WO2006138675A2 - Her-2 peptides - Google Patents
Her-2 peptides Download PDFInfo
- Publication number
- WO2006138675A2 WO2006138675A2 PCT/US2006/023672 US2006023672W WO2006138675A2 WO 2006138675 A2 WO2006138675 A2 WO 2006138675A2 US 2006023672 W US2006023672 W US 2006023672W WO 2006138675 A2 WO2006138675 A2 WO 2006138675A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- epitope
- sequence
- isolated polypeptide
- composition
- epitopes
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/82—Translation products from oncogenes
Definitions
- HER-2 protein a product of the HER-2 oncogene, is overexpressed in a variety of cancers. It is found in 50%- 60% of ductal in situ carcinoma and 20%-40% of all breast cancers, as well as a substantial
- Overexpression of the HER-2 protein is related to malignant transformation in humans. Overexpression of the HER-2 protein is also intimately associated with the aggressiveness of the malignancy, being found in one-fourth of all invasive breast cancers. Overexpression of HER-2 protein is correlated with a poor prognosis in both breast and ovarian cancer.
- trastuzumab has also been shown to improve survival when combined with cytotoxic chemotherapeutics (Baselga, J., et al., J. Clin. Oncol. 14:737-44, 1996; Pegram, M.D., et al., J. Clin. Oncol, 16:2659-71, 1988.).
- a number of vaccine approaches targeting a recombinant HER-2 protein, the HER-2 ECD, or the ECD of rat neu, which is the rat homolog of HER-2 have also been evaluated.
- strain NFS mice immunized with a vaccinia virus recombinant that expresses the ECD rat neu developed a protective antibody response against subsequent challenge with neu-transformed NIH 3T3 cells (Bernards, R., et al., Proc. Natl. Acad. Sci. USA, 84:6854-8, 1987.).
- Immunization of BDIX rats with the same immunogen did not result in antibody response nor did it inhibit the growth of syngeneic neu-expressing B 104 neuroblastoma cells, suggesting that this strategy was insufficient to induce immune responses in the rat.
- a polysaccharide- oncoprotein complex vaccine consisting of the 147 amino-terminal amino acids of HER-2 ECD complexed with cholesteryl group-bearing mannan and pullulan, induced cellular and humoral immune responses that mediated rejection of HER-2-expressing sarcomas in BALB/c mice (Gu, X. G., et al., Cancer Res., 58: 3385-90, 1998.). Partial protection was shown in rat neu zransgenic mice destined to develop mammary tumors by immunizing with either a purified rat neu ECD (Esserman, L. J., Cancer hnmunol. Immunother., 47:337-42, 1999.) or neu-transfected allogeneic mouse fibroblasts (Cefai, D., et al., hit. J. Cancer, 83:393-400, 1999.)
- HER-2 B epitopes are provided.
- the Epitopes have a sequence of CHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVA; VACAHYKDPPFCVAJ VARCPSGVKPDLSYMPrWI 1 CFPDEEGACQPL; IWKFPDEEGACQPL; LHCPALVTYNTDTFESMPNPEGRYTFGASCV; ACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEK; CPLHNQEVTAEDGTQRCEK; or CPINCTHSCVDLDDKGCP AEQRAS.
- Figure 1 illustrates the HER-2 protein sequence
- Figure 2 shows the synthetic strategy for 3 disulfide pairings. Differential cysteine protection and selective removal and oxidation was used to generate the correct disulfide pairings as illustrated;
- Figure 3 shows the immune response in FVB/n mice.
- Groups of four to ten FVB/n mice were immunized with linear (NC) or disulfide-bonded (SS) peptide constructs (A) MVF563-598, (B) MVF585-598, (C) MVF597-626, or the linear peptide (D) MVF613-626.
- NC linear
- SS disulfide-bonded
- A MVF563-598
- B MVF585-598
- C MVF597-626
- D linear peptide
- FIG. 4 shows that trastuzumab specifically recognizes peptide epitopes designed to mimic the trastuzmab binding-site of HER-2.
- the peptide sequences are given on the x-axis.
- MVF316-339 is an Her-2 irrelevant control peptide;
- Figure 5 shows the flow cytometry of peptide-specific antibodies with human breast cancer cells over-expressing HER-2. Flow cytometry was used to assess whether antibodies from FVB/n mice induced by various constructs recognize native HER-2.
- BT-474 human breast cancer cells (HER-2high) were treated with lO ⁇ g/mL of normal mouse Ig (negative control), mouse monoclonal Ab-2 (positive control), or peptide antibodies raised in FVB/n mice.
- Figure 6 shows the pertuzumab binding sites with HER-2
- Figure 7 shows the 3-dimensional structure of Herceptin Peptide epitopes
- Figure 8 shows the structure of HER-2 bound to OmnitargTM (Pertuzumab).
- Figure 9 shows the HER-2-trastuzumab binding site.
- A Ribbon diagram of HER-2 and the heavy and light chain of trastuzumab complex.
- B The trastuzumab binding-site of HER-2. This region is disulfide-rich. The sequences of the three loops that interact with trastuzumab are indicated;
- FIG 10 shows the binding of trastuzumab to peptides.
- Microtiter wells were coated overnight with 2 ⁇ g/ml of various peptides and then blocked with 1% BSA for one hour.
- Trastuzumab was then added to plates at a concentration of 2000 ⁇ g/ml and serially diluted 1 :2 with PBT. Bound trastuzumab was detected with HRP-conjugated anti-human IgG and then with substrate.
- A The OD 4J5 value for peptides from Table I and an irrelevant control peptide (MVF316-339) using 2000 ⁇ g/ml of trastuzumab. Values shown are the mean of duplicate samples. SEM are indicated by error bars.
- B Titration of trastuzumab with the disulfi de-bound (CYC) and linear (NC) forms of MVF563-598 along with irrelevant control peptide (MVF316-339).
- FIG 11 shows cell proliferation by MTT assay.
- BT474 cells were plated in 96-well microtiter plates at 2 x 104 cells/well and incubated overnight at 37 0 C.
- PBS containing trastuzumab or normal human IgG (lOO ⁇ g/ml) with or without peptide at the indicated concentrations was added to the wells.
- the plates were incubated for three days at 37 0 C.
- the number of viable cells was measured with MTT by reading OD 57O .
- the percentage of inhibition was calculated using the formula (OD norma i hu man igo - OD trastuzumab +peptide)/OD norma i human i gG x 100. Values shown are the mean of triplicate samples. SEM are indicated by error bars;
- Figure 12 shows the antibody response against peptides in FVB/n (A) and Neu-N (B) transgenic mice.
- Direct ELISAs were performed on sera from mice immunized with the cyclized (CYC) and linear (NC) constructs to determine differences in immunogenicity.
- Antibody titers against the corresponding immunogen were defined as the reciprocal of the highest dilution with absorbance > 0.2 .
- Each bar represents an individual mouse. Designation on the x-axis represents time at which sera was sampled, e.g. ly+3 corresponds to serum collected three weeks after the first immunization.
- Neu-N mice have an FVB/n background and express normal rat neu proto-oncogene under control of a mammary-specific promoter. These mice show tolerance to neu relative to non-transgenic mice (Cancer Research 60, 3569). B demonstrates that although these mice are tolerant to rat neu they are able to generate an immune response against the peptide immunogens;
- Figure 13 shows the cross-reactivity of peptide antibodies to HER-2.
- the reactivity of purified antibodies from immunized mouse sera was tested with (A) BT474 and (B) SKBR-3 breast cancer cell lines using flow cytometric analysis. Ab binding was detected with goat-anti mouse FITC-conjugated abs. The x-axis represents fluorescent intensity, and the y-axis represents relative cell number.
