporation Methods for treating osteogenesis imperfecta
US12364737B2 (en) 2018-05-09 2025-07-22 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
US12440539B2 (en) 2020-03-20 2025-10-14 Keros Therapeutics, Inc. Methods of using activin receptor type IIB variants
US12522646B2 (en) 2020-03-20 2026-01-13 Keros Therapeutics, Inc. Activin receptor type II chimeras and methods of use thereof

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100028332A1 (en) * 2006-12-18 2010-02-04 Acceleron Pharma Inc. Antagonists of actriib and uses for increasing red blood cell levels
KR20210029836A (ko) * 2009-09-09 2021-03-16 악셀레론 파마 인코포레이티드 ActRIIb 길항제들와 이의 투약 및 용도
EP3260130B1 (en) * 2009-11-03 2021-03-10 Acceleron Pharma Inc. Methods for treating fatty liver disease
JP2013518108A (ja) 2010-01-26 2013-05-20 アントフロゲネシス コーポレーション 胎盤幹細胞を用いる骨関連癌の治療
US9809636B2 (en) 2012-04-06 2017-11-07 Acceleron Pharma Inc. Methods for increasing red blood cell levels comprising administering BMP9
CN110237880A (zh) 2013-01-18 2019-09-17 生米公司 分析设备
JP2015159766A (ja) * 2014-02-27 2015-09-07 国立大学法人京都大学 クッシング症候群の検査方法、検査用バイオマーカー及び治療剤
EP3808778A1 (en) 2014-04-18 2021-04-21 Acceleron Pharma Inc. Methods for increasing red blood cell levels and treating sickle-cell disease
HK1252174A1 (zh) 2015-05-20 2019-05-17 细胞基因公司 使用II型活化素受体配体阱的用於β-地中海贫血的体外细胞培养方法
WO2017091706A1 (en) * 2015-11-23 2017-06-01 Acceleron Pharma Inc. Methods for treating eye disorders
PL3426680T3 (pl) * 2016-03-10 2025-03-31 Acceleron Pharma Inc. Białka wiążące receptor aktywiny typu 2 i ich zastosowania
MX378869B (es) 2016-07-15 2025-03-10 Acceleron Pharma Inc Composiciones y metodos para tratar hipertension pulmonar.
AU2018214979A1 (en) * 2017-02-01 2019-08-15 Acceleron Pharma Inc. TGFβ and actrii antagonists for use in increasing immune activity
WO2019055875A2 (en) 2017-09-15 2019-03-21 Biomeme, Inc. METHODS AND SYSTEMS FOR AUTOMATIC SAMPLE PROCESSING
US12263205B2 (en) 2018-04-30 2025-04-01 The Children's Hospital Of Philadelphia Methods of improving anemias by combining agents
KR102263643B1 (ko) * 2018-07-24 2021-06-10 주식회사 굳티셀 면역 관련 질환의 예방 또는 치료용 조성물
EP3942281A4 (en) 2019-03-21 2022-11-16 Biomeme, Inc. MULTIFUNCTIONAL ANALYTICAL DEVICES
JP7328729B2 (ja) * 2020-03-31 2023-08-17 Cell Exosome Therapeutics株式会社 細胞の保存方法
WO2022061105A1 (en) 2020-09-18 2022-03-24 Biomeme, Inc. Portable devices and methods for analyzing samples
US12186370B1 (en) 2020-11-05 2025-01-07 Celgene Corporation ACTRIIB ligand trap compositions and uses thereof
MX2024002711A (es) * 2021-09-03 2024-05-02 Laekna Therapeutics Shanghai Co Ltd Anticuerpos de receptor de activina tipo-2a (anti-acvr2a) y usos de estos.

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5283317A (en) 1987-08-03 1994-02-01 Ddi Pharmaceuticals, Inc. Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols
US5525490A (en) 1994-03-29 1996-06-11 Onyx Pharmaceuticals, Inc. Reverse two-hybrid method
WO1996026432A1 (en) 1995-02-23 1996-08-29 University Of Utah Research Foundation Composite waveguide for solid phase binding assays
US5677196A (en) 1993-05-18 1997-10-14 University Of Utah Research Foundation Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays
US5955280A (en) 1995-04-11 1999-09-21 The General Hospital Corporation Reverse two-hybrid system
WO2002032925A2 (en) 2000-10-16 2002-04-25 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2002088171A2 (en) 2001-04-26 2002-11-07 Avidia Research Institute Combinatorial libraries of monomer domains
US6521750B2 (en) 1997-07-30 2003-02-18 Univ Emory Bone mineralization proteins, DNA, vectors, expression systems
WO2006012627A2 (en) 2004-07-23 2006-02-02 Acceleron Pharma Inc. Actrii receptor polypeptides, methods and compositions
WO2006055689A2 (en) 2004-11-16 2006-05-26 Avidia Research Institute Protein scaffolds and uses thereof

