US7812121B2 - GLP-2 mimetibodies, polypeptides, compositions, methods and uses - Google Patents
GLP-2 mimetibodies, polypeptides, compositions, methods and uses Download PDFInfo
- Publication number
- US7812121B2 US7812121B2 US11/848,635 US84863507A US7812121B2 US 7812121 B2 US7812121 B2 US 7812121B2 US 84863507 A US84863507 A US 84863507A US 7812121 B2 US7812121 B2 US 7812121B2
- Authority
- US
- United States
- Prior art keywords
- glp
- mimetibody
- seq
- mimetibodies
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related, expires
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 82
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 62
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 55
- 101800000221 Glucagon-like peptide 2 Proteins 0.000 title abstract description 178
- TWSALRJGPBVBQU-PKQQPRCHSA-N glucagon-like peptide 2 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 TWSALRJGPBVBQU-PKQQPRCHSA-N 0.000 title abstract description 153
- 238000000034 method Methods 0.000 title abstract description 28
- 102400000326 Glucagon-like peptide 2 Human genes 0.000 title abstract 3
- 239000000203 mixture Substances 0.000 title description 15
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 24
- 108060003951 Immunoglobulin Proteins 0.000 claims description 10
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 claims description 10
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 claims description 10
- 102000018358 immunoglobulin Human genes 0.000 claims description 10
- 239000000556 agonist Substances 0.000 claims description 8
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 claims description 6
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 claims description 6
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- 239000000126 substance Substances 0.000 claims description 6
- 101001015549 Homo sapiens Glucagon-like peptide 2 receptor Proteins 0.000 claims description 5
- 239000003085 diluting agent Substances 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 22
- 150000007523 nucleic acids Chemical class 0.000 abstract description 16
- 108020004707 nucleic acids Proteins 0.000 abstract description 12
- 102000039446 nucleic acids Human genes 0.000 abstract description 12
- 201000010099 disease Diseases 0.000 abstract description 11
- 102100040918 Pro-glucagon Human genes 0.000 description 169
- 210000004027 cell Anatomy 0.000 description 45
- 241000699670 Mus sp. Species 0.000 description 36
- 230000000694 effects Effects 0.000 description 26
- 208000008384 ileus Diseases 0.000 description 26
- 230000002496 gastric effect Effects 0.000 description 25
- 108010024044 Glucagon-Like Peptide-2 Receptor Proteins 0.000 description 21
- 102000015626 Glucagon-Like Peptide-2 Receptor Human genes 0.000 description 21
- 102220316816 rs777965976 Human genes 0.000 description 21
- 230000002757 inflammatory effect Effects 0.000 description 18
- 238000011282 treatment Methods 0.000 description 18
- 238000012360 testing method Methods 0.000 description 17
- 230000027455 binding Effects 0.000 description 16
- 210000000813 small intestine Anatomy 0.000 description 16
- 210000001035 gastrointestinal tract Anatomy 0.000 description 14
- 230000014509 gene expression Effects 0.000 description 14
- 230000000968 intestinal effect Effects 0.000 description 14
- 239000000178 monomer Substances 0.000 description 13
- 239000002953 phosphate buffered saline Substances 0.000 description 13
- 208000035475 disorder Diseases 0.000 description 11
- 108090000623 proteins and genes Proteins 0.000 description 11
- 238000006467 substitution reaction Methods 0.000 description 11
- 238000001356 surgical procedure Methods 0.000 description 11
- 235000001014 amino acid Nutrition 0.000 description 10
- 208000014674 injury Diseases 0.000 description 10
- 206010049416 Short-bowel syndrome Diseases 0.000 description 9
- RHQDFWAXVIIEBN-UHFFFAOYSA-N Trifluoroethanol Chemical compound OCC(F)(F)F RHQDFWAXVIIEBN-UHFFFAOYSA-N 0.000 description 9
- 150000001413 amino acids Chemical class 0.000 description 9
- 230000035772 mutation Effects 0.000 description 9
- 230000002980 postoperative effect Effects 0.000 description 9
- 235000018102 proteins Nutrition 0.000 description 9
- 102000004169 proteins and genes Human genes 0.000 description 9
- 208000024891 symptom Diseases 0.000 description 9
- 239000013598 vector Substances 0.000 description 9
- 206010061218 Inflammation Diseases 0.000 description 8
- 241001465754 Metazoa Species 0.000 description 8
- 102000003896 Myeloperoxidases Human genes 0.000 description 8
- 108090000235 Myeloperoxidases Proteins 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 230000004054 inflammatory process Effects 0.000 description 8
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 241001529936 Murinae Species 0.000 description 7
- 208000027418 Wounds and injury Diseases 0.000 description 7
- 230000006378 damage Effects 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 210000000265 leukocyte Anatomy 0.000 description 7
- 235000012054 meals Nutrition 0.000 description 7
- 230000004899 motility Effects 0.000 description 7
- 108091033319 polynucleotide Proteins 0.000 description 7
- 102000040430 polynucleotide Human genes 0.000 description 7
- 239000002157 polynucleotide Substances 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- 229920002307 Dextran Polymers 0.000 description 6
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 description 6
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Natural products NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 6
- 238000012084 abdominal surgery Methods 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 6
- 210000001072 colon Anatomy 0.000 description 6
- 230000000875 corresponding effect Effects 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 208000011231 Crohn disease Diseases 0.000 description 5
- 102000009109 Fc receptors Human genes 0.000 description 5