- Each histogram contains an overlay of mouse pre IgG, peptide antibodies, and AB2, a mouse mAb that binds HER-2. Both cell lines demonstrate that Abs from epitopes 563-598 and 585-598 do not recognize HER-2, while Abs from epitopes 597-626 and 613-626 recognize HER-2;
- Figure 14 shows a schematic representation of the chimeric peptide vaccine construct consisting of the 'promiscuous' Th-cell epitope MVF co-linearly synthesized with the B-cell epitope via a flexible linker (GPSL), allowing independent folding of MVF and the B-cell epitope. This combination may help to elicit optimal antibody production by activation of both the humoral and innate arms of the immune system;
- GPSL flexible linker
- Figure 15 shows that iodine oxidation was used to form the naturally occurring disulfide bond between Cys268 and Cys295;
- Figure 16 shows the immunogenicity in NZW rabbits immunized with MVFHER2(266-296) non-cyclized (NC) and cyclized (CYC) peptides. Serum is collected weekly and antibodies purified for use in diagnostic studies. Antibody titers are determined by direct ELISA;
- Figure 17 shows A) immunogenicity in WT FVB/n mice immunized with either MVFHER2(266-296) cyclized (CYC) or non-cyclized (NC) peptide (8 mice/group). B) immunogenicity in 3 Neu over-expressing mice with FVB/n background. Antibody titers are determined by direct ELISA;
- Figure 18 shows the ribbon structure of the extracellular domain of HER-2 that interacts with herceptin.
- the arrows show the three loops where HER-2 makes contact with herceptin;
- Figure 19 shows the CD spectroscopy measurements that were performed using 100 uM solution of Her-2 563-598 CYC and Her-2 563-598 NC in water.
- Epitope HER-2 563- 598 CYC which is constrained with three disulfide bonds shows CD ellipticity minima at 193 nm, while epitope HER-2 563-598 NC free peptide shows CD ellipticity minima at 204 nm, which demonstrate significant differences in secondary structure
- Figure 20 shows the HER-2 563-598 epitope, and strategy for selective oxidation, reduction and disulfide bond analysis using a biotinylation agent, which attacks free sulfhydryl groups and therefore can be used to determine the completion of disulfide pairing;
- Figure 21 shows the regioselective disulfide formation.
- Side chain protection for residues 315 and 331 was trityl, which was conveniently removed upon cleavage from the resin.
- the side chain of cysteine residues at 299 and 311 was protected with Acm, which can be selectively removed and cyclized by oxidation (12) after the first cyclization;
- Figure 22 shows the antibody response against peptides in out bred NZW rabbits (A) and inbred FVB/n mice (B).
- Direct ELISAs were performed on sera from animals immunized with the cyclized (CYC) and linear (NC) constructs to determine differences in immunogenicity.
- Antibody titers against the corresponding immunogen were defined as the reciprocal of the highest dilution with absorbance > 0.2 .
- Each bar represents an individual animal. Designation on the x-axis represents time at which sera was sampled, e.g. ly+3w corresponds to serum collected three weeks after the first immunization;
- Figure 23 shows the cross-reactivity of peptide antibodies to HER-2.
- the reactivity of purified antibodies from immunized rabbit sera was tested with (A) BT474 (HER-2high) and (B) MDA468 (HER-21ow) breast cancer cell lines using flow cytometric analysis. Ab binding was detected with goat-anti rabbit FITC-conjugated abs.
- the x-axis represents fluorescent intensity, and the y-axis represents relative cell number.
- Each histogram contains an overlay of rabbit pre IgG, peptide antibodies, and herceptin, a human mAb that binds HER-2.
- Figure 24 shows that peptide antibodies induce ADCC (antibody dependent cell- mediated cytotoxicity) against BT474 breast cancer cells in vitro
- Target cell line BT474 was incubated with peptide antibodies from rabbits, normal rabbit IgG, or herceptin in the presence of Na51CrO4 for one hour. After three washings target cells were cultured with human PBMC effector cells to give an effecto ⁇ target (E:T) ratio of 100:1, 20:1, and 4:1 for four hours at 37 0 C.
- E:T effecto ⁇ target
- Figure 25 shows a schematic representation of the chimeric peptide vaccine construct consisting of the 'promiscuous' TH-cell epitope derived from the measles virus fusion protein (MVF, residues 288-302) co-linearly synthesized with the B-cell epitope (HER-2(266-296)) via a flexible linker (GPSL), allowing independent folding of MVF and the B-cell epitope;
- MVF measles virus fusion protein
- GPSL flexible linker
- Figure 26 shows solid-phase peptide synthesis was performed using preloaded Fmoc- VaI-CLEAR Acid resin. Peptides were cleaved using Reagent B (TFA:Phenol:H2O:TIS, 90:4:4: 1) and crude peptide purifed by RP-HPLC. Iodine oxidation was used to form the naturally occurring disulfide bond between Cys268 and Cys295;
- Figure 27 shows A) Antibody titers of NZW rabbits mice immunized with MVF- HER-2(266-296) noncyclized and cyclized peptides. B) Antibody titers of wild-type FVB/n mice immunized with MVF-HER-2(266-296) noncyclized and cyclized peptides. C) Antibody titers of Neu overexpressing FVB/n mice immunized with MVF-HER-2(266-296). Serum was collected weekly and titers determined by direct ELISA;
- Figure 28 shows the purified MVF-HER-2(266-296) cyclized and noncyclized antibodies tested for their ability to bind to the native protein on human BT474 HER-2 overexpressing tumor cells (A) and mouse NT2.5 neu-overexpressing tumor cells (B). Both antibodies were shifted compared to the normal IgG isotype control and had similar binding compared to the positive controls (Herceptin for BT474 and anti-c-ErbB2/c-Neu (Ab-4) for NT2.5);
- Figure 29 shows antibody-dependent cell-mediated cytotoxicity determined by incubating BT474 cells with purified MVF-HER-2(266-296) cyclized and noncyclized antibodies and 51Cr, then exposing the antibody-bound cells to human PBMCs, which perform immunologic lysis on the BT474 cells; and
- Figure 30 shows wild-type FVB/n mice from Fig. 3B subcutaneously challenged with 3x106 NT2.5 cells and tumor growth monitored for 24 days.
- MVF-HER-2(266-296) cyclized- and noncyclized-treated mice had delayed tumor development (A) and growth (B) as compared to the MVF immunized mice only.
- the present invention provides isolated polypeptides of the HER-2 protein, referred to hereinafter as HER-2 B epitopes.
- the HER-2 B epitopes are immunogenic.
- the present invention additionally provides compositions that include one or more chimeric peptides, and the chimeric peptides include the HER-2 B epitopes. Additionally, compositions having one or more multivalent peptides are provided. These multivalent peptides include two or more of the HER-2 B epitopes. Methods of stimulating an immune response and methods of treating cancer in a subject are additionally provided. Vaccines are also provided for therapeutic and prophylactic use.
- the HER-2 B epitopes may capable of invoking a humoral response which results in the production of antibodies that are immunoreactive with the extracellular domain of the HER-2 protein.
- the HER-2 B epitopes or chimeric peptides confer a protective effect.
- HER-2 protein, and its rat homolog neu are transmembrane proteins with a relative molecular mass of 185 kd that is approximately 1255 amino acids (aa) in length.
- HER-2/neu protein has an extracellular binding domain (ECD) of approximately 645 aa, with 40% homology to epidermal growth factor receptor (EGFR), a highly hydrophobic transmembrane anchor domain (TMD), and a carboxyterminal cytoplasmic domain (CD) of approximately 580 aa with n 80% homology to EGFR.
- ECD extracellular binding domain
- the amino acid sequence of the HER-2 protein and a nucleotide sequence which encodes such amino acid sequence are shown GenBanlc Accession No. Ml 1730.
- Fig. 1 shows the amino acid sequence of the HER-2 protein (SEQ ID NO. 1).
- the HER-2 B epitopes encompass peptides having one of the sequences, referred to hereinafter as the "reference sequences", and the sequences are:
- VACAHYKDPPFCVA SEQ ID NO. 3;
- VARCPSGVKPDLSYMPIWKFPDEEGACQPL SEQ ID NO. 4
- IWKFPDEEGACQPL SEQ ID NO. 5;
- LHCPALVTYNTDTFESMPNPEGRYTFGASCV SEQ ID NO. 6; ACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEK, SEQ ID NO 7; CPLHNQEVTAEDGTQRCEK, SEQ ID NO. 8; or CPINCTHSCVDLDDKGCP AEQRAS, SEQ ID NO. 9.