Family Cites Families (199)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH0637520B2 (ja) * 1985-07-03 1994-05-18 味の素株式会社 ポリペプチド
US4956282A (en) * 1985-07-29 1990-09-11 Calgene, Inc. Mammalian peptide expression in plant cells
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US4973577A (en) * 1986-04-04 1990-11-27 The Salk Institute For Biological Studies FSH-releasing peptides
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5198346A (en) 1989-01-06 1993-03-30 Protein Engineering Corp. Generation and selection of novel DNA-binding proteins and polypeptides
US5096815A (en) 1989-01-06 1992-03-17 Protein Engineering Corporation Generation and selection of novel dna-binding proteins and polypeptides
WO1992004913A1 (en) 1990-09-13 1992-04-02 Children's Hospital Medical Center Of Northern California Method for increasing red blood cell production by treatment with activin or activin-related peptides
US5208219A (en) * 1991-02-14 1993-05-04 Celtrix Pharmaceuticals Inc. Method for inducing bone growth
US5118667A (en) * 1991-05-03 1992-06-02 Celtrix Pharmaceuticals, Inc. Bone growth factors and inhibitors of bone resorption for promoting bone formation
US20050186593A1 (en) 1991-05-10 2005-08-25 The Salk Institute For Biological Studies Cloning and recombinant production of CRF receptor(s)
CA2086327A1 (en) 1991-05-10 1992-11-11 Lawrence S. Mathews Cloning and recombinant production of receptor(s) of the activin/tgf- .beta. superfamily
US6162896A (en) * 1991-05-10 2000-12-19 The Salk Institute For Biological Studies Recombinant vertebrate activin receptors
US5885794A (en) * 1991-05-10 1999-03-23 The Salk Institute For Biological Studies Recombinant production of vertebrate activin receptor polypeptides and identification of receptor DNAs in the activin/TGF-β superfamily
KR100255415B1 (ko) 1991-06-25 2000-05-01 브루스 엠. 에이센 비엠피-9 조성물
US6287816B1 (en) 1991-06-25 2001-09-11 Genetics Institute, Inc. BMP-9 compositions
US6692925B1 (en) * 1992-11-17 2004-02-17 Ludwig Institute For Cancer Research Proteins having serine/threonine kinase domains, corresponding nucleic acid molecules, and their use
EP0679163A4 (en) 1993-01-12 1997-07-16 Univ Johns Hopkins Med GROWTH DIFFERENTIATION FACTOR-3.
US5637480A (en) 1993-05-12 1997-06-10 Genetics Institute, Inc. DNA molecules encoding bone morphogenetic protein-10
DE69433742T2 (de) 1993-05-12 2005-07-07 Genetics Institute, LLC, Cambridge Bmp-10 zusammensetzungen
US5831050A (en) 1993-06-07 1998-11-03 Creative Biomolecules, Inc. Morphogen cell surface receptor
JPH09503673A (ja) 1993-10-14 1997-04-15 プレジデント・アンド・フエローズ・オブ・ハーバード・カレツジ ニューロン細胞の誘導および維持法
US5658876A (en) 1994-04-28 1997-08-19 The General Hospital Corporation Activin antagonists as novel contraceptives
US5545616A (en) * 1994-09-22 1996-08-13 Genentech, Inc. Method for predicting and/or preventing preterm labor
US5760010A (en) 1995-01-01 1998-06-02 Klein; Ira Method of treating liver disorders with a macrolide antibiotic
US6132988A (en) * 1995-10-27 2000-10-17 Takeda Chemical Industries, Ltd. DNA encoding a neuronal cell-specific receptor protein
GB9526131D0 (en) 1995-12-21 1996-02-21 Celltech Therapeutics Ltd Recombinant chimeric receptors
US20050244867A1 (en) * 1996-03-26 2005-11-03 Human Genome Sciences, Inc. Growth factor HTTER36
US6004780A (en) * 1996-03-26 1999-12-21 Human Genome Sciences, Inc. Growth factor HTTER36
BR9712675A (pt) 1996-10-25 1999-10-19 Searle & Co Agonistas do receptor de eritropoietina circularmente permutados.
US6605699B1 (en) * 1997-01-21 2003-08-12 Human Genome Sciences, Inc. Galectin-11 polypeptides
US6034062A (en) 1997-03-13 2000-03-07 Genetics Institute, Inc. Bone morphogenetic protein (BMP)-9 compositions and their uses
US6231880B1 (en) * 1997-05-30 2001-05-15 Susan P. Perrine Compositions and administration of compositions for the treatment of blood disorders
US6891082B2 (en) * 1997-08-01 2005-05-10 The Johns Hopkins University School Of Medicine Transgenic non-human animals expressing a truncated activintype II receptor
WO1999006559A1 (en) 1997-08-01 1999-02-11 The Johns Hopkins University School Of Medicine Methods to identify growth differentiation factor (gdf) receptors
US6656475B1 (en) * 1997-08-01 2003-12-02 The Johns Hopkins University School Of Medicine Growth differentiation factor receptors, agonists and antagonists thereof, and methods of using same
US6696260B1 (en) * 1997-08-01 2004-02-24 The Johns Hopkins University School Of Medicine Methods to identify growth differentiation factor (GDF) binding proteins
AU8921698A (en) 1997-08-29 1999-03-16 Human Genome Sciences, Inc. Follistatin-3
US6953662B2 (en) * 1997-08-29 2005-10-11 Human Genome Sciences, Inc. Follistatin-3
BR9812846A (pt) 1997-10-03 2000-08-08 Chugai Pharmaceutical Co Ltd Anticorpo humanizado natural
US6696411B1 (en) * 1998-04-22 2004-02-24 Cornell Research Foundation, Inc. Canine erythropoietin gene and recombinant protein
JP2002524514A (ja) 1998-09-17 2002-08-06 イーライ・リリー・アンド・カンパニー タンパク質製剤
CA2343715C (en) * 1998-09-22 2004-05-18 Long Yu New human growth differentiation factor encoding sequence and polypeptide encoded by such dna sequence and producing method thereof
US6472179B2 (en) 1998-09-25 2002-10-29 Regeneron Pharmaceuticals, Inc. Receptor based antagonists and methods of making and using
US6548634B1 (en) 1998-09-30 2003-04-15 Chiron Corporation Synthetic peptides having FGF receptor affinity
US6238860B1 (en) 1998-11-05 2001-05-29 Dyax Corp. Binding moieties for human parvovirus B19
US6777205B1 (en) * 1998-11-06 2004-08-17 Sterrenbeld Biotechnologie North America, Inc. Host cells expressing recombinant human erythropoietin
US20040009535A1 (en) 1998-11-27 2004-01-15 Celltech R&D, Inc. Compositions and methods for increasing bone mineralization
JP2003517580A (ja) 1999-01-21 2003-05-27 メタモーフイクス・インコーポレーテツド 増殖分化因子インヒビター及びそれらの用途
US6914128B1 (en) 1999-03-25 2005-07-05 Abbott Gmbh & Co. Kg Human antibodies that bind human IL-12 and methods for producing
CN1163262C (zh) * 1999-04-01 2004-08-25 上海益众生物技术有限公司 成骨生长肽药物组合物及制备方法和应用
AU777783B2 (en) 1999-04-19 2004-10-28 Kyowa Hakko Kogyo Co. Ltd. Proliferation inhibitor for androgen-independent tumor
US6468543B1 (en) * 1999-05-03 2002-10-22 Zymogenetics, Inc. Methods for promoting growth of bone using ZVEGF4
HRP20020387A2 (en) 1999-11-12 2005-10-31 Maxygen Holdings Ltd. Interferon gamma conjugates
DE60026592T2 (de) 1999-12-15 2006-12-14 Research Development Foundation, Carson City Betaglycan als ein inhibin rezeptor und dessen verwendung
US20030224501A1 (en) 2000-03-17 2003-12-04 Young Paul E. Bone morphogenic protein polynucleotides, polypeptides, and antibodies
JP4487376B2 (ja) * 2000-03-31 2010-06-23 味の素株式会社 腎疾患治療剤
US6627424B1 (en) 2000-05-26 2003-09-30 Mj Bioworks, Inc. Nucleic acid modifying enzymes
US20030215913A1 (en) 2000-07-19 2003-11-20 Enrique Alvarez Nucleic acids, vectors, host cells, polypeptides, and uses thereof
US6632180B1 (en) 2000-09-07 2003-10-14 John H. Laragh Method for evaluating and treating hypertension
DE10045591A1 (de) 2000-09-15 2002-04-04 Klaus Pfizenmaier Ortsspezifische, antikörpervermittelte Aktivierung proapoptotischer Zytokine - AMAIZe (Antibody-Mediated Apoptosis Inducing Zytokine)
US7087224B2 (en) 2000-10-31 2006-08-08 Amgen Inc. Method of treating anemia by administering IL-1ra
AU2567002A (en) 2000-11-20 2002-05-27 Univ Illinois Membrane scaffold proteins
US20030082233A1 (en) 2000-12-01 2003-05-01 Lyons Karen M. Method and composition for modulating bone growth
AU2002236558A1 (en) 2000-12-01 2002-06-11 Regents Of The University Of California Method and composition for modulating bone growth
TWI329129B (en) * 2001-02-08 2010-08-21 Wyeth Corp Modified and stabilized gdf propeptides and uses thereof
US20040132675A1 (en) * 2002-02-08 2004-07-08 Calvin Kuo Method for treating cancer and increasing hematocrit levels
US7294472B2 (en) 2001-03-14 2007-11-13 Caden Biosciences Method for identifying modulators of G protein coupled receptor signaling