- 108010087819 Fc receptors Proteins 0.000 description 5
- 235000012730 carminic acid Nutrition 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 238000001142 circular dichroism spectrum Methods 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 239000000539 dimer Substances 0.000 description 5
- 210000000981 epithelium Anatomy 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 4
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 4
- 230000001133 acceleration Effects 0.000 description 4
- 230000003213 activating effect Effects 0.000 description 4
- 229960004516 alvimopan Drugs 0.000 description 4
- UPNUIXSCZBYVBB-JVFUWBCBSA-N alvimopan Chemical compound C([C@@H](CN1C[C@@H]([C@](CC1)(C)C=1C=C(O)C=CC=1)C)C(=O)NCC(O)=O)C1=CC=CC=C1 UPNUIXSCZBYVBB-JVFUWBCBSA-N 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 235000018417 cysteine Nutrition 0.000 description 4
- 230000002354 daily effect Effects 0.000 description 4
- 238000009826 distribution Methods 0.000 description 4
- 230000006334 disulfide bridging Effects 0.000 description 4
- 230000004064 dysfunction Effects 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 210000002540 macrophage Anatomy 0.000 description 4
- 229940005483 opioid analgesics Drugs 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 210000002784 stomach Anatomy 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101500028771 Homo sapiens Glucagon-like peptide 2 Proteins 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 206010028116 Mucosal inflammation Diseases 0.000 description 3
- 201000010927 Mucositis Diseases 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- 206010033645 Pancreatitis Diseases 0.000 description 3
- 206010040047 Sepsis Diseases 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 210000004534 cecum Anatomy 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000006471 dimerization reaction Methods 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 210000003158 enteroendocrine cell Anatomy 0.000 description 3
- 230000028709 inflammatory response Effects 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 230000003871 intestinal function Effects 0.000 description 3
- 210000001630 jejunum Anatomy 0.000 description 3
- 210000003041 ligament Anatomy 0.000 description 3
- 238000004020 luminiscence type Methods 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 210000002569 neuron Anatomy 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 235000015816 nutrient absorption Nutrition 0.000 description 3
- 239000000014 opioid analgesic Substances 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 230000002035 prolonged effect Effects 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 238000007790 scraping Methods 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 108010073046 teduglutide Proteins 0.000 description 3
- CILIXQOJUNDIDU-ASQIGDHWSA-N teduglutide Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 CILIXQOJUNDIDU-ASQIGDHWSA-N 0.000 description 3
- 229960002444 teduglutide Drugs 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 230000008736 traumatic injury Effects 0.000 description 3
- 206010000060 Abdominal distension Diseases 0.000 description 2
- 238000010152 Bonferroni least significant difference Methods 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 102100037355 Chromosome alignment-maintaining phosphoprotein 1 Human genes 0.000 description 2
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 description 2
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 2
- 206010017076 Fracture Diseases 0.000 description 2
- 101000741320 Homo sapiens Cathelicidin antimicrobial peptide Proteins 0.000 description 2
- 101000880066 Homo sapiens Chromosome alignment-maintaining phosphoprotein 1 Proteins 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- -1 IL-1β Proteins 0.000 description 2
- 241000282567 Macaca fascicularis Species 0.000 description 2
- 206010051606 Necrotising colitis Diseases 0.000 description 2
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 230000004989 O-glycosylation Effects 0.000 description 2
- 206010054048 Postoperative ileus Diseases 0.000 description 2
- 102000035554 Proglucagon Human genes 0.000 description 2
- 108010058003 Proglucagon Proteins 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 102220500372 Toll-like receptor 8_M10V_mutation Human genes 0.000 description 2
- 210000001015 abdomen Anatomy 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 238000000540 analysis of variance Methods 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000024203 complement activation Effects 0.000 description 2
- YPHMISFOHDHNIV-FSZOTQKASA-N cycloheximide Chemical compound C1[C@@H](C)C[C@H](C)C(=O)[C@@H]1[C@H](O)CC1CC(=O)NC(=O)C1 YPHMISFOHDHNIV-FSZOTQKASA-N 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 210000001198 duodenum Anatomy 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 210000005216 enteric neuron Anatomy 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 230000003054 hormonal effect Effects 0.000 description 2
- 210000003405 ileum Anatomy 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 210000000936 intestine Anatomy 0.000 description 2
- 208000028867 ischemia Diseases 0.000 description 2
- 238000002350 laparotomy Methods 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- 229920000609 methyl cellulose Polymers 0.000 description 2
- 239000001923 methylcellulose Substances 0.000 description 2
- BQJCRHHNABKAKU-KBQPJGBKSA-N morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 2
- 210000004877 mucosa Anatomy 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 208000004995 necrotizing enterocolitis Diseases 0.000 description 2
- 230000002232 neuromuscular Effects 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 2
- 201000006195 perinatal necrotizing enterocolitis Diseases 0.000 description 2