- the HER-2 B epitopes may be cyclized or linear. When cyclized, the epitopes may be cyclized in any suitable manner. For example, disulfide bonds may be formed between selected cysteine (Cys) pairs in order to provide a desired confirmation. It is believed that the formation of cyclized epitopes may provide conformations that improve the humoral response, thus improving the protective effect.
- cysteine cysteine
- the HER_2 B epitopes identified by SEQ ID NOS. 2-5 contain at least one region of the three regions that make contact with trastuzumab in the trastuzumab binding region of the HER-2 extracellular domain (SEQ ID NO. 1).
- SEQ ID NO. 1 the crystal structure of the extracellular region of HER-2 alone and complexed to the Fab fragment of trastuzumab was published.
- Trastuzumab was shown to interact with three loops in subdomain IV comprising residues from SEQ ID NO.
- loops 1 and 3 are further stabilized by interaction with trastuzumab mainly through electrostatic interactions, whereas loop 2 take part in hydrophobic interactions.
- the HER-2 B epitope identified by SEQ ID NO. 2 represents positions 563-598 of the HER-2 protein (SEQ ID. NO. 1).
- the HER-2 B epitope identified by SEQ ID NO. 2 may be cyclized by the formation of a disulfide bonds between Cys-563 and Cys-576, Cys-567 and Cys-584, and/or Cys-587 and Cys-596.
- the HER-2 B epitope identified by SEQ ID. NO. 3 represents positions 585-598.
- the HER-2 B epitope identified by SEQ ID NO. 3 may be cyclized by the formation of a disulfide bond between Cys-587 and Cys-596.
- SEQ ID NO. 4 represents positions 597-626, and the underlined leucine (Leu) amino acid was mutated from Cys to Leu in order not to interfere with disulfide bond formation.
- the HER-2 B epitope identified by SEQ ID NO. 4 may be cyclized by the formation of a disulfide bond between Cys-600 and Cys-623.
- the HER-2 B epitope identified by SEQ ID NO. 5 represents positions 613-626, and the bold Leu amino acid was mutated from Cys to Leu in order not to interfere with disulfide bond formation as will be discussed further herein. It will be understood that the indicated Leu amino acids in SEQ ID NOS. 4 and 5 may alternatively be Cys.
- the HER-2 B epitopes identified by SEQ ID NOS. 6-8 represent sequences designed to elicit antibody similar to the pertuzmab binding site of HER-2 (SEQ ID No. 1).
- the HER_2 B epitope identified by SEQ ID. NO. 6 represents positions 315-333 of the HER-2 protein (SEQ ID NO. 1).
- the HER-2 B epitope identified by SEQ ID NO. 6 may be cyclized by the formation of a disulfide bond between Cys-315 and Cys-331.
- the HER-2 B epitope identified by SEQ ID NO. 7 represents positions 298-333.
- the HER-2 B epitope identified by SEQ ID NO. 8 represents positions 266-296.
- the HER-2 B epitope identified by SEQ ID NO. 8 may be cyclized by the formation of a disulfide bond between Cys-268 and Cys-295.
- the HER-2 B epitope identified by SEQ ID NO. 9 represents positions 626-649. This sequence may have disulfide bonds between Cys-626 and Cys-634 and/or Cys-630 and Cys- 634. It will be understood that each of epitopes having more than one Cys may be cyclized or linear.
- the HER-2 B epitopes also encompass peptides that are functional equivalents of the peptides identified by SEQ ID NOS. 2-9. Such functional equivalents have an altered sequence in which one or more of the amino acids in the corresponding HER-2 B epitope sequence is substituted or in which one or more amino acids are deleted from or added to the corresponding reference sequence. For example 1 to 3 amino acids may be added to the amino terminus, carboxy terminus, or both. In some examples, the HER-2 B epitopes are glycosylated.
- the HER-2 B epitopes may be the retro-inverso isomers of the HER-2 B epitopes.
- the retro-inverso modification comprises the reversal of all amide bonds within the peptide backbone. This reversal may be achieved by reversing the direction of the sequence and inverting the chirality of each amino acid residue by using D-amino acids instead of the L-amino acids.
- This retro-inverso isomer form may retain planarity and conformation restriction of at least some of the peptide bonds.
- the nonretro- inverso form of SEQ ID. NO. 5 may be indicated as NH 2 -Z[IWKFPDEEGACQPL]-COOH.
- the retro-inverso form of SEQ ID NO. 5 may be indicated as NH 2 -D[LPQCAGEEDPFKWI] -COOH .
- Nonconservative amino acid substitutions and/or conservative substitutions may be made. Substitutions are conservative amino acid substitutions when the substituted amino acid has similar structural or chemical properties with the corresponding amino acid in the reference sequence.
- conservative amino acid substitutions involve substitution of one aliphatic or hydrophobic amino acids, e.g., alanine, valine, leucine and isoleucine, with another; substitution of one hydroxyl-containing amino acid, e.g., serine and threonine, with another; substitution of one acidic residue, e.g., glutamic acid or aspartic acid, with another; replacement of one amide-containing residue, e.g., asparagine and glutamine, with another; replacement of one aromatic residue, e.g., phenylalanine and tyrosine, with another; replacement of one basic residue, e.g., lysine, arginine and histidine, with another; and replacement of one small amino acid, e.g.,
- the deletions and additions are located at the amino terminus, the carboxy terminus, or both, of one of the sequences shown above.
- the HER-2 B epitope equivalent has an amino acid sequence which is at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to the corresponding HER-2 B epitope sequences. Sequences which are at least 90% identical have no more than 1 alteration, i.e., any combination of deletions, additions or substitutions, per 10 amino acids of the reference sequence. Percent identity is determined by comparing the amino acid sequence of the variant with the reference sequence using MEGALIGN project in the DNA STAR program.
- the functional equivalent may have a sequence which is at least 90% identical to the HER-2 B epitope sequence and the sequences which flank the HER-2 B epitope sequences in the wild-type HER-2 protein.
- Functional equivalents of the HER-2 B epitopes may be identified by modifying the sequence of the epitope and then assaying the resulting polypeptide for the ability to stimulate an immune response, e.g., production of antibodies.
- assays may generally be performed by preparing a chimeric peptide which comprises the modified polypeptide and a Th epitope, injecting the chimeric peptide into a test animal and assaying for antibodies.
- Such antibodies may be found in a variety of body fluids including sera and ascites. Briefly, a body fluid sample is isolated from a warm-blooded animal, such as a human, for whom it is desired to determine whether antibodies specific for HER-2/neu polypeptide are present.
- the body fluid is incubated with HER-2/neu polypeptide under conditions and for a time sufficient to permit immunocomplexes to form between the polypeptide and antibodies specific for the protein and then assayed, preferably using an ELISA technique. In such technique, the colorimetric change is measured at 490 nm.
- Epitopes which induce production of antibodies that exhibit a titer equal to 10,000 or greater for HER-2/neu protein may be useful. As used herein a titer of 10,000 refers to an absorbance value of 0.2 above background.
- chimeric peptides and compositions comprising one or more chimeric peptides are provided.
- the chimeric peptides comprise a HER-2 B epitope, a T helper (Th) epitope, and a linker joining the HER-2 B epitope to the Th epitope.
- Th epitope any suitable Th epitope may be used.
- a promiscuous Th epitope may be used.
- a "promiscuous" Th epitope is one which promotes release of cytokines that assists in bypassing MHC restriction. It will be further understood that any suitable linker may be used.
- the HER-2 B epitope may be linked to either the amino or the carboxy terminus of the Th epitope.
- the location and selection of the Th epitope depends on the structural characteristics of the HER-2 B epitope, whether alpha helical or beta-turn or strand. Methods for selecting suitable Th epitopes are described in Kaumaya et al, "DE NOVO" ENGINEERING OF PEPTIDE IMMUNOGENIC AND ANTIGENIC DETERMINANTS AS POTENTIAL VACCINES, in Peptides, Design, Synthesis and Biological Activity (1994), pp. 133-164, which is specifically incorporated herein by reference.
- the Th epitope may be from about 14 to about 22, about 15 to 21, or 16 amino acids in length.