WO2002074340A1 (fr) 2001-03-16 2002-09-26 Takeda Chemical Industries, Ltd. Procede de fabrication d'une preparation a liberation continue
JP2004535182A (ja) 2001-05-24 2004-11-25 ザイモジェネティクス,インコーポレイティド Taci−免疫グロブリン融合タンパク質
CA2448253A1 (en) * 2001-05-25 2002-11-28 Genset S.A. Human cdnas and proteins and uses thereof
JP2003012699A (ja) 2001-07-04 2003-01-15 Japan Science & Technology Corp 抗麻酔性貝毒抗体の製法、新規抗体、該抗体を用いるelisa測定キット、該製法による系標識毒標品
AUPR638101A0 (en) 2001-07-13 2001-08-09 Bioa Pty Limited Composition and method for treatment of disease
CA2452246A1 (en) 2001-07-17 2003-01-30 Teijin Limited Method of screening substance by measuring ppar .delta. activating effect and agent
US6855344B2 (en) * 2001-07-17 2005-02-15 Integrated Chinese Medicine Holdings, Ltd. Compositions and methods for prostate and kidney health and disorders, an herbal preparation
KR100453877B1 (ko) 2001-07-26 2004-10-20 메덱스젠 주식회사 연쇄체화에 의한 면역 글로블린 융합 단백질의 제조 방법 및 이 방법에 의해 제조된 TNFR/Fc 융합 단백질, 상기 단백질을 코딩하는 DNA, 상기 DNA를 포함하는벡터, 및 상기 벡터에 의한 형질전환체
US7320789B2 (en) * 2001-09-26 2008-01-22 Wyeth Antibody inhibitors of GDF-8 and uses thereof
US6784154B2 (en) * 2001-11-01 2004-08-31 University Of Utah Research Foundation Method of use of erythropoietin to treat ischemic acute renal failure
US20060234918A1 (en) 2001-12-19 2006-10-19 Voyager Pharmaceutical Corporation Methods for treating and preventing cancers that express the hypothalamic-pituitary-gonadal axis of hormones and receptors
US20030144203A1 (en) * 2001-12-19 2003-07-31 Voyager Pharmaceutical Corporation Methods for slowing senescence and treating and preventing diseases associated with senescence
US6998118B2 (en) 2001-12-21 2006-02-14 The Salk Institute For Biological Studies Targeted retrograde gene delivery for neuronal protection
US20030224397A1 (en) 2002-02-11 2003-12-04 Genentech, Inc. Antibody variants with faster antigen association rates
BR0307907A2 (pt) * 2002-02-21 2011-07-05 Wyeth Corp gasp1: proteìna contendo domìnio de folistatina
US20030219846A1 (en) 2002-02-28 2003-11-27 Pfizer Inc. Assay for activity of the ActRIIB kinase
US8053552B2 (en) 2002-04-18 2011-11-08 Mtm Laboratories, Ag Neopeptides and methods useful for detection and treatment of cancer
MXPA05001694A (es) 2002-08-16 2005-07-22 Wyeth Corp Elementos de respuesta al estrogeno de bmp-2 y metodos de uso de los mismos.
AR047392A1 (es) * 2002-10-22 2006-01-18 Wyeth Corp Neutralizacion de anticuerpos contra gdf 8 y su uso para tales fines
US20040223966A1 (en) * 2002-10-25 2004-11-11 Wolfman Neil M. ActRIIB fusion polypeptides and uses therefor
AU2002953327A0 (en) 2002-12-12 2003-01-09 Monash University Methods of diagnosing prognosing and treating activin associated diseases and conditions
NZ541593A (en) 2003-02-07 2009-05-31 Prometic Biosciences Inc Medium-chain length fatty acids, glycerides and analogues as stimulators of erythropoiesis
US20040197828A1 (en) * 2003-03-26 2004-10-07 Gaddy Dana P. Method for diagnosis and treatment of bone turnover
WO2005028517A2 (en) 2003-05-09 2005-03-31 The General Hospital Corporation SOLUBLE TGF-β TYPE III RECEPTOR FUSION PROTEINS
BRPI0410927A (pt) 2003-06-02 2006-06-27 Wyeth Corp métodos terapêuticos e profiláticos para distúrbios neuromusculares
NO345763B1 (no) 2003-06-16 2021-07-19 Celltech R&D Inc Immunogen og antistoffer spesifikke for sklerostin, samt farmasøytiske preparater for å øke benmineralisering.
WO2005009460A2 (en) 2003-07-25 2005-02-03 Medexis, S.A. Pharmaceutical composition comprising activin a, alk-4 or derivatives thereof for the treatment of ophthalmic disorders or cancer
US8895540B2 (en) 2003-11-26 2014-11-25 DePuy Synthes Products, LLC Local intraosseous administration of bone forming agents and anti-resorptive agents, and devices therefor
AU2005206277B2 (en) 2004-01-22 2011-06-23 Merck Patent Gmbh Anti-cancer antibodies with reduced complement fixation
US20050197292A1 (en) * 2004-01-30 2005-09-08 Glennda Smithson Compositions and methods for treating T-cell mediated pathological conditions
AU2005229072A1 (en) * 2004-03-26 2005-10-13 Acceleron Pharma Inc. BMP-3 propeptides and related methods
JP2008500816A (ja) 2004-03-31 2008-01-17 ゼンコー・インコーポレイテッド 改善された性質を有するbmp−7変異体
WO2005113590A2 (en) 2004-05-12 2005-12-01 Acceleron Pharma Inc. Bmp10 propeptides and related methods
KR20070026650A (ko) * 2004-05-27 2007-03-08 악셀레론 파마 인코포레이티드 케르베루스/코코 유도체 및 그의 용도
CA2572330A1 (en) 2004-06-24 2006-01-05 Acceleron Pharma Inc. Gdf3 propeptides and related methods
US8617815B2 (en) 2004-08-05 2013-12-31 The Regents Of The University Of California Molecules with effects on cellular development and function
BRPI0514253A (pt) 2004-08-12 2008-06-03 Wyeth Corp terapia de combinação para diabetes, obesidade e doenças cardiovasculares usando composições contendo inibidores de gdf-8
WO2006039400A2 (en) 2004-09-29 2006-04-13 Mount Sinai School Of Medicine Of New York University Fsh and fsh receptor modulator compositions and methods for inhibiting osteoclastic bone resorption and bone loss in osteoporosis
US7358361B2 (en) * 2004-10-08 2008-04-15 The Board Of Trustees Of The University Of Illinois Biophosphonate compounds and methods for bone resorption diseases, cancer, bone pain, immune disorders, and infectious diseases
NZ538097A (en) 2005-02-07 2006-07-28 Ovita Ltd Method and compositions for improving wound healing
EP2954903A1 (en) 2005-02-16 2015-12-16 The General Hospital Corporation Use of bmp antagonists to regulate hepcidin-mediated iron metabolism
US20060213667A1 (en) * 2005-03-28 2006-09-28 Mashburn Benny D Screen apparatus and method
WO2006115274A1 (ja) 2005-04-26 2006-11-02 Ajinomoto Co., Inc. 骨髄赤血球前駆細胞分化促進剤
NZ612578A (en) 2005-08-19 2014-11-28 Abbvie Inc Dual variable domain immunoglobin and uses thereof
JP2007099764A (ja) 2005-09-09 2007-04-19 Ajinomoto Co Inc 血糖低下剤
PT1931697E (pt) 2005-09-28 2010-12-06 Zymogenetics Inc Antagonistas de il-17a e il-17f e processos para a sua utilização
US8067562B2 (en) 2005-11-01 2011-11-29 Amgen Inc. Isolated nucleic acid molecule comprising the amino acid sequence of SEQ ID NO:1
US8128933B2 (en) 2005-11-23 2012-03-06 Acceleron Pharma, Inc. Method of promoting bone growth by an anti-activin B antibody
AU2006318449B2 (en) * 2005-11-23 2012-07-05 Acceleron Pharma Inc. Activin-actRIIa antagonists and uses for promoting bone growth
WO2007067616A2 (en) 2005-12-06 2007-06-14 Amgen Inc Uses of myostatin antagonists
WO2007071023A1 (en) 2005-12-20 2007-06-28 Merck Frosst Canada Ltd. Heteroaromatic compounds as inhibitors of stearoyl-coenzyme a delta-9 desaturase
BRPI0620255A2 (pt) 2005-12-21 2011-11-08 Schering Corp uso de agentes redutores de colesterol e/ou antagonista/agonista inverso do receptor de h3
WO2007076127A2 (en) 2005-12-22 2007-07-05 Biogen Idec Ma Inc Condensed imidazoles or pyrazoles and their use as transforming growth factor modulators
EP1976541B1 (en) * 2006-01-20 2011-07-13 Beckman Coulter, Inc. Low hemoglobin concentration cell percentage and method of use in detection of iron deficiency
EP1976377A4 (en) 2006-01-25 2010-06-23 Wellstat Therapeutics Corp COMPOUNDS FOR THE TREATMENT OF METABOLIC DISORDERS
KR20080098615A (ko) 2006-02-28 2008-11-11 웰스태트 테러퓨틱스 코포레이션 물질대사 장애의 치료용 화합물
EP2007813A2 (en) * 2006-04-14 2008-12-31 Amgen Inc. Agonist erythropoietin receptor antibodies
WO2007123391A1 (en) 2006-04-20 2007-11-01 Academisch Ziekenhuis Leiden Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly expressed gene.
WO2007133653A2 (en) * 2006-05-09 2007-11-22 Hemaquest Pharmaceuticals, Inc. Methods for treating blood disorders
WO2008011126A2 (en) * 2006-07-21 2008-01-24 Lyne Laboratories Liquid compositions of calcium acetate
GB0615129D0 (en) 2006-07-29 2006-09-06 Univ Cardiff Anti-cancer activity of BMP-9 and BMP-10 and their use in cancer therapies
CL2007002567A1 (es) 2006-09-08 2008-02-01 Amgen Inc Proteinas aisladas de enlace a activina a humana.
US7547781B2 (en) * 2006-09-11 2009-06-16 Curis, Inc. Quinazoline based EGFR inhibitors containing a zinc binding moiety