- 230000003285 pharmacodynamic effect Effects 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000017854 proteolysis Effects 0.000 description 2
- 210000001187 pylorus Anatomy 0.000 description 2
- 102200072304 rs1057519530 Human genes 0.000 description 2
- 102200158370 rs868333 Human genes 0.000 description 2
- 102000014452 scavenger receptors Human genes 0.000 description 2
- 108010078070 scavenger receptors Proteins 0.000 description 2
- 238000001370 static light scattering Methods 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 230000001839 systemic circulation Effects 0.000 description 2
- 238000002054 transplantation Methods 0.000 description 2
- 238000012762 unpaired Student’s t-test Methods 0.000 description 2
- SFLSHLFXELFNJZ-QMMMGPOBSA-N (-)-norepinephrine Chemical compound NC[C@H](O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-QMMMGPOBSA-N 0.000 description 1
- 206010003011 Appendicitis Diseases 0.000 description 1
- 206010003694 Atrophy Diseases 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 238000012935 Averaging Methods 0.000 description 1
- 206010070545 Bacterial translocation Diseases 0.000 description 1
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 101100007328 Cocos nucifera COS-1 gene Proteins 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 206010010774 Constipation Diseases 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 208000037487 Endotoxemia Diseases 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 208000004262 Food Hypersensitivity Diseases 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 208000001762 Gastric Dilatation Diseases 0.000 description 1
- 208000006442 Gastroschisis Diseases 0.000 description 1
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 description 1
- 101001039966 Homo sapiens Pro-glucagon Proteins 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 206010021518 Impaired gastric emptying Diseases 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 208000037112 Intestinal Failure Diseases 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- 102000004195 Isomerases Human genes 0.000 description 1
- 108090000769 Isomerases Proteins 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 241000502522 Luscinia megarhynchos Species 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 206010025476 Malabsorption Diseases 0.000 description 1
- 208000004155 Malabsorption Syndromes Diseases 0.000 description 1
- 208000034486 Multi-organ failure Diseases 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 208000001132 Osteoporosis Diseases 0.000 description 1
- 208000012868 Overgrowth Diseases 0.000 description 1
- 102000008212 P-Selectin Human genes 0.000 description 1
- 108010035766 P-Selectin Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 206010033647 Pancreatitis acute Diseases 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 206010035669 Pneumonia aspiration Diseases 0.000 description 1
- 208000004550 Postoperative Pain Diseases 0.000 description 1
- FELJDCNGZFDUNR-WDSKDSINSA-N Pro-Ala Chemical group OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 FELJDCNGZFDUNR-WDSKDSINSA-N 0.000 description 1
- 102000006437 Proprotein Convertases Human genes 0.000 description 1
- 108010044159 Proprotein Convertases Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- YZCKVEUIGOORGS-IGMARMGPSA-N Protium Chemical compound [1H] YZCKVEUIGOORGS-IGMARMGPSA-N 0.000 description 1
- 206010038419 Renal colic Diseases 0.000 description 1
- 206010038687 Respiratory distress Diseases 0.000 description 1
- 206010058360 Retroperitoneal haematoma Diseases 0.000 description 1
- 208000027790 Rib fracture Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 206010047697 Volvulus Diseases 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- 210000000683 abdominal cavity Anatomy 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 201000003229 acute pancreatitis Diseases 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 230000003444 anaesthetic effect Effects 0.000 description 1
- 230000036592 analgesia Effects 0.000 description 1
- 230000000202 analgesic effect Effects 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 230000002421 anti-septic effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 201000009807 aspiration pneumonia Diseases 0.000 description 1
- 230000037444 atrophy Effects 0.000 description 1
- 230000007375 bacterial translocation Effects 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 230000008993 bowel inflammation Effects 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000003090 cAMP-screen direct system Methods 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 230000002612 cardiopulmonary effect Effects 0.000 description 1
- 239000004106 carminic acid Substances 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 229960000590 celecoxib Drugs 0.000 description 1
- RZEKVGVHFLEQIL-UHFFFAOYSA-N celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 230000003822 cell turnover Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 201000001352 cholecystitis Diseases 0.000 description 1
- DCSUBABJRXZOMT-IRLDBZIGSA-N cisapride Chemical compound C([C@@H]([C@@H](CC1)NC(=O)C=2C(=CC(N)=C(Cl)C=2)OC)OC)N1CCCOC1=CC=C(F)C=C1 DCSUBABJRXZOMT-IRLDBZIGSA-N 0.000 description 1
- 229960005132 cisapride Drugs 0.000 description 1
- DCSUBABJRXZOMT-UHFFFAOYSA-N cisapride Natural products C1CC(NC(=O)C=2C(=CC(N)=C(Cl)C=2)OC)C(OC)CN1CCCOC1=CC=C(F)C=C1 DCSUBABJRXZOMT-UHFFFAOYSA-N 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 229940080423 cochineal Drugs 0.000 description 1
- 206010009887 colitis Diseases 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 230000000112 colonic effect Effects 0.000 description 1
- 210000002777 columnar cell Anatomy 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 239000003636 conditioned culture medium Substances 0.000 description 1
- 230000037020 contractile activity Effects 0.000 description 1