- suitable Th epitopes include, but are not limited to:
- NSVDD ALINSTIYSYFPSV, SEQ ID NO. 11;
- the linker may be a peptide of from about 2 to about 15 amino acids, about 2 to about 10 amino acids, or from about 2 to about 6 amino acids in length.
- the linker may be a peptide having the amino acid sequence Gly-Pro-Ser-Leu, SEQ ID NO. 18, The chimeric peptides may be linear or cyclized.
- the HER-2 B epitopes, the Th epitopes, and/or the linker may be in retro-inverso form.
- the HER-2 B epitope along could be in retro inverse form.
- the HER-2 B epitope and the Th epitope could be in retro inverso form.
- the HER-2 B epitope, the Th epitope, and the linker could be in retro inverso form.
- Suitable chimeric peptides include but are not limited to-. KLLSLIKGVIVHRLEGVE-GPSL-
- ACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEK SEQ E) NO. 24; KLLSLDCGVrVHRLEGVE-GPSL-CPLHNQEVTAEDGTQRCEK, SEQ ID NO. 25; or KLLSL ⁇ CGVrVHRLEGVE-GPSL-CPINCTHSCVDLDDKGCP AEQRAS, SEQ ID NO. 26.
- the peptides of SEQ ID NOS. 19-26 have a Th epitope, a GPSL linker and a HER-2 B epitope.
- the chimeric peptides and compositions comprising the peptides may be useful imrnunogens for inducing production of antibodies that interact with and bind to the extracellular domain of the HER-2 protein.
- the chimeric peptides may also be useful as laboratory tools for detecting antibodies to HER-2 protein in a subject's sera.
- the chimeric peptides may invoke an antibody response in a subject and that such antibodies may (a) immunopreciptate HER-2 protein, (b) bind to intact HER 2 receptor on ER-2 overexpressing cells in culture, and (c) reduce proliferation of HER-2 overexpressing cells in vitro.
- the chimeric peptides may also be used to immunize a subject and retard or prevent tumor development.
- compositions comprising a mixture of two or more of the chimeric peptides are provided.
- the HER-2 B epitope of each of the two or more chimeric peptides are different.
- one of the HER-2 B epitopes is selected from SEQ ID NOS. 2-5 and another one of the HER-2 B epitopes is selected from SEQ IDS NOS. 6-8.
- the HER-2 B epitopes and chimeric peptides may be synthesized using commercially available peptide synthesizers.
- the chemical methods described in Kaumaya et al., "DE NOVO" ENGINEERING OF PEPTIDE IMMUNOGENIC AND ANTIGENIC DETERMINANTS AS POTENTIAL VACCINES, in Peptides, Design, Synthesis and Biological Activity (1994), pp 133-164, which is specifically incorporated herein by reference, may be used.
- HER-2 B-cell epitopes may be synthesized co-linearly with the Th epitope to form a chimeric peptide.
- Peptide synthesis may be performed using Fmoc/t-But chemistry.
- the HER-2 B epitopes and chimeric peptides may be cyclized in any suitable manner.
- disulfide bonds may be achieved using differentially protected cysteine residues, iodine oxidation, the addition of water to boost Acm removal and the concomitant formation of a disulfide bond, and/or the silyl chloride-sulfoxide method.
- the HER-2 B epitopes and chimeric peptides may also be produced using cell-free translation systems and RNA molecules derived from DNA constructs that encode the epitope or peptide.
- the epitopes or chimeric peptides are made by transfecting host cells with expression vectors that comprise a DNA sequence that encodes the respective epitope or chimeric peptide and then inducing expression of the polypeptide in the host cells.
- recombinant constructs comprising one or more of the sequences which encode the epitope, chimeric peptide, or a variant thereof are introduced into host cells by conventional methods such as calcium phosphate transfection, DEAE- dextran mediated transfection, transvection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape lading, bollistic introduction or infection.
- the HER-2 B epitope and chimeric peptide may be expressed in suitable host cells, such as for example, mammalian cells, yeast, bacteria, insect cells or other cells under the control of appropriate promoters using conventional techniques.
- suitable hosts include, but are not limited to, E. coli, P. pastoris, Cos cells and 293 HEK cells.
- glycosylated epitopes and chimeric peptides may be produced using recombinant techniques.
- mammalian cells such as, Cos-7 and Hep-G2 cells be employed in the recombinant techniques.
- glycoslyated epitopes and chimeric peptides may be produced using standard Fmoc/tBut synthesis.
- one or more sugar units can be added to peptides using a chemo enzymatic approach employing endo- ⁇ -N- aceylglucosaminidases as the key enzyme for oligosaccharide transfer.
- Naturally occurring variants of the HER-2 B epitopes may also be isolated by, for example, by screening an appropriate cDNA or genomic library with a DNA sequence encoding the polypeptide.
- multivalent peptides which comprise a plurality, i.e., at least two of the HER 2-B epitopes or functional equivalents thereof and a Th epitope are provided.
- the HER-2 B epitopes and Th epitope are connected to a template.
- the HER-2 B epitopes and the Th epitope may be connected to a core ⁇ sheet template.
- the template may be two strands of alternating leucine and lysine residues, which are connected by a linker.
- the linker is an amino acid or a peptide of from about 2 to about 15 amino acids, from about 2 to about 10 amino acids, or from about 2 to about 6 amino acids in length.
- the linker may be the amino acid sequence Gly-Pro-Ser-Leu, SEQ ID NO. 18.
- Multivalent peptides may be synthesized in any suitable manner.
- multivalent peptides may be prepared by employing a combinatorial Fmoc/tbutyl, Fmoc/benzyl and Boc benzyl strategy as well as a fourth level of differential protecting group (Npys) strategy. Details of such approach are presented in Larimore et al. (1995) Journal of Virology 69:6077-6089, which is specifically incorporated herein by reference.
- isolated polynucleotides which encode the HER-2 B epitopes and the chimeric peptides discussed herein are provided.
- the present polynucleotides also encompass polynucleotides having sequences that are capable of hybridizing to the nucleotide sequences of the HER-2 B epitopes or the chimeric peptides under stringent conditions, and/or highly stringent conditions.
- Hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex or probe, as described in Berger and Kimmel (1987) Guide to Molecular Cloning Techniques, Methods in Enzymology, vol 152, Academic Press.
- stringent conditions is the “stringency” which occurs within a range from about Tm-5 (5° below the melting temperature of the probe) to about 20° C below Tm.
- highly stringent conditions employ at least 0.2 x SSC buffer and at least 65° C.
- stringency conditions can be attained by varying a number of factors such as the length and nature, i.e., DNA or RNA, of the probe; the length and nature of the target sequence, the concentration of the salts and other components, such as formamide, dextran sulfate, and polyethylene glycol, of the hybridization solution. AU of these factors may be varied to generate conditions of stringency which are equivalent to the conditions listed above.
- Polynucleotides comprising sequences encoding a HER-2 B epitope or a chimeric peptide of the present invention may be synthesized in whole or in part using chemical methods or recombinant methods which are suitable.
- Polynucleotides which encode a HER-2 B epitope may be obtained by screening a genomic library or cDNA library with antibodies immunospecific for the HER-2 protein to identify clones containing such polynucleotide.
- the polynucleotides are useful for producing a HER-2 B epitope or a chimeric peptide.
- an RNA molecule encoding a multivalent chimeric peptide may be used in a cell-free translation systems to prepare such polypeptides.
- a DNA molecule encoding a HER-2 B epitope or a chimeric peptide may be introduced into an expression vector and used to transform cells.
- Suitable expression vectors include, but are not limited to, chromosomal, nonchromosomal and synthetic DNA sequences, e.g., derivatives of SV40, bacterial plasmids, phage DNAs; yeast plasmids, vectors derived from combinations of plasmids and phage DNAs, viral DNA such as vaccinia, adenovirus, fowl pox virus, pseudorabies, baculovirus, and retrovirus.
- the DNA sequence may introduced into the expression vector by any suitable procedure.
- recombinant constructs comprising one or more of the polynucleotides encoding one or more HER-2 B epitopes or chimeric peptides.