WO2008060139A1 (en) 2006-11-17 2008-05-22 Erasmus University Medical Center Rotterdam Methods for controlling mineralization of extracellular matrix, therapeutic methods based thereon and medicaments for use therein
US20100003190A1 (en) 2006-12-08 2010-01-07 Caritas St. Elizabeth's Medical Center Of Boston, Inc. Method for protecting renal tubular epithelial cells from radiocontrast nephropathy (RCN)
CA2672581A1 (en) 2006-12-14 2008-06-19 Forerunner Pharma Research Co., Ltd. Anti-claudin 3 monoclonal antibody and treatment and diagnosis of cancer using the same
US8895016B2 (en) 2006-12-18 2014-11-25 Acceleron Pharma, Inc. Antagonists of activin-actriia and uses for increasing red blood cell levels
US20100028332A1 (en) 2006-12-18 2010-02-04 Acceleron Pharma Inc. Antagonists of actriib and uses for increasing red blood cell levels
EA035911B1 (ru) * 2006-12-18 2020-08-31 Акселерон Фарма Инк. Применение полипептида, который ингибирует опосредованный активином сигнальный путь, в качестве лекарственного средства
TR200906131T1 (tr) * 2007-02-01 2009-11-23 Acceleron Pharma Inc. Aktivin -actrIIa antagonistleri ve göğüs kanserinin tedavi e
TWI782836B (zh) 2007-02-02 2022-11-01 美商艾瑟勒朗法瑪公司 衍生自ActRIIB的變體與其用途
CN104548056B (zh) 2007-02-09 2022-09-09 阿塞勒隆制药公司 活化素-actriia拮抗剂和促进癌症患者骨骼生长的用途
TWI573802B (zh) 2007-03-06 2017-03-11 安美基公司 變異之活動素受體多肽及其用途
US8501678B2 (en) 2007-03-06 2013-08-06 Atara Biotherapeutics, Inc. Variant activin receptor polypeptides and uses thereof
US20090017019A1 (en) * 2007-06-01 2009-01-15 Wyeth Methods and compositions for modulating bmp-10 activity
WO2009009059A1 (en) 2007-07-09 2009-01-15 Biogen Idec Ma Inc. Spiro compounds as antagonists of tgf-beta
GB0715087D0 (en) 2007-08-03 2007-09-12 Summit Corp Plc Drug combinations for the treatment of duchenne muscular dystrophy
PE20090510A1 (es) 2007-08-03 2009-05-22 Summit Corp Plc Combinaciones de drogas para el tratamiento de la distrofia muscular de duchenne
GB0715938D0 (en) 2007-08-15 2007-09-26 Vastox Plc Method of treatment of duchenne muscular dystrophy
WO2009025651A1 (en) 2007-08-17 2009-02-26 University Of Maine System Board Of Trustees Biologically active peptide and method of using the same
WO2009035629A1 (en) 2007-09-13 2009-03-19 Ludwig Institute Of Cancer Research Method for modifying cellular immune response by modulating activin activity
US7960343B2 (en) 2007-09-18 2011-06-14 Acceleron Pharma Inc. Activin-ActRIIa antagonists and uses for decreasing or inhibiting FSH secretion
PE20091163A1 (es) * 2007-11-01 2009-08-09 Wyeth Corp Anticuerpos para gdf8
EA201000844A1 (ru) 2007-11-21 2011-10-31 Амген Инк. Связывающие wise агенты и эпитопы
WO2009114180A1 (en) 2008-03-13 2009-09-17 The General Hospital Corporation Inhibitors of the bmp signaling pathway
FR2930460B1 (fr) * 2008-04-25 2010-05-28 Valois Sas Distributeur de fragrance.
WO2009137075A1 (en) 2008-05-06 2009-11-12 Acceleron Pharma Inc. Anti-activin antibodies and uses for promoting bone growth
JP2011523357A (ja) 2008-05-06 2011-08-11 ジョスリン ダイアビーティス センター インコーポレイテッド 褐色脂肪細胞分化を誘導するための方法および組成物
KR101871510B1 (ko) 2008-06-26 2018-06-26 악셀레론 파마 인코포레이티드 액티빈-actriia 길항물질을 투약하는 방법 및 치료된 환자의 모니터링
NZ602471A (en) 2008-06-26 2014-10-31 Acceleron Pharma Inc Antagonists of activin-actriia and uses for increasing red blood cell levels
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
DK2340031T3 (da) * 2008-08-14 2019-07-15 Acceleron Pharma Inc Gdf-fanger til anvendelse ved behandling af anæmi
US20110293526A1 (en) 2008-11-20 2011-12-01 University Of Southern California Compositions and methods to modulate hair growth
UA107921C2 (en) 2008-11-26 2015-03-10 Amgen Inc Variants of polypeptide of receptor ivr activin and their use
EP2387412A4 (en) 2009-01-13 2013-04-03 Acceleron Pharma Inc PROCESS FOR INCREASING THE ADIPONECTIN MIRROR
US8110355B2 (en) 2009-02-20 2012-02-07 GenRemedy, LLC Methods for identifying agents that inhibit cell migration, promote cell adhesion and prevent metastasis
SG174273A1 (en) 2009-04-27 2011-10-28 Novartis Ag Compositions and methods for increasing muscle growth
EP2440576A4 (en) 2009-06-08 2013-11-20 Acceleron Pharma Inc PROCESS FOR INCREASING THE NUMBER OF THERMOUS ADIPOCYTES
CN107267520A (zh) 2009-06-12 2017-10-20 阿塞勒隆制药公司 截短的actriib‑fc融合蛋白
EP3838919A1 (en) 2009-08-13 2021-06-23 Acceleron Pharma Inc. Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels
KR20210029836A (ko) 2009-09-09 2021-03-16 악셀레론 파마 인코포레이티드 ActRIIb 길항제들와 이의 투약 및 용도
EP3260130B1 (en) 2009-11-03 2021-03-10 Acceleron Pharma Inc. Methods for treating fatty liver disease
AU2010322011B2 (en) 2009-11-17 2016-03-31 Acceleron Pharma Inc. ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy
WO2012027065A2 (en) 2010-08-27 2012-03-01 Celgene Corporation Combination therapy for treatment of disease
US8580922B2 (en) 2011-03-04 2013-11-12 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
ES2692519T3 (es) 2011-07-01 2018-12-04 Novartis Ag Método para tratar trastornos metabólicos
ES2741477T3 (es) 2011-10-17 2020-02-11 Acceleron Pharma Inc Composiciones para tratar la sobrecarga de hierro en talasemia
US8765385B2 (en) 2011-10-27 2014-07-01 Ravindra Kumar Method of detection of neutralizing anti-actriib antibodies
WO2013063536A1 (en) 2011-10-27 2013-05-02 Acceleron Pharma, Inc. Actriib binding agents and uses thereof
WO2013059876A1 (en) 2011-10-28 2013-05-02 Paranta Biosciences Limited A method of treating mucus hypersecretion
BR112014015003A2 (pt) 2011-12-19 2019-09-24 Amgen Inc composição farmacêutica, método para tratar um cancer e método para reduzir o tamanho de uma massa tumoral
US10501512B2 (en) 2012-04-02 2019-12-10 Modernatx, Inc. Modified polynucleotides
US9663569B2 (en) 2012-06-14 2017-05-30 The Medical Research, Infrastructure, And Health Services Fund Of The Tel Aviv Medical Center Use of blocking agents of bone morphogenic protein (BMP) signalling for the treatment of neuroinflammatory and neurodegenerative diseases
CN104411720B (zh) 2012-07-02 2018-05-11 协和发酵麒麟株式会社 以抗bmp9抗体作为有效成分的、对肾性贫血、癌性贫血等贫血的治疗剂
NZ747350A (en) 2012-10-24 2020-07-31 Celgene Corp Methods for treating anemia
JP6401171B2 (ja) 2012-10-24 2018-10-03 セルジーン コーポレイション 貧血の治療に使用するためのバイオマーカー
WO2014064292A1 (en) 2012-10-26 2014-05-01 Universite Pierre Et Marie Curie (Paris 6) A method for preventing or treating atrial fibrillation
MX366336B (es) 2012-11-02 2019-07-05 Celgene Corp Antagonistas de activina - actrii y usos para el tratar trastornos oseos y otros.
KR102467714B1 (ko) 2012-11-08 2022-11-16 클리어사이드 바이오메디컬, 인코포레이드 인간 대상체에서 안구 질병을 치료하기 위한 방법 및 장치
WO2014093531A1 (en) 2012-12-11 2014-06-19 Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center Modulation of myofiber repair by anti-myostatin in strategies with stem cells
US20140220033A1 (en) 2013-02-01 2014-08-07 Santa Maria Biotherapeutics, Inc. Administration of an Anti-Activin-A Compound to a Subject
US20160184458A1 (en) 2013-03-14 2016-06-30 Shire Human Genetic Therapies, Inc. Mrna therapeutic compositions and use to treat diseases and disorders
TWI655207B (zh) 2013-07-30 2019-04-01 再生元醫藥公司 抗活化素a之抗體及其用途
HK1219280A1 (zh) 2013-08-14 2017-03-31 Novartis Ag 治疗偶发性包涵体肌炎之方法
WO2015089575A1 (en) 2013-12-16 2015-06-25 Paranta Biosciences Limited Method of diagnosis and treatment
WO2015108972A1 (en) 2014-01-14 2015-07-23 Santa Maria Biotherapeutics, Inc. Activin inhibitor response prediction and uses for treatment
WO2015111008A2 (en) 2014-01-27 2015-07-30 Novartis Ag Biomarkers predictive of muscle atrophy, method and use
JP6601687B2 (ja) 2014-03-31 2019-11-06 大日本住友製薬株式会社 進行性骨化性線維異形成症の予防剤及び治療剤
EP3808778A1 (en) 2014-04-18 2021-04-21 Acceleron Pharma Inc. Methods for increasing red blood cell levels and treating sickle-cell disease
TW201622746A (zh) 2014-04-24 2016-07-01 諾華公司 改善或加速髖部骨折術後身體復原之方法
BR112016029211A2 (pt) 2014-06-13 2018-01-30 Amgen Inc composição, método para inibir um crescimento tumoral sólido em um indivíduo, método para produzir uma proteína, método para inibir, reduzir ou tratar de caquexia em um indivíduo, método para tratar obesidade ou uma doença associada à obesidade e kit