- 230000008828 contractile function Effects 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 229940111134 coxibs Drugs 0.000 description 1
- 210000001100 crypt cell Anatomy 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 239000003255 cyclooxygenase 2 inhibitor Substances 0.000 description 1
- 108010004073 cysteinylcysteine Proteins 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 230000001120 cytoprotective effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 235000015872 dietary supplement Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 238000002224 dissection Methods 0.000 description 1
- 210000004921 distal colon Anatomy 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000003989 endothelium vascular Anatomy 0.000 description 1
- 210000000105 enteric nervous system Anatomy 0.000 description 1
- 210000001842 enterocyte Anatomy 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 210000001723 extracellular space Anatomy 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 235000020932 food allergy Nutrition 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 230000027119 gastric acid secretion Effects 0.000 description 1
- 230000030135 gastric motility Effects 0.000 description 1
- 230000005176 gastrointestinal motility Effects 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 238000009499 grossing Methods 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 150000002402 hexoses Chemical class 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 208000009326 ileitis Diseases 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000007358 intestinal barrier function Effects 0.000 description 1
- 230000008991 intestinal motility Effects 0.000 description 1
- 210000004347 intestinal mucosa Anatomy 0.000 description 1
- 230000003870 intestinal permeability Effects 0.000 description 1
- 210000002011 intestinal secretion Anatomy 0.000 description 1
- 201000007647 intestinal volvulus Diseases 0.000 description 1
- 230000001134 intestinotrophic effect Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000012004 kinetic exclusion assay Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 210000000111 lower esophageal sphincter Anatomy 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 229960005181 morphine Drugs 0.000 description 1
- 239000002756 mu opiate receptor agonist Substances 0.000 description 1
- 230000004682 mucosal barrier function Effects 0.000 description 1
- 208000029744 multiple organ dysfunction syndrome Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 210000000651 myofibroblast Anatomy 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 230000006654 negative regulation of apoptotic process Effects 0.000 description 1
- ALWKGYPQUAPLQC-UHFFFAOYSA-N neostigmine Chemical compound CN(C)C(=O)OC1=CC=CC([N+](C)(C)C)=C1 ALWKGYPQUAPLQC-UHFFFAOYSA-N 0.000 description 1
- 229960002362 neostigmine Drugs 0.000 description 1
- 230000001703 neuroimmune Effects 0.000 description 1
- 229960002748 norepinephrine Drugs 0.000 description 1
- SFLSHLFXELFNJZ-UHFFFAOYSA-N norepinephrine Natural products NCC(O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-UHFFFAOYSA-N 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000000399 orthopedic effect Effects 0.000 description 1
- 230000011164 ossification Effects 0.000 description 1
- 229940094443 oxytocics prostaglandins Drugs 0.000 description 1
- 230000036407 pain Effects 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 238000009520 phase I clinical trial Methods 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 108010017378 prolyl aminopeptidase Proteins 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000001141 propulsive effect Effects 0.000 description 1
- 150000003180 prostaglandins Chemical class 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000003642 reactive oxygen metabolite Substances 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000011514 reflex Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000011808 rodent model Methods 0.000 description 1
- 229960000371 rofecoxib Drugs 0.000 description 1
- RZJQGNCSTQAWON-UHFFFAOYSA-N rofecoxib Chemical compound C1=CC(S(=O)(=O)C)=CC=C1C1=C(C=2C=CC=CC=2)C(=O)OC1 RZJQGNCSTQAWON-UHFFFAOYSA-N 0.000 description 1
- 102200011087 rs36047130 Human genes 0.000 description 1
- 102220217525 rs794726912 Human genes 0.000 description 1
- 102220019866 rs80359034 Human genes 0.000 description 1
- 230000036186 satiety Effects 0.000 description 1
- 235000019627 satiety Nutrition 0.000 description 1
- 208000013223 septicemia Diseases 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000011343 solid material Substances 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000011301 standard therapy Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000003874 surgical anastomosis Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002889 sympathetic effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 229940124598 therapeutic candidate Drugs 0.000 description 1
- 210000000115 thoracic cavity Anatomy 0.000 description 1
- 235000021476 total parenteral nutrition Nutrition 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/04—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the present invention relates to mammalian GLP-2 polypeptides and mimetibodies, and their use as therapeutics.
- Glucagon-like peptide-2 (GLP-2) is a 33 amino acid intestinotrophic peptide hormone generated via post-translational processing of proglucagon (Orskov et al., FEBS Lett. 247: 193-196 (1989); Hartmann et al., Peptides 21: 73-80 (2000)). In mammals, GLP-2 is liberated from proglucagon in the intestine and brain but not in pancreas, as a result of cell-specific expression of prohormone convertases in gut endocrine cells (Dhanvantari et al., Mol. Endocrinol. 10: 342-355 (1996); Rothenberg et al., Mol. Endocrinol.
- GLP-2 1-33 is cleaved in vivo by the protease dipeptidyl peptidase IV (DPP IV), which removes the first two residues, histidine and alanine (HA).