- Suitable constructs include, for example, vectors, such as a plasmid, phagemid, or viral vector, into which a sequence that encodes the HER-2 B cell epitiope or the chimeric peptide has been inserted, hi the expression vector, the DNA sequence which encodes the epitope or chimeric peptide is operatively linked to an expression control sequence, i.e., a promoter, which directs mRNA synthesis.
- promoters include the LTR or SV40 promoter, the E.
- the expression vector may also contain a ribosome binding site for translation initiation and a transcription terminator.
- the recombinant expression vectors also may include an origin of replication and a selectable marker, such as for example, the ampicillin resistance gene of E. coli to permit selection of transformed cells, i.e., cells that are expressing the heterologous DNA sequences.
- the polynucleotide sequence encoding the H ⁇ R-B cell epitope or the chimeric peptide may be incorporated into the vector in frame with translation initiation and termination sequences.
- the polynucleotide may further encode a signal sequence which is operatively linked to the amino terminus of the H ⁇ R-2 B epitope or chimeric peptide.
- the polynucleotides encoding the HER-2 B epitope or the chimeric peptides comprising such epitopes may be used to express recombinant peptide using suitable techniques. Such techniques include, but are not limited to, those described in Sambrook, J. et al (1989) Molecular Cloning A Laboratory Manual, Cold Spring Harbor Press, Plainview, N. Y. and Ausubel, F. M. et al. (1989) Cuurent Protocols in Molecular Biology, John Wile & Sons, New York, NY. Polynucleotides encoding the HER-2 B epitope or the chimeric peptides comprising such epitopes may also be used to immunize subjects.
- methods of treating cancer comprise administering a pharmaceutical composition to a subject.
- vaccines comprising at least one chimeric peptide, multivalent peptide, or both, of the polynucleotide which encodes the same are provided.
- the pharmaceutical composition comprises a pharmaceutically acceptable vehicle and at least one chimeric peptide, multivalent peptide, or both, or the polynucleotide which encodes the same, as described herein.
- Pharmaceutically acceptable vehicles include, but are not limited to pharmaceutically acceptable carriers, excipients or diluents. These vehicles are generally nontoxic to subjects at the dosages and concentrations employed.
- a vehicle for antigen delivery examples include aluminum salts, water-in-oil emulsions, biodegradable oil vehicles, oil-in-water emulsions, biodegradable microcapsules, and liposomes.
- a suitable vehicle for antigen delivery is a biodegradable microsphere, which may be comprised of poly (D, L- lactide-co-glycolide) (PLGA).
- the type of carrier will vary depending on the mode of administration and whether a substantial release is desired.
- the carrier may be water, saline, alcohol, a fat, a wax, or a buffer.
- Biodegradable microspheres e.g., polylactic galactide
- the pharmaceutical composition comprises an adjuvant.
- the HER-2 chimeric and multivalent peptides and the polynucleotides which encode the same may be useful for enhancing or eliciting, in a subject or a cell line, a humoral response and, preferably, a cellular immune response (e.g., the generation of antigen-specific cytolytic T cells).
- the subject is a human.
- a subject may be afflicted with cancer or other cancer involving HER-2, such as breast cancer, or may be normal (i.e., free of detectable disease and infection).
- the pharmaceutical compositions and vaccines may be useful for treating women who have a family history of breast cancer or who have had breast tumors removed.
- treating means inhibiting or slowing or retarding the growth of the tumor .
- cancers include, but are not limited to, breast, lung, ovarian, bladder and prostate.
- multiple intramuscular injections, at three week intervals, are used to administer the pharmaceutical composition. Examples
- Peptides were synthesized as previously described (Kaumaya 1994). Briefly, peptides were synthesized on a Milligen/Biosearch 9600 peptide synthesizer, using a 4-methylbenzhydrylamine resin as the solid support (substitution 0.54mm/g). The Fmoc/t-butyl synthetic method was employed using 4-(hydroxymethyi) phenoxyacetic acid as the linker. After the final deprotection step, protecting groups and peptide resin bond were cleaved with 90% TFA, 5% anisole, 3% thioanisole, 2% ethanedithiol.
- CZE Capillary Zone Electrophoresis.
- CZE was performed on a Beckman P/ ACE System 2100 interfaced with an IBM computer.
- Sample was voltage separated (15IcV) in 10OmM sodium borate using a 50cm capillary over 20min.
- Eluant was monitored at 214nm,
- Circular Dichroism and mass spectrometry Measurements were performed on a JASCO J-500 spectropolarimeter interfaced with an IBM computer. The instrument was calibrated in 0.06% (w/v) solution of ammonium-d-10-camphorsulfonate. The CD spectra of the peptides (62.5- 25OuM by dilution of peptide stocks in water) were measured at ambient temperature in a 0.1cm path length cylindrical quartz cuvette (Hellma).
- FAB Fast atom bombardment
- Antibody was allowed to precipitate by slowly adding SAS to 35% v/v under stirring in cold room. Samples were centrifuged 14,000 xg 20min and the supemate stored at -2O 0 C. The pellet was dissolved with 0.1M PBS in 1 A original volume. Fractions were then placed in Slide-a-lyzer cassettes (Pierce) and dialyzed against frequent changes of >200 volumes pH 8, 0.15M NaCl. The saline was brought to pH 8 with a few drops of 0.1M NaOH. IgG concentration was determined by radial immunodiffusion (RID) (The Binding Site, UK ). Monoclonal antibodies were purchased from Oncogene Science.
- RID radial immunodiffusion
- SKBR3 is a breast tumor cell line which overexpresses the HER-2 protein while MCF-7 expresses the normal concentration of protein. Immunoprecipitation and Western Blotting. On day zero, 1.0 X 10 7 SKBR3 cells were plated in 75cm 3 cell culture flasks and allowed to adhere overnight. Anti-peptide antibodies were added (100 ⁇ g/ml) for 4 lirs. The reaction was stopped by aspirating the media and immediately adding ice cold 0.1M phosphate buffered saline (PBS). Cells were trypsinized and washed twice with cold Hank's Balanced Salts Solution (HBSS).
- PBS ice cold 0.1M phosphate buffered saline
- Cold lysis buffer (15OmM NaCl; 50 mM Tris, pH 8; 1OmM EDTA, 1OmM sodium pyrophosphate, 1OmM sodium fluoride; 1% NP-40, 0.1% SDS) containing 3mM Na 3 VO 4 , lO ⁇ g/ml each aprotinin and leupeptin was added to cells resuspended in lOO ⁇ l HBSS. Lysis was achieved by gentle rotation at 4°C for 20min. After centrifugation (14,000xg, 20min) to remove cell debris, lysates were incubated with 3-5 ⁇ g antibody and 30 ⁇ l Protein A/Protein G (Oncogene Science) overnight. Beads were pelleted by centrifugation (14,000xg 30sec),washed twice in lysis buffer containing ImM Na 3 VO 4 and boiled in SDS sample buffer 5 min.
- Proteins were resolved by 7.5% SDS-PAGE, transferred to nitrocellulose and probed with antibody. Protein transfer was monitored with prestained molecular mass standards (BioRad). Immunoreactive bands were detected using horse radish peroxidase conjugated goat anti rabbit immunoglobins by enhanced chemiluminescence (Amersham).
- SKBR3 cells or MCF-7 cells were plated at 5,000 cells/well in V-bottom plates (Linbro, McLean VA). The cells were incubated with various concentrations of antibodies. After being washed with Hank's Balanced Salts Solution (HBSS) the cells were incubated for one hour with fluorescein isothiocyanate (FITC)- conjugated goat anti-rabbit or goat anti-mouse antibody and fixed with formalin. A mouse monoclonal Ab (Oncogene Science, Cambridge, MA) was used as the positive control and an anti-CD3 Ab as the negative control.
- FITC fluorescein isothiocyanate
- the cells were analyzed by a Coulter ELITE flow cytometer (Coulter, Hialeah, FL), which has an argon laser for excitation at 488mn, and a 525run band pass filter for FITC fluorescence 5.0 x 10 3 cells were counted for each sample and final processing was performed. Debris, cell clusters and dead cells were gated out by light scatted assessment before single parameter histograms were drawn.