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5283317A (en) 1987-08-03 1994-02-01 Ddi Pharmaceuticals, Inc. Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols
US5677196A (en) 1993-05-18 1997-10-14 University Of Utah Research Foundation Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays
US5525490A (en) 1994-03-29 1996-06-11 Onyx Pharmaceuticals, Inc. Reverse two-hybrid method
WO1996026432A1 (en) 1995-02-23 1996-08-29 University Of Utah Research Foundation Composite waveguide for solid phase binding assays
US5955280A (en) 1995-04-11 1999-09-21 The General Hospital Corporation Reverse two-hybrid system
US5965368A (en) 1995-04-11 1999-10-12 The General Hospital Corporation Reverse two-hybrid systems
US6521750B2 (en) 1997-07-30 2003-02-18 Univ Emory Bone mineralization proteins, DNA, vectors, expression systems
WO2002032925A2 (en) 2000-10-16 2002-04-25 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2002088171A2 (en) 2001-04-26 2002-11-07 Avidia Research Institute Combinatorial libraries of monomer domains
WO2006012627A2 (en) 2004-07-23 2006-02-02 Acceleron Pharma Inc. Actrii receptor polypeptides, methods and compositions
WO2006055689A2 (en) 2004-11-16 2006-05-26 Avidia Research Institute Protein scaffolds and uses thereof