- DPP IV protease dipeptidyl peptidase IV
- HA histidine and alanine
- GLP-2 regulates gastric motility, gastric acid secretion, intestinal hexose transport, and increases the barrier function of the gut epithelium (reviewed in Drucker, J. Clin. Endocr. Metab. 86: 1759-1764 (2001)). It significantly enhances the surface area of the mucosal epithelium via stimulation of crypt cell proliferation and inhibition of apoptosis in the enterocyte and crypt compartments. (Drucker et al., Proc. Natl. Acad. Sci. U.S.A. 93: 1911-7916 (1996)).
- GLP-2 reduces mortality and decreases mucosal injury, cytokine expression, and bacterial septicemia in small and large bowel inflammation (Boushey et al., Am. J. Physiol. 277: E937-E947 (1999); Prasad et al., J. Pediatr. Surg. 35: 357-359 (2000)). GLP-2 also enhances nutrient absorption and gut adaptation in rodents or humans with short bowel syndrome (SBS) (Jeppesen et al., Gastroenterology 120: 806-815 (2001)).
- SBS short bowel syndrome
- GLP-2R GLP-2 receptor
- enteric neurons and subendothelial myofibroblasts (Munroe et al., Proc. Natl. Acad. Sci U.S.A. 96: 1569-1573 (1999); Yusta et al., Gastroenterology 119: 744-755 (2000); Bjerknes et al., Proc. Natl. Acad. Sci. U.S.A. 98: 12497-12502 (2001); Orskov et al., Regul. Pept.
- GLP-2R GLP-2 receptor
- GLP-2 may potentially be useful for the treatment of human disorders characterized by injury and/or dysfunction of the intestinal mucosal epithelium.
- Intestinal epithelial injury is seen in patients with inflammatory bowel disease (IBD), including Crohn's Disease and ulcerative colitis, and in patients with autoimmune diseases that are associated with an inflammatory response in the intestine, such as Celiac's Disease (reviewed in Hanauer, New England J. Med. 334: 841-848 (1996)).
- IBD inflammatory bowel disease
- Celiac's Disease reviewed in Hanauer, New England J. Med. 334: 841-848 (1996).
- some chemotherapy drugs cause injury to the intestinal epithelium that result in toxic side effects that are dose limiting (Oster, Oncology 13: 41 (1999)).
- Increased intestinal permeability is also reported in cases of acute pancreatitis (Kouris et al., Am. J. Surg. 181: 571-575 (2001)) and could contribute to food allergies by allowing macromolecules to access the subendothelial compartment (Troncone et al., Allergy 49: 142-146 (1994)).
- SBS short bowel syndrome
- the causes of short bowel syndrome differ between adults and children: in adults, it most often results after surgery for Crohn's disease or mesenteric infarction; while in infants, the causes more commonly include necrotizing enterocolitis, gastroschisis, atresia, and volvulus (Platell et al., World J. Gastroenterol. 8: 13-20 (2002)).
- Teduglutide a DPP-IV resistant GLP-2 peptide analog (where alanine-2 is substituted with glycine (A2G)), is being developed for the potential treatment of gastrointestinal (GI) diseases, including SBS, Crohn's disease and pediatric GI disorders.
- GI gastrointestinal
- Teduglutide also has potential for the treatment of mucositis associated with cancer chemotherapy and IBD.
- due to the peptide's low molecular weight, teduglutide is cleared quickly with a half-life of less than 30 minutes. Accordingly, daily dosing is required to maintain the therapeutic level (Shin et al., Curr. Opin. Endocrin. Diabetes 12: 63-71 (2005)). Therefore, a need exists for a modified GLP-2 that will overcome the short half-life while retaining its function and provide for facile development and manufacture.
- Ileus Inflammatory ileus, the temporary impairment of coordinated gastrointestinal motility following invasive surgery or traumatic injury, remains a major clinical problem, extending hospital stays and often contributing to medical complications during the recovery period (Holte and Kehlet, Br. J. Surg. 87: 1480-1493 (2000)). Ileus is characterized by delayed gastric emptying, dilatation of the small bowel and colon, abdominal distension, loss of normal propulsive contractile patterns, and inability to evacuate gas or stool, leading to prolonged patient discomfort (abdominal distension, nausea, emesis).
- ileus can lead to more serious complications including acute gastric dilatation, cardiac arrhythmia, respiratory distress, aspiration pneumonia, and failure of surgical anastomoses.
- prolonged loss of the normal “housekeeping” contractile activity of the GI tract can contribute to bacterial overgrowth and breakdown of intestinal barrier function, followed by bacterial translocation and entry into the systemic circulation (Anup and Balasubramanian, J. Surg. Res. 92: 291-300 (2000)). This in turn can lead to endotoxemia, sepsis, multi-organ failure and ultimately death, an outcome for which elderly patients are the most susceptible.
- endotoxemia sepsis
- multi-organ failure and ultimately death an outcome for which elderly patients are the most susceptible.
- the return of normal bowel function is a prime limiting factor for release of patients from hospital, with inflammatory ileus increasing hospital stays by 3 to 5 days. Thus, costs accrued from increased morbidity and protracted hospital stays can be substantial.
- Factors that contribute to the development and maintenance of ileus include the activation of central sympathetic inhibitory reflexes which release norepinephrine into the bowel wall, inhibitory humoral agents, anesthetic and analgesic agents, and inflammatory mediators (Livingston and Passaro, Dig. Dis. Sci. 35: 121-132 (1990); Bauer et al., Curr. Opin. Crit. Care 8: 152-157 (2002)). Results from rodent studies suggest that inflammation within the wall of the GI tract plays a central role in initiating and maintaining ileus.