- Coulter ELITE flow cytometer Coulter, Hialeah, FL
- SKBR3, MCF7 and CAVI cells were plated 5,000 cells/well in V-bottom plates along with various concentrations of Ab on day zero. On day 3, cells were pulsed with [3H] thymidine (1 ⁇ Ci/well) at which time they were placed in a 2O 0 C freezer for Ih. After thawing at room temperature cells were harvested an a PHD cell harvester (Cambridge Tech, Inc.). Samples were incubated in 5ml Ready Safe liquid scintillation cocktail (Beckman) and radioactivity determined by beta counter. Results are expressed as the mean CPM +/- the standard deviation (SD).
- SD standard deviation
- CTL Assay In vitro stimulation. Inguinal and periaortic lymph nodes (LN) are removed 7-10 days after immunization. LN cells (4 x 10 6 - 5x 10 6 ) are then stimulated in vitro by coculturing with 1.5 x 10 5 irradiated (10 000 rad) P815 cells prepulsed for Ih with l ⁇ M of the appropriate CTL peptide.
- the culture medium used is cDMEM (DMEM supplemented with 10% FCS). Supernatant containing 30 U/ml (final) of IL-2, 2mM L- glutamine, 1OmM Hepes and 5 x 10 5 M-2-mercaptoethanol).
- the CTL activity is tested in a standard chromium-release assay.
- P815 cells (10 6 ) are labeled with 150 ⁇ Ci sodium [ 51 Cr] chromate for Ih at 37 0 C in the presence or absence of the appropriate peptide (l ⁇ M) and washed three times.
- Labeled targets (2 x 10 3 ) are co-incubated with stimulated LN cells at predetermined ratios in 200 ⁇ l volumes in V-bottom 96 well plates. After a 4h incubation at 37°C, the supernatants (lOO ⁇ l) are harvested for ⁇ -counting.
- the % specific lysis is calculated as 100 x [(experimental-spontaneous release)/(total-spontaneous release)] (Valmori, et al. 1994).
- HER2 cells (3 x 10 ) were suspended in 250ul PBS, mixed with 250 ⁇ l MATRIGEL (Beckton Dickinson) on ice and injected subcutaneously into mice. Polyclonal antibodies to a total concentration of 2mg/mouse, were injected i.p. on days 9 and 11. Tumor volume was measured twice weekly with calipers and calculated by the formula (length x width x height).
- Example 1 A Conformational HER-2 B-CeIl Epitope Incorporating of Two Native Disulfide Bonds Show Enhanced Tumor Cell Binding.
- the human EGFR disulfide pairings have been defined. Based on the high homology between EGFR and HER-2, the 628-647 epitope to 626-649 to incorporate two disulfide bonds between Cys-626 and Cys-634, and Cys-630 and Cys-642. Differential side chain protection and a specialized deprotection and oxidation successfully generated the cyclized product with a desired secondary structural characteristics as determined by CD measurements. Both linear and cyclized constructs were highly immunogenic (titers >200,000) in outbred mice. Flow cytometry analysis showed that the antibodies against the cyclized epitope bound the HER-2 protein with a higher affinity than the non-cyclized epitope (mean log fluorescence 2.29 and 1.65 respectively).
- Antibodies against both the cyclized and non-cyclized epitopes were able to cause a reduction of growth in cells overexpressing HER-2 as measured in an anchorage-independent growth assay (31 and 58% inhibition, respectively).
- Antibodies against both constructs were able to elicit IFN- ⁇ release in the presence of effector human PBMCs, with the cyclized antibodies inducing 25% higher levels of IFN- ⁇ compared to the linear antibodies.
- Cyclized antibodies elicited twice the level of specific lysis compared to non-cyclized antibodies in an ADCC assay (11 and 5.6% respectively).
- mice were immunogenic in these mice with the cyclized construct generating higher titers. These mice were then challenged with the NT2.5 tumor cell line which has an FVB/N background. The mice immunized with the cyclized conformational construct had a reduction in tumor volume compared to both the linear and control MVF immunized mice. Cyclized vaccinated mice had the longest doubling time (6.63 days), thereby demonstrating the greatest ability to impede tumor growth compared to linear or MVF control peptide (4.31 and 4.48 days, respectively). Thus, these results show that conformational peptides for eliciting high affinity Abs has immediate application for the design of effective Her-2 vaccines.
- AU four constructs contain as least one region of the three regions that make contact with trastuzumab.
- HER-2 B epitopes were synthesized co-linearly with the MVF promiscuous Th epitope.
- Peptide synthesis was performed using Fmoc/t-But chemistry.
- the formation of three disulfide bonds for epitope 563-598 was achieved using differentially protected cysteine residues shown in Figure 2.
- the first disulfide bond is formed using iodine oxidation.
- the addition of water boosts Acm removal and the concomitant formation of a disulfide bond between C567 and C584.
- the final disulfide bond between C563 and C576 was formed using the silyl chloride-sulfoxide method.
- Table 1 shows candidate peptide vaccines from the HER-2/Herceptin structure.
- the promiscuous T-helper epitope sequence shown in italics, is linked to the B-cell epitope via a four residue turn sequence (GPSL).
- Underlined amino acids were mutated from Cys to Leu so as not to interfere with natural disulfide formation.
- Example 4 Cross reactivity of Herceptin binding peptides with Herceptin (trastuzumab) Whether the conformational peptides from trastuzumab binding sites could recognize herceptin by ELISA was tested. As shown in Fig. 4, various peptides in the binding region of 563-626 bound trastuzumab. Maximum binding occurred with cyclized epitope 563-598 which possesses the 3 disulfide pairings. This result is in contrast with the FACS binding of antibodies to HER-2 due to glycosylation.
- FIG. 5 C, D shows that both the 597-626 and the 613-626 construct are shifted relative to normal mouse antibodies. However the 563-598 and the 585-598 constructs showed little shift compared to normal mouse antibodies (Fig. 5 A, B). The 563-598 contains two of the three contacts that HER-2 makes with trastuzumab. The 597-626 epitope, which contains the last contact point with trastuzumab consist of 11 amino acids that recognize the native protein (Fig. 5C).
- both FVB/n and neu-N transgenic mice were challenged with the tumor cell line NT2.5 derived from a spontaneous mammary tumor isolated from a ne ⁇ -N transgenic mouse.
- NT2.5 tumor cell line
- these mice develop spontaneous mammary adenocarcinomas in a manner similar to that observed in human breast cancer patients, and are therefore a suitable model for human breast cancer studies.
- Groups of FVB/n mice were challenged with 5> ⁇ 10 6 NT2.5 cells s.c. (lower abdomen) two weeks after final immunization. Tumor measurements were taken twice weekly until day 55. Tumor volumes were calculated by the formula (long measurement x short measurement 2 )/2.
- mice immunized with the 563-598 NC and SS constructs had mean tumor volumes at day 30 of 166,517 and 173.7292 mm 3 respectively while unimmunized mice had a mean tumor volume of 346.6563 mm 3 (data not shown).
- mice immunized with the 613-626 and 585-598CYC showed a reduction in tumor volume compared to both unimmunized and MVF immunized mice. While there appears to be some moderate success in terms of reduction in tumor burden of mice immunized with the trastuzumab B-cell epitopes, nearly all mice developed tumors.
- the 3 peptide sequence listed in the Table 2 were designed to further delineate the minimal sequence to elicit an antibody similar to the pertuzumab binding site.
- These complex conformational peptide epitopes have been synthesized, successfully purified, and cyclized with the correct disulfide pairings.
- Epitope 266-296 SH bond between Cys268-Cys295, Epitope 298-333 (SH bond between Cys 299-Cys311, and Epitope 315-333 (SH bond Cys 315-Cys 331) should allow us to delineate the minimal pertuzumab binding epitope.