Non-Patent Citations (24)

* Cited by examiner, † Cited by third party
Title
"Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS
"Current Protocols in Molecular Biology", 1992, JOHN WILEY & SONS
"Molecular Cloning A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
ANDERSSON ET AL., J. ENDOCRINOL., vol. 170, pages 529 - 537
BARTEL ET AL., BIOTECHNIQUES, vol. 14, 1993, pages 920 - 924
CHENG ET AL., J BONE JOINT SURG AM., vol. 85-A, no. 8, 2003, pages 1544 - 52
COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, INC., pages: 77 - 96
DALUISKI ET AL., NAT GENET., vol. 27, no. 1, 2001, pages 84 - 8
FRALEY ET AL., TRENDS BIOCHEM. SCI., vol. 6, 1981, pages 77
GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS
HINO ET AL., FRONT BIOSCI., vol. 9, 2004, pages 1520 - 9
HOCHULI ET AL., J. CHROMATOGRAPHY, vol. 411, 1987, pages 177
IWABUCHI ET AL., ONCOGENE, vol. 8, 1993, pages 1693 - 1696
JAKOBY WB ET AL., METHODS IN ENZYMOLOGY, vol. 46, 1974, pages 1
JANKNECHT ET AL., PNAS USA, vol. 88, pages 8972
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497
KOZBAR ET AL., IMMUNOLOGY TODAY, vol. 4, 1983, pages 72
KUBO ET AL., STEROID BIOCHEMISTRY & MOLECULAR BIOLOGY, vol. 68, 1999, pages 197 - 202
MADURA ET AL., J BIOL CHEM, vol. 268, 1993, pages 12046 - 12054
MANNINO ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 682
NAMKUNG-MATTHAI ET AL., BONE, vol. 28, 2001, pages 80 - 86
VIDAL; LEGRAIN, NUCLEIC ACIDS RES, vol. 27, 1999, pages 919 - 29
VIDAL; LEGRAIN, TRENDS BIOTECHNOL, vol. 17, 1999, pages 374 - 81
ZERVOS ET AL., CELL, vol. 72, 1993, pages 223 - 232