- muscularis externa is a highly immunologically active compartment. Normally resident within the muscularis externa is an impressive array of common leukocytes (Mikkelsen, Histol. Histopathol. 10: 719-736 (1995); Kalff et al., Ann. Surg. 228: 652-663 (1998)). Most abundant of these are resident macrophages, which form an extensive network of cells from the esophagus to the colon, and which are poised to defend the gastrointestinal tract from potential injury and disease. Disturbances to the bowel during abdominal surgery activate this macrophage network, initiating a local molecular inflammatory response.
- the activated macrophages release pro-inflammatory cytokines (IL-6, IL-1 ⁇ , TNF ⁇ ) and chemokines (MCP-1) that suppress neuromuscular communication within the muscularis and induce the expression of adhesion molecules (ICAM-1, P-selectin) on the vascular endothelium (Kalff et al., J. Leukoc. Biol. 63: 683-691 (1998); Josephs et al., J. Surg. Res.
- Infiltrating leukocytes release additional cytokines as well as prostaglandins, nitric oxide, proteases and reactive oxygen species that further contribute to neuromuscular dysfunction (von Ritter et al., Gastroenterology 97: 605-609 (1989); Bielefeldt and Conklin, Dig. Dis. Sci. 42: 878-884 (1997)).
- Opioids exert their analgesic effects by interacting with one or more of three receptor subtypes present on neurons in the pain processing centers of the brain.
- Most current opioid analgesics such as morphine, work primarily by activating ⁇ -(mu) and ⁇ (delta)-opioid receptors.
- these same receptors are also expressed on the neurons within the gastrointestinal tract that control bowel motility. Activation of the receptors, whether in the presence or absence of inflammatory ileus, significantly suppresses gastrointestinal contractile function, causing bowel stasis and constipation.
- Adalor Corporation has conducted Phase I and II clinical trials using Alvimopan, a peripherally restricted and selective ⁇ -OR antagonist that does not cross the blood-brain barrier.
- Alvimopan prevented opioid-induced suppression of intestinal motility (Gonenne et al., Clin. Gastroenterol. Hepatol. 3: 784-791 (2005)).
- Alvimopan was found to hasten return of bowel function and to shorten hospital stay in patients who were experiencing mild to moderate postoperative ileus after having undergone abdominal surgery (Viscusi et al., Surg. Endosc. 20: 64-70 (2006)). Alvimopan does not alter inflammation.
- FIG. 1 shows the image of a SDS-PAGE gel of GLP-2 mimetibody Pro substitution variants (SEQ ID NOs: 43 and 44) after incubation with U937 cell lysate.
- FIG. 2 shows a dose-dependent increase of the wet weight of mucosal scrapings from mice treated with A2G GLP-2 mimetibody.
- FIG. 3 shows a significant acceleration of intestinal transit in mice treated with A2G-GLP-2 peptide. Statistical significance determined by unpaired Student's T-test.
- FIG. 4 shows a significant acceleration of intestinal transit in mice treated with A2G GLP-2 mimetibody. Statistical significance determined by unpaired Student's t-test.
- FIG. 5 shows significant attenuation of the delay in gastrointestinal transit associated with post-operative inflammatory ileus in mice treated with murine A2G GLP-2 mimetibody. Statistical significance determined by ANOVA followed by Bonferroni post hoc test.
- FIG. 6 shows the whole mounts of intestinal muscularis with increased numbers of myeloperoxidase (MPO)-containing leukocytes following abdominal surgery.
- MPO myeloperoxidase
- FIG. 7 shows the histogram with compiled cell counts from FIG. 6 .
- Statistical significance determined by ANOVA followed by Bonferroni post hoc test.
- One aspect of the invention is a mimetibody having the generic formula (II): (GLP2RAg-Lk-V2-Hg—C H 2-C H 3) (t) (II) where GLP2RAg is a mammalian GLP-2R agonist, Lk is a polypeptide or chemical linkage, V2 is a portion of a C-terminus of an immunoglobulin variable region, Hg is at least a portion of an immunoglobulin variable hinge region, C H 2 is an immunoglobulin heavy chain C H 2 constant region and C H 3 is an immunoglobulin heavy chain C H 3 constant region and t is independently an integer from 1 to 10.
- GLP2RAg is a mammalian GLP-2R agonist
- Lk is a polypeptide or chemical linkage
- V2 is a portion of a C-terminus of an immunoglobulin variable region
- Hg is at least a portion of an immunoglobulin variable hinge region
- C H 2 is an immunoglobulin
- Another aspect of the invention is a mimetibody comprising a polypeptide having the sequence shown in SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11, 42, 43, 44, 45, 58, 59, 60, 61, 62, 63, 64, 65, 75, or 77.
- Another aspect of the invention is a polynucleotide comprising a polynucleotide having the sequence shown in SEQ ID NO: 12, 13, 14, 15, 16, 17, 18, 46, 47, 48, 49, 66, 67, 68, 69, 70, 71, 72, 73, 76, or 78 or a complementary sequence.