- Table 2 shows engineered HER-2 B chimeric peptides.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Oncology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Marine Sciences & Fisheries (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES06785065.1T ES2531483T3 (es) | 2005-06-15 | 2006-06-15 | Péptidos HER-2 |
| JP2008517193A JP5222134B2 (ja) | 2005-06-15 | 2006-06-15 | Her−2ペプチド |
| EP06785065.1A EP1912680B1 (en) | 2005-06-15 | 2006-06-15 | Her-2 peptides |
| CA2612394A CA2612394C (en) | 2005-06-15 | 2006-06-15 | Her-2 peptides |
| AU2006261342A AU2006261342B2 (en) | 2005-06-15 | 2006-06-15 | Her-2 peptides |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US69057405P | 2005-06-15 | 2005-06-15 | |
| US60/690,574 | 2005-06-15 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2006138675A2 true WO2006138675A2 (en) | 2006-12-28 |
| WO2006138675A9 WO2006138675A9 (en) | 2010-01-28 |
Family
ID=37571268
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2006/023672 Ceased WO2006138675A2 (en) | 2005-06-15 | 2006-06-15 | Her-2 peptides |
Country Status (7)
| Country | Link |
|---|---|
| US (3) | US7691396B2 (https=) |
| EP (1) | EP1912680B1 (https=) |
| JP (2) | JP5222134B2 (https=) |
| AU (1) | AU2006261342B2 (https=) |
| CA (1) | CA2612394C (https=) |
| ES (1) | ES2531483T3 (https=) |
| WO (1) | WO2006138675A2 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008097229A1 (en) * | 2007-02-09 | 2008-08-14 | The Government Of The Usa As Represented By The Secretary Of The Dept. Of Health And Human Services | Method for spectroscopic quantitation of her-2 in biological samples |
| US8470333B2 (en) | 2005-06-15 | 2013-06-25 | The Ohio State University Research Foundation | Chimeric peptides comprising HER-2 B-cell epitopes and T-helper epitopes |
| EP2628750A3 (en) * | 2006-09-08 | 2013-12-11 | The Henry M. Jackson Foundation for the Advancement of Military Medicine, Inc. | Targeted identification of immunogenic peptides |
| US9504738B2 (en) | 2009-02-04 | 2016-11-29 | Ohio State Innovation Foundation | Immunogenic epitopes, peptidomimetics, and anti-peptide antibodies, and methods of their use |
| US9884098B2 (en) | 2012-04-16 | 2018-02-06 | The Cleveland Clinic Foundation | Multivalent breast cancer vaccine |
| US10463724B2 (en) | 2010-06-10 | 2019-11-05 | The Cleveland Clinic Foundation | Breast cancer vaccine |
| WO2020191434A1 (en) * | 2019-03-22 | 2020-10-01 | Olivia Newton-John Cancer Research Institute | Anti-her2 binding molecules |
Families Citing this family (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1246597B1 (en) * | 1999-08-03 | 2015-01-14 | The Ohio State University | Polypeptides and polynucleotides for enhancing immune reactivity to her-2 protein |
| US20110044882A1 (en) * | 2008-04-22 | 2011-02-24 | David Buckley | Method of making high purity lithium hydroxide and hydrochloric acid |
| RU2607033C2 (ru) * | 2010-09-28 | 2017-01-10 | Ноно Инк. | Пептиды nd2 и способы лечения неврологического заболевания |
| US10221230B2 (en) | 2013-02-25 | 2019-03-05 | Ohio State Innovation Foundation | HER-1, HER-3 and IGF-1R compositions and uses thereof |
| CN105017425B (zh) * | 2014-04-30 | 2018-02-16 | 京天成生物技术(北京)有限公司 | 抗her2中和活性单克隆抗体及其应用 |
| US20180327453A1 (en) * | 2015-11-06 | 2018-11-15 | Evorx Technologies, Inc. | Her-2-specific cyclized supr peptides |
| WO2018145020A1 (en) | 2017-02-03 | 2018-08-09 | The Medical College Of Wisconsin, Inc. | Kras peptide vaccine compositions and method of use |
| ES2963635T3 (es) * | 2017-03-28 | 2024-04-01 | Ohio State Innovation Foundation | Vacunas de péptido PD1 humano y usos de las mismas |
| US20200179500A1 (en) | 2018-12-05 | 2020-06-11 | Wayne State University | Methods and immunogenic compositions relating to her2 with selective sequence modifications |
| BR112022005044A2 (pt) * | 2019-09-17 | 2022-07-05 | Ohio State Innovation Foundation | Peptídeo quimérico, peptídeo sintético, composição farmacêutica, anticorpo, método de tratamento |
| EP4486389A1 (en) | 2022-02-28 | 2025-01-08 | Tridem Bioscience GmbH & Co KG | A conjugate comprising at least a beta-glucan |
| CN119019569B (zh) * | 2024-08-19 | 2025-10-24 | 中国人民解放军陆军军医大学 | 一种可定向增强胸腺新生t细胞杀伤乳腺癌的多肽及其应用 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001008636A2 (en) | 1999-08-03 | 2001-02-08 | The Ohio State University | Polypeptides and polynucleotides for enhancing immune reactivity to her-2 protein |
Family Cites Families (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP3040121B2 (ja) | 1988-01-12 | 2000-05-08 | ジェネンテク,インコーポレイテッド | 増殖因子レセプターの機能を阻害することにより腫瘍細胞を処置する方法 |
| DE69031120T2 (de) | 1989-05-19 | 1998-01-15 | Genentech, Inc., South San Francisco, Calif. | Her2 extrazellulare domäne |
| WO1991011719A1 (en) | 1990-01-26 | 1991-08-08 | Washington Research Foundation | Immune reactivity to expressed activated oncogenes for diagnosis and treatment of malignancy |
| IL101943A0 (en) | 1991-05-24 | 1992-12-30 | Genentech Inc | Structure,production and use of heregulin |
| CA2138997C (en) | 1992-06-25 | 2003-06-03 | Jean-Paul Prieels | Vaccine composition containing adjuvants |
| DE69333588T2 (de) | 1992-09-28 | 2005-08-04 | Wyeth Holdings Corp. | Verfahren zur verstärkung zellularer immunantworten |
| AU679902B2 (en) | 1992-09-30 | 1997-07-17 | Ohio State University Research Foundation, The | Vaccines and antigenic conjugates |
| US5801005A (en) | 1993-03-17 | 1998-09-01 | University Of Washington | Immune reactivity to HER-2/neu protein for diagnosis of malignancies in which the HER-2/neu oncogene is associated |
| US5869445A (en) | 1993-03-17 | 1999-02-09 | University Of Washington | Methods for eliciting or enhancing reactivity to HER-2/neu protein |
| GB9326253D0 (en) | 1993-12-23 | 1994-02-23 | Smithkline Beecham Biolog | Vaccines |
| EP1167379A3 (en) | 1994-07-15 | 2004-09-08 | University Of Iowa Research Foundation | Immunomodulatory oligonucleotides |
| UA56132C2 (uk) | 1995-04-25 | 2003-05-15 | Смітклайн Бічем Байолоджікалс С.А. | Композиція вакцини (варіанти), спосіб стабілізації qs21 відносно гідролізу (варіанти), спосіб приготування композиції вакцини |
| US6410022B1 (en) | 1995-05-01 | 2002-06-25 | Avant Immunotherapeutics, Inc. | Modulation of cholesteryl ester transfer protein (CETP) activity |
| WO1997038011A1 (en) | 1996-04-03 | 1997-10-16 | Pepresearch A/S | Non-dendritic backbone peptide carrier |
| KR20060079258A (ko) | 1996-10-18 | 2006-07-05 | 제넨테크, 인크. | 항-ErbB2 항체 |
| CN1181422A (zh) | 1996-10-31 | 1998-05-13 | 上海市肿瘤研究所 | 与生长因子受体结合的多肽所构建的基因转移载体 |
| JP2001513369A (ja) | 1997-08-11 | 2001-09-04 | アラーガン・セイルズ・インコーポレイテッド | 改善された生物適合性を有する無菌の生物侵食性の移植デバイスおよび方法 |
| ZA9811162B (en) | 1997-12-12 | 2000-06-07 | Genentech Inc | Treatment with anti-ERBB2 antibodies. |