Cited By (85)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8252900B2 (en) 2004-07-23 2012-08-28 Acceleron Pharma Inc. Actriib-Fc polynucleotides, polypeptides, and compositions
US9138459B2 (en) 2004-07-23 2015-09-22 Acceleron Pharma Inc. ACTRIIB-FC polynucleotides, polypeptides, and compositions
EP2329837A1 (en) * 2005-11-23 2011-06-08 Acceleron Pharma Inc. Promoting bone growth
EP3269381A1 (en) * 2005-11-23 2018-01-17 Acceleron Pharma, Inc. Activin-actriia antagonists in use for promoting bone growth
US7951771B2 (en) 2005-11-23 2011-05-31 Acceleron Pharma Inc. Activin-ActRIIa antagonists and uses for promoting bone growth
US9480742B2 (en) 2005-11-23 2016-11-01 Acceleron Pharma Inc. Method of promoting bone growth by an anti-actriia antibody
US9572865B2 (en) 2005-11-23 2017-02-21 Acceleron Pharma Inc. Activin-actriia antagonists and uses for treating multiple myeloma
US10071135B2 (en) 2005-11-23 2018-09-11 Acceleron Pharma Inc. Method of identifying an agent that promotes bone growth or increases bone density
US8629109B2 (en) 2005-11-23 2014-01-14 Acceleron Pharma Inc. Method for promoting bone growth using activin-actriia antagonists
US11129873B2 (en) 2005-11-23 2021-09-28 Acceleron Pharma Inc. Method for promoting bone growth using activin-actriia antagonists
US8067360B2 (en) 2005-11-23 2011-11-29 Acceleron Pharma Inc. Method for promoting bone growth using activin-ActRIIa antagonists
US8128933B2 (en) 2005-11-23 2012-03-06 Acceleron Pharma, Inc. Method of promoting bone growth by an anti-activin B antibody
US9163075B2 (en) 2005-11-23 2015-10-20 Acceleron Pharma Inc. Isolated polynucleotide that encodes an ActRIIa-Fc fusion polypeptide
US8486403B2 (en) 2005-11-23 2013-07-16 Acceleron Pharma, Inc. Method of promoting bone growth by an anti-activin A antibody
US10239940B2 (en) 2005-11-23 2019-03-26 Acceleron Pharma Inc. Method of promoting bone growth by an anti-actriia antibody
US10093707B2 (en) 2006-12-18 2018-10-09 Acceleron Pharma Inc. Antagonists of activin-ActRIIa and uses for increasing red blood cell levels
US8007809B2 (en) 2006-12-18 2011-08-30 Acceleron Pharma Inc. Activin-actrii antagonists and uses for increasing red blood cell levels
US7988973B2 (en) 2006-12-18 2011-08-02 Acceleron Pharma Inc. Activin-ActRII antagonists and uses for increasing red blood cell levels
US9526759B2 (en) 2007-02-01 2016-12-27 Acceleron Pharma Inc. Activin-actriia antagonists and uses for treating or preventing breast cancer
US8343933B2 (en) 2007-02-02 2013-01-01 Acceleron Pharma, Inc. Variants derived from ActRIIB and uses therefor
US7842663B2 (en) 2007-02-02 2010-11-30 Acceleron Pharma Inc. Variants derived from ActRIIB and uses therefor
US9399669B2 (en) 2007-02-02 2016-07-26 Acceleron Pharma Inc. Variants derived from ActRIIB
US10259861B2 (en) 2007-02-02 2019-04-16 Acceleron Pharma Inc. Variants derived from ActRIIB and uses therefor
WO2009038745A1 (en) * 2007-09-18 2009-03-26 Acceleron Pharma Inc. Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion
CN103877564A (zh) * 2007-09-18 2014-06-25 阿塞勒隆制药公司 活化素-actriia拮抗剂和减少或抑制fsh分泌的用途
US8367611B2 (en) 2007-09-18 2013-02-05 Acceleron Pharma Inc. Activin-actriia antagonists for inhibiting germ cell maturation
US7960343B2 (en) 2007-09-18 2011-06-14 Acceleron Pharma Inc. Activin-ActRIIa antagonists and uses for decreasing or inhibiting FSH secretion
US9353356B2 (en) 2007-09-18 2016-05-31 Acceleron Pharma Inc. Activin-actriia antagonists for treating a follicle-stimulating horomone-secreting pituitary tumor
EP3363453A1 (en) 2008-06-26 2018-08-22 Acceleron Pharma Inc. Soluble actriia as activin-actriia antagonist for use in treating anemia or bone-related disorders
EP3415161A1 (en) 2008-06-26 2018-12-19 Acceleron Pharma Inc. The use of an actriib antagonist for the treatment of anemia
EP3620795A1 (en) 2008-06-26 2020-03-11 Acceleron Pharma Inc. Antagonists of soluble activin-actriia and uses for increasing red blood cell levels
WO2009158033A2 (en) 2008-06-26 2009-12-30 Acceleron Pharma Inc. Antagonists of activin-actriia and uses for increasing red blood cell levels
WO2009158035A2 (en) 2008-06-26 2009-12-30 Acceleron Pharma Inc. Methods for dosing an activin-actriia antagonist and monitoring of treated patients
US9932379B2 (en) 2008-08-14 2018-04-03 Acceleron Pharma Inc. Isolated nucleotide sequences encoding GDF traps
US10829532B2 (en) 2008-08-14 2020-11-10 Acceleron Pharma Inc. Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels
US9505813B2 (en) 2008-08-14 2016-11-29 Acceleron Pharma Inc. Use of GDF traps to treat anemia
US9439945B2 (en) 2008-08-14 2016-09-13 Acceleron Pharma Inc. Isolated nucleotide sequences encoding GDF traps
US11168311B2 (en) 2008-08-14 2021-11-09 Acceleron Pharma Inc. Methods for treating anemia in a subject in need thereof
US11162085B2 (en) 2008-08-14 2021-11-02 Acceleron Pharma Inc. Methods for treating anemia in a subject in need thereof
US11155791B2 (en) 2008-08-14 2021-10-26 Acceleron Pharma Inc. Methods for treating anemia in a subject in need thereof
US8058229B2 (en) 2008-08-14 2011-11-15 Acceleron Pharma Inc. Method of increasing red blood cell levels or treating anemia in a patient
US10889626B2 (en) 2008-08-14 2021-01-12 Acceleron Pharma Inc. Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels
US10829533B2 (en) 2008-08-14 2020-11-10 Acceleron Pharma Inc. Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels
US10689427B2 (en) 2008-08-14 2020-06-23 Acceleron Pharma Inc. Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels
US10377996B2 (en) 2008-08-14 2019-08-13 Acceleron Pharma Inc. Methods of identifying ActRIIB variants
US8703927B2 (en) 2008-08-14 2014-04-22 Acceleron Pharma Inc. Isolated nucleotide sequences encoding GDF traps
US8361957B2 (en) 2008-08-14 2013-01-29 Acceleron Pharma, Inc. Isolated GDF trap polypeptide
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
US8138142B2 (en) 2009-01-13 2012-03-20 Acceleron Pharma Inc. Methods for increasing adiponectin in a patient in need thereof
US8765663B2 (en) 2009-01-13 2014-07-01 Acceleron Pharma Inc. Methods for increasing adiponectin
US9790284B2 (en) 2009-06-08 2017-10-17 Acceleron Pharma Inc. Methods for increasing thermogenic adipocytes
US8178488B2 (en) 2009-06-08 2012-05-15 Acceleron Pharma, Inc. Methods for increasing thermogenic adipocytes
US10968282B2 (en) 2009-06-08 2021-04-06 Acceleron Pharma Inc. Methods for screening compounds for increasing thermogenic adipocytes
US8703694B2 (en) 2009-06-08 2014-04-22 Acceleron Pharma, Inc. Methods for increasing thermogenic adipocytes
US8293881B2 (en) 2009-06-12 2012-10-23 Acceleron Pharma Inc. Isolated nucleic acid encoding a truncated ActRIIB fusion protein
US9745559B2 (en) 2009-06-12 2017-08-29 Acceleron Pharma Inc. Method for decreasing the body fat content in a subject by administering an ActRIIB protein
US10358633B2 (en) 2009-06-12 2019-07-23 Acceleron Pharma Inc. Method for producing an ActRIIB-Fc fusion polypeptide
US9181533B2 (en) 2009-06-12 2015-11-10 Acceleron Pharma, Inc. Truncated ACTRIIB-FC fusion protein
US11066654B2 (en) 2009-06-12 2021-07-20 Acceleron Pharma Inc. Methods and compositions for reducing serum lipids
US8710016B2 (en) 2009-11-17 2014-04-29 Acceleron Pharma, Inc. ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy
US10968262B2 (en) 2009-11-17 2021-04-06 Acceleron Pharma Inc. Methods of increasing sarcolemmal utrophin
US9617319B2 (en) 2009-11-17 2017-04-11 Acceleron Pharma Inc. ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy
US9493556B2 (en) 2010-11-08 2016-11-15 Acceleron Pharma Inc. Actriia binding agents and uses thereof
US10195249B2 (en) 2012-11-02 2019-02-05 Celgene Corporation Activin-ActRII antagonists and uses for treating bone and other disorders
US12365725B2 (en) 2013-03-20 2025-07-22 Genzyme Corporation Methods for treating osteogenesis imperfecta
US9850298B2 (en) 2014-06-13 2017-12-26 Acceleron Pharma Inc. Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide
US11260107B2 (en) 2014-06-13 2022-03-01 Acceleron Pharma Inc. Methods and compositions for treating ulcers
US10487144B2 (en) 2014-06-13 2019-11-26 Acceleron Pharma Inc. Methods for treating ulcers in a hemoglobinopathy anemia with a soluble actRIIB polypeptide
US11813308B2 (en) 2014-10-09 2023-11-14 Celgene Corporation Treatment of cardiovascular disease using ActRII ligand traps
US11471510B2 (en) 2014-12-03 2022-10-18 Celgene Corporation Activin-ActRII antagonists and uses for treating anemia
US11717558B2 (en) 2016-11-10 2023-08-08 Keros Therapeutics, Inc. Nucleic acid molecules encoding activin receptor type IIA variants
US11013785B2 (en) 2016-11-10 2021-05-25 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
US11090361B2 (en) 2016-11-10 2021-08-17 Keros Therapeutics, Inc. Activin receptor type IIa variants and methods of use thereof
US12350313B2 (en) 2016-11-10 2025-07-08 Keros Therapeutics, Inc. Activin receptor type IIa variants and methods of use thereof
US11407799B2 (en) 2016-11-29 2022-08-09 Pharmafox Therapeutics Ag Muscle performance improvement compounds comprising C-terminus agrin fragment and an ACTR2B inhibitor
US11834508B2 (en) 2017-03-24 2023-12-05 Novartis Ag Method of treating structural and/or functional cardiac abnormalities by administering an anti-ActRII receptor antibody
WO2019094751A1 (en) 2017-11-09 2019-05-16 Keros Therapeutics, Inc. Activin receptor type iia variants and methods of use thereof
EP4428147A3 (en) * 2017-11-09 2024-10-30 Keros Therapeutics, Inc. Activin receptor type iia variants and methods of use thereof
EP3706777A4 (en) * 2017-11-09 2021-06-23 Keros Therapeutics, Inc. ACTIVIN RECEPTOR TYPE IIA VARIANTS AND METHOD OF USE THEREOF
US11484573B2 (en) 2017-11-09 2022-11-01 Keros Therapeutics, Inc. Activin receptor type IIa variants and methods of use thereof
US11884715B2 (en) 2018-01-12 2024-01-30 Keros Therapeutics, Inc. Activin receptor type IIB variants and methods of use thereof
US12269858B2 (en) 2018-01-12 2025-04-08 Keros Therapeutics, Inc. Activin receptor type IIB variants and methods of use thereof
US12364737B2 (en) 2018-05-09 2025-07-22 Keros Therapeutics, Inc. Activin receptor type IIA variants and methods of use thereof
US12440539B2 (en) 2020-03-20 2025-10-14 Keros Therapeutics, Inc. Methods of using activin receptor type IIB variants
US12522646B2 (en) 2020-03-20 2026-01-13 Keros Therapeutics, Inc. Activin receptor type II chimeras and methods of use thereof