- Another aspect of the invention is a polynucleotide comprising a polynucleotide encoding the amino acid sequence shown in SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11, 42, 43, 44, 45, 58, 59, 60, 61, 62, 63, 64, 65, 75, or 77.
- Another aspect of the invention is a polypeptide comprising a polypeptide having the sequence shown in SEQ ID NO: 52, 54, 55 or 74.
- Another aspect of the invention is a polynucleotide comprising a polynucleotide encoding the amino acid sequence shown in SEQ ID NO: 52, 54, 55, or 74.
- Another aspect of the invention is a method of reducing the symptoms of, or treating a disorder characterized by injury and/or dysfunction of the intestinal mucosal epithelium, comprising administering a GLP-2 polypeptide composition or a GLP-2 mimetibody composition to a patient in need thereof.
- Another aspect of the invention is a method of preventing, reducing the symptoms of, or treating inflammatory ileus, comprising administering a GLP-2 polypeptide composition or a GLP-2 mimetibody composition to a patient in need thereof.
- the present invention provides protein constructs having the properties and activities of mammalian GLP-2.
- One embodiment of the invention is protein constructs that mimic different types of immunoglobulin molecules such as IgA, IgD, IgE, IgG, or IgM, and any subclass thereof, such as IgA1, IgA2, IgG1, IgG2, IgG3 or IgG4, or combinations thereof, hereinafter referred to as “GLP-2 mimetibodies” or simply “mimetibodies.”
- Another embodiment of the invention is polypeptides that are variants of GLP-2 where the polypeptides have the properties and activities of the wild type molecule.
- the invention also provides nucleic acids encoding GLP-2 mimetibodies, polypeptides, vectors containing these nucleic acids, host cells, compositions and methods of making and using GLP-2 mimetibodies and polypeptides.
- the present invention generally relates to mimetibody polypeptides having the generic formula (I): (Pep-Lk-V2-Hg—C H 2-C H 3) (t) (I) where Pep is a polypeptide having a desired biological property, Lk is a polypeptide or chemical linkage, V2 is a portion of a C-terminus of an immunoglobulin variable region, Hg is at least a portion of an immunoglobulin hinge region, C H 2 is an immunoglobulin heavy chain C H 2 constant region and C H 3 is an immunoglobulin heavy chain C H 3 constant region and t is independently an integer of 1 to 10.
- Pep is a polypeptide having a desired biological property
- Lk is a polypeptide or chemical linkage
- V2 is a portion of a C-terminus of an immunoglobulin variable region
- Hg is at least a portion of an immunoglobulin hinge region
- C H 2 is an immunoglobulin heavy chain C H 2 constant region
- the present invention relates to GLP-2 mimetibody polypeptides that are capable of, upon binding, activating GLP-2R.
- the polypeptides have the generic formula (II): (GLP2RAg-Lk-V2-Hg—C H 2-C H 3) (t) (II) where GLP2RAg is a mammalian GLP-2R agonist, Lk is a polypeptide or chemical linkage, V2 is a portion of a C-terminus of an immunoglobulin variable region, Hg is at least a portion of an immunoglobulin hinge region, C H 2 is an immunoglobulin heavy chain C H 2 constant region and C H 3 is an immunoglobulin heavy chain C H 3 constant region and t is independently an integer of 1 to 10.
- GLP-2R agonist encompasses any molecule which, upon binding to, activates GLP-2R.
- GLP-2R agonists include wild-type mammalian GLP-2 and peptidic analogs of GLP-2.
- An exemplary wild-type GLP-2 peptide has the amino acid sequence shown in SEQ ID NO: 1. It is known that certain amino acid residues in naturally occurring GLP-2 can be substituted for other amino acid residues with the analogs maintaining the GLP-2R binding property of the wild-type GLP-2. For example, Ala2 of the wild-type human GLP-2 peptide can be substituted with Ser (A2S) or Gly (A2G). The resulting amino acid sequences are shown in SEQ ID NOs: 2 and 3, respectively.
- novel analogs of wild-type human GLP-2 have been developed that function as GLP-2R agonists. Amino acid sequences of these analogs are shown in SEQ ID NOs: 50, 51, 52, 53, 54, 55, 56, 57, and 74 shown below (mutations designated against wild type GLP-2). These analogs are useful as GLP2RAg components of a mimetibody.
- GLP-2 peptides can self-associate and pose a problem for development and manufacture of a homogeneous therapeutic candidate. See US Patent Application Publication No. 20040122210 A1.
- the polypeptides having the amino acid sequences shown in SEQ ID NOs: 52, 54, 55 and 74 were designed to be monomeric at pH 7.5 and have reduced helical propensities. Accordingly, these human GLP-2 peptide analogs would be particularly useful in a mimetibody construct or as a naked therapeutic peptide.
- the linker portion provides structural flexibility by allowing the mimetibody to have alternative orientations and binding properties.
- exemplary linkers include non-peptide chemical linkages or one to 20 amino acids linked by peptide bonds, wherein the amino acids are selected from the 20 naturally occurring amino acids.
- the linker portion can include a majority of amino acids that are sterically unhindered, such as glycine, alanine and serine and include GS, GGGS (SEQ ID NO: 19), GSGGGS (SEQ ID NO: 20), and polymers or combinations thereof.
- Other exemplary linkers within the scope of the invention may be longer than 20 residues and may include residues other than glycine, alanine and serine.
- V2 is a portion of a C-terminal domain of an immunoglobulin variable region such as a heavy chain variable region.
- An exemplary V2 amino acid sequence is GTLVTVSS (SEQ ID NO: 21).
- O-glycosylation can occur at the two Tyr residues in the V2 region, although the extent of glycosylation is highly dependent on the host cell line and may also be influenced by culture conditions. O-glycans may act to block aggregation and proteolysis, resulting in greater in vivo stability. However, it may be desirable to abrogate the O-glycosylation because of heterogeneity and poor reproducibility. Accordingly, an alternative exemplary V2 amino acid sequence is GALVAVSS (SEQ ID NO: 22).
- Hg is a portion of the hinge domain of an immunoglobulin variable region such as a heavy chain variable region.
- exemplary Hg amino acid sequences include EPKSCDKTHTCPPCP (SEQ ID NO: 23), EPKSADKTHTCPPCP (SEQ ID NO: 24), ESKYGPPCPSCP (SEQ ID NO: 25), ESKYGPPCPPCP (SEQ ID NO: 26) and CPPCP (SEQ ID NO: 27).
- C H 2 is an immunoglobulin heavy chain C H 2 constant region.
- Exemplary C H 2 amino acid sequences include:
- C H 3 is an immunoglobulin heavy chain C H 3 constant region.
- Exemplary C H 3 amino acid sequences include: GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 32) and GQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 33).
- the C H 3 region of the mimetibodies of the invention may have its C-terminal amino acid cleaved off when expressed in certain recombinant systems.
- the FcRn scavenger receptor binding site of the immunoglobulin molecules is preserved at the junction of the C H 2 and C H 3 region. Since FcRn binding enables the return of pinocytosed immunoglobulin back to the extracellular space, it is expected that the half-life of GLP-2 mimetibodies will be significantly extended relative to GLP-2 peptides.
- the monomeric structure (GLP2-Lk-V2-Hg—C H 2-C H 3) can be linked to other monomers non-covalently or by covalent linkage, such as, but not limited to, a Cys-Cys disulfide bond.
- IgG1 and IgG4 subclasses differ in the number of cysteines in the hinge region. Like the IgG1 subclass, there are two cysteines in the IgG4 hinge that participate in the disulfide bonding between heavy chains. However, the cysteine in IgG1 hinge that is normally involved in disulfide bonding to the light chain is absent in the IgG4 hinge. Therefore, the IgG4 hinge is less flexible than the IgG1 hinge.
- CDC complement dependent cytotoxicity
- ADCC antibody-dependent cellular cytotoxicity
- ADCC is a cell-mediated reaction in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g., Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell.
- FcRs Fc receptors
- the IgG1 subclass binds with high affinity to the Fc receptor and contributes to ADCC while IgG4 binds only weakly. The relative inability of IgG4 to activate effector functions is desirable since delivery of the mimetibody to cells without cell killing is possible.
- the binding site for the FcRn scavenger receptor is present in IgG4 and IgG1 isotypes and both have similar binding characteristics. Therefore, the pharmacokinetics of the IgG1 and IgG4 mimetibodies of the invention are expected to be similar.
- the hinge-C H 2-C H 3 portion of the immunoglobulin region may also be extensively modified to form variants in accordance with the invention.
- one or more native sites that provide structural features or functional activity not required by the mimetibody molecules could be removed. These sites may be removed by, for example, substituting or deleting residues, inserting residues into the site, or truncating portions containing the site.
- Exemplary Hg—C H 2-C H 3 variants are discussed below.
- Sites involved in disulfide bond formation can be removed by deletion or substitution with other amino acids in the mimetibodies of the invention. Typically, the cysteine residues present in these motifs are removed or substituted. Removal of these sites may avoid disulfide bonding with other cysteine-containing proteins present in the mimetibody-producing host cell or intra-heavy chain disulfide bonding in IgG4-based constructs while still allowing for a dimeric CH3-CH2-hinge domain that is held together non-covalently.
- IgG type antibodies such as IgG1
- H heavy chain
- L light chain
- these molecules are generally bivalent with respect to antigen binding, i.e., both antigen binding (Fab) arms of the IgG molecule have identical binding specificity.
- IgG4 isotype heavy chains contain a CPSC (SEQ ID NO: 34) motif in their hinge regions capable of forming either inter- or intra-heavy chain disulfide bonds, i.e., the two Cys residues in the CPSC motif may disulfide bond with the corresponding Cys residues in the other H chain (inter) or the two Cys residues within a given CPSC motif may disulfide bond with each other (intra). It is believed that in vivo isomerase enzymes are capable of converting inter-heavy chain bonds of IgG4 molecules to intra-heavy chain bonds and vice versa (Aalberse and Schuurman, Immunology 105, 9-19 (2002)).
- CPSC SEQ ID NO: 34
- the HL pairs in those IgG4 molecules with intra-heavy chain bonds in the hinge region