| EP0953823A2 (en) | 1998-05-01 | 1999-11-03 | Aisin Cosmos R & D Co. Ltd. | Micro yaw rate sensors |
| WO2000034337A1 (en) | 1998-12-10 | 2000-06-15 | Tsukuba Research Laboratory, Toagosei Co., Ltd. | Humanized monoclonal antibodies against vascular endothelial cell growth factor |
| DE60040981D1 (de) | 1999-05-14 | 2009-01-15 | Genentech Inc | BEHANDLUNG MIT ANTI-ErbB2 ANTIKÖRPERN |
| US6432409B1 (en) | 1999-09-14 | 2002-08-13 | Antigen Express, Inc. | Hybrid peptides modulate the immune response |
| US20030235594A1 (en) * | 1999-09-14 | 2003-12-25 | Antigen Express, Inc. | Ii-Key/antigenic epitope hybrid peptide vaccines |
| EP1366153A2 (en) * | 2000-08-14 | 2003-12-03 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of her-2/neu-associated malignancies |
| GB0213878D0 (en) | 2002-06-17 | 2002-07-31 | Protherics Plc | Use |
| CA2499123A1 (en) * | 2002-09-17 | 2004-04-15 | Antigen Express, Inc. | Ii-key/antigenic epitope hybrid peptide vaccines |
| EP2287315A1 (en) * | 2003-03-04 | 2011-02-23 | Intercell AG | Streptococcus pyogenes antigens |
| DE602004026445D1 (de) * | 2003-06-25 | 2010-05-20 | Ottawa Health Research Inst | Verwendung von cardiotrophin zur modulation der stammzellenproliferation |
| US7473682B2 (en) * | 2003-10-29 | 2009-01-06 | Ramot At Tel Aviv University Ltd. | Angiogenic peptides and uses thereof |
| CA2555274A1 (en) | 2004-02-05 | 2005-08-25 | The Ohio State University Research Foundation | Chimeric vegf peptides |
| SE0402565L (sv) | 2004-10-19 | 2005-12-20 | Mia Kumm | Anordning och system för ventilation av tunnel vid brand |
| CN101087878A (zh) | 2004-12-20 | 2007-12-12 | 味之素株式会社 | 具有肽合成活性的突变型蛋白质 |
| AU2006261342B2 (en) | 2005-06-15 | 2012-02-02 | The Ohio State University Research Foundation | Her-2 peptides |
| US20100234283A1 (en) | 2009-02-04 | 2010-09-16 | The Ohio State University Research Foundation | Immunogenic epitopes, peptidomimetics, and anti-peptide antibodies, and methods of their use |
| JP5510272B2 (ja) | 2010-06-21 | 2014-06-04 | 株式会社リコー | 画像形成装置 |
-
2006
- 2006-06-15 AU AU2006261342A patent/AU2006261342B2/en not_active Ceased
- 2006-06-15 JP JP2008517193A patent/JP5222134B2/ja not_active Expired - Fee Related
- 2006-06-15 US US11/424,526 patent/US7691396B2/en active Active
- 2006-06-15 ES ES06785065.1T patent/ES2531483T3/es active Active
- 2006-06-15 CA CA2612394A patent/CA2612394C/en active Active
- 2006-06-15 WO PCT/US2006/023672 patent/WO2006138675A2/en not_active Ceased
- 2006-06-15 EP EP06785065.1A patent/EP1912680B1/en not_active Not-in-force
-
2010
- 2010-02-01 US US12/697,578 patent/US8470333B2/en active Active
-
2012
- 2012-04-17 JP JP2012093680A patent/JP5542865B2/ja not_active Expired - Fee Related
-
2013
- 2013-05-30 US US13/905,996 patent/US9452204B2/en active Active
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001008636A2 (en) | 1999-08-03 | 2001-02-08 | The Ohio State University | Polypeptides and polynucleotides for enhancing immune reactivity to her-2 protein |
Non-Patent Citations (2)
| Title |
|---|
| BERGER; KIMMEL: "Methods in Enzymology", vol. 152, 1987, ACADEMIC PRESS, article "Guide to Molecular Cloning Techniques" |
| See also references of EP1912680A4 |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8470333B2 (en) | 2005-06-15 | 2013-06-25 | The Ohio State University Research Foundation | Chimeric peptides comprising HER-2 B-cell epitopes and T-helper epitopes |
| US9452204B2 (en) | 2005-06-15 | 2016-09-27 | Ohio State Innovation Foundation | Chimeric peptides comprising HER-2 B-cell epitopes and Tcell helper epitopes |
| EP2628750A3 (en) * | 2006-09-08 | 2013-12-11 | The Henry M. Jackson Foundation for the Advancement of Military Medicine, Inc. | Targeted identification of immunogenic peptides |
| WO2008097229A1 (en) * | 2007-02-09 | 2008-08-14 | The Government Of The Usa As Represented By The Secretary Of The Dept. Of Health And Human Services | Method for spectroscopic quantitation of her-2 in biological samples |
| US9504738B2 (en) | 2009-02-04 | 2016-11-29 | Ohio State Innovation Foundation | Immunogenic epitopes, peptidomimetics, and anti-peptide antibodies, and methods of their use |
| US10463724B2 (en) | 2010-06-10 | 2019-11-05 | The Cleveland Clinic Foundation | Breast cancer vaccine |
| US11547749B2 (en) | 2010-06-10 | 2023-01-10 | The Cleveland Clinic Foundation | Breast cancer vaccine |
| US12370244B2 (en) | 2010-06-10 | 2025-07-29 | The Cleveland Clinic Foundation | Breast cancer vaccine |
| US9884098B2 (en) | 2012-04-16 | 2018-02-06 | The Cleveland Clinic Foundation | Multivalent breast cancer vaccine |
| WO2020191434A1 (en) * | 2019-03-22 | 2020-10-01 | Olivia Newton-John Cancer Research Institute | Anti-her2 binding molecules |
| EP3941947A4 (en) * | 2019-03-22 | 2022-12-14 | Olivia Newton-John Cancer Research Institute | ANTI-HER2 BINDING MOLECULES |
| US12534538B2 (en) | 2019-03-22 | 2026-01-27 | Certis Therapeutics Pty Ltd | Anti-HER2 binding molecules |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2006261342A1 (en) | 2006-12-28 |
| US20070060516A1 (en) | 2007-03-15 |
| JP5222134B2 (ja) | 2013-06-26 |
| JP5542865B2 (ja) | 2014-07-09 |
| US7691396B2 (en) | 2010-04-06 |
| US20110086055A1 (en) | 2011-04-14 |
| WO2006138675A9 (en) | 2010-01-28 |
| JP2012136555A (ja) | 2012-07-19 |
| CA2612394A1 (en) | 2006-12-28 |
| EP1912680A4 (en) | 2010-09-22 |
| EP1912680B1 (en) | 2014-11-26 |
| JP2009500298A (ja) | 2009-01-08 |
| US20140010831A1 (en) | 2014-01-09 |
| EP1912680A2 (en) | 2008-04-23 |
| US9452204B2 (en) | 2016-09-27 |
| CA2612394C (en) | 2017-02-21 |
| ES2531483T3 (es) | 2015-03-16 |
| US8470333B2 (en) | 2013-06-25 |
| AU2006261342B2 (en) | 2012-02-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8470333B2 (en) | Chimeric peptides comprising HER-2 B-cell epitopes and T-helper epitopes | |
| EP1246597B1 (en) | Polypeptides and polynucleotides for enhancing immune reactivity to her-2 protein | |
| CN101113163B (zh) | Hla-a24限制性癌抗原肽 | |
| US20130230546A1 (en) | Chimeric VEGF Peptides | |
| WO2014131019A2 (en) | Her-1, her-3 and igf-1r compositions and uses thereof | |
| AU2016250289B2 (en) | A vaccine composition and uses thereof | |
| EP1121435A1 (en) | Camel, an alternative translation product of the tumour antigen lage-1 | |
| JP2002517240A (ja) | TGFβRIIレセプターの核酸配列、コードされたペプチドおよび使用 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| ENP | Entry into the national phase |
Ref document number: 2008517193 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2612394 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006261342 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 564951 Country of ref document: NZ Ref document number: 2006785065 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2006261342 Country of ref document: AU Date of ref document: 20060615 Kind code of ref document: A |