Also Published As

Publication number Publication date
TW202140531A (zh) 2021-11-01
TW201500371A (zh) 2015-01-01
EP2481415B1 (en) 2019-09-11
IL257848B (en) 2021-04-29
IL200242B (en) 2018-03-29
KR20190026047A (ko) 2019-03-12
SI2120999T1 (sl) 2012-12-31
CN101687016B (zh) 2014-12-31
PL2120999T3 (pl) 2013-01-31
US20090142333A1 (en) 2009-06-04
US8173601B2 (en) 2012-05-08
KR20100014850A (ko) 2010-02-11
JP2017071624A (ja) 2017-04-13
IL281715A (en) 2021-05-31
IL200242A0 (en) 2010-04-29
AU2008216896B2 (en) 2013-06-20
CA2677605A1 (en) 2008-08-21
JP2010518079A (ja) 2010-05-27
KR20200054317A (ko) 2020-05-19
ME02333B (me) 2013-04-30
JP6132861B2 (ja) 2017-05-24
TW200900076A (en) 2009-01-01
US20210261682A1 (en) 2021-08-26
US9572865B2 (en) 2017-02-21
JP2013224317A (ja) 2013-10-31
AU2008216896A1 (en) 2008-08-21
CA2913992A1 (en) 2008-08-21
JP2020176139A (ja) 2020-10-29
KR20210082540A (ko) 2021-07-05
EA200970747A1 (ru) 2010-02-26
CA3039330C (en) 2021-11-09
TW201934141A (zh) 2019-09-01
CN101687016A (zh) 2010-03-31
CA3039330A1 (en) 2008-08-21
TR200906329T1 (tr) 2010-01-21
KR20150115965A (ko) 2015-10-14
PT2120999E (pt) 2012-12-10
AR065289A1 (es) 2009-05-27
JP2018162312A (ja) 2018-10-18
CA2913992C (en) 2019-05-21
JP2015091870A (ja) 2015-05-14
US20170190784A1 (en) 2017-07-06
RS52535B (sr) 2013-04-30
BRPI0807506B1 (pt) 2022-02-15
KR20180083967A (ko) 2018-07-23
EA025371B1 (ru) 2016-12-30
TW201907953A (zh) 2019-03-01
JP5574711B2 (ja) 2014-08-20
ES2394123T3 (es) 2013-01-22
AU2008216896A2 (en) 2011-07-14
TWI667038B (zh) 2019-08-01
EA018221B1 (ru) 2013-06-28
CN104548056B (zh) 2022-09-09
CY1113963T1 (el) 2016-07-27
TWI525102B (zh) 2016-03-11
TW201808334A (zh) 2018-03-16
KR101672156B1 (ko) 2016-11-02
US20130004489A1 (en) 2013-01-03
BRPI0807506A2 (pt) 2013-07-30
EP2484372A1 (en) 2012-08-08
ES2756725T3 (es) 2020-04-27
HRP20120947T1 (hr) 2012-12-31
MX2009008510A (es) 2010-01-15
TWI606062B (zh) 2017-11-21
HK1137366A1 (en) 2010-07-30
CN104548056A (zh) 2015-04-29
EP2481415A1 (en) 2012-08-01
EP2120999A2 (en) 2009-11-25
KR101670417B1 (ko) 2016-11-10
DK2120999T3 (da) 2012-12-03
CA2677605C (en) 2016-01-19
EA201300116A1 (ru) 2013-09-30
EA201690994A1 (ru) 2016-09-30
WO2008100384A3 (en) 2008-12-11
CN104189889A (zh) 2014-12-10
TW201615660A (zh) 2016-05-01
IL257848A (en) 2018-04-30
TWI459963B (zh) 2014-11-11
MX368173B (es) 2019-09-23
EP2120999B1 (en) 2012-08-29
KR20160129095A (ko) 2016-11-08

Similar Documents

Publication Publication Date Title
US20210261682A1 (en) Activin-actriia antagonists and uses for treating multiple myeloma
US20220211806A1 (en) Method for promoting bone growth using activin-actriia antagonists
WO2009137075A1 (en) Anti-activin antibodies and uses for promoting bone growth
AU2013204959B2 (en) Activin-actriia antagonists and uses for promoting bone growth in cancer patients
AU2020204583A1 (en) Activin-ActRIIa antagonists and uses for promoting bone growth in cancer patients
HK40050689A (en) Activin-actriia antagonists in use for promoting bone growth
HK1137366B (en) Pharmaceutical compositions comprising activin-actriia antagonists and use thereof in preventing or treating multiple myeloma
HK1173982A (en) Pharmaceutical compositions comprising activin-actriia antagonists
HK1173982B (en) Pharmaceutical compositions comprising activin-actriia antagonists
HK1174273A (en) Activin-actriia antagonists and uses for promoting bone growth in cancer patients
HK1202245A1 (en) Activin-actriia antagonists in use for promoting bone growth
HK1202245B (en) Activin-actriia antagonists in use for promoting bone growth

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200880011454.1

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08725055

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2009549079

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 200242

Country of ref document: IL

Ref document number: 2009/06329

Country of ref document: TR

WWE Wipo information: entry into national phase

Ref document number: 2677605

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2009/008510

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2008216896

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 1020097017745

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 3118/KOLNP/2009

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2008216896

Country of ref document: AU

Date of ref document: 20080201

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2008725055

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 200970747

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: P-2012/0504

Country of ref document: RS

ENP Entry into the national phase

Ref document number: PI0807506

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20090810

WWE Wipo information: entry into national phase

Ref document number: 2013/12988

Country of ref document: TR

WWE Wipo information: entry into national phase

Ref document number: 1020157026929

Country of ref document: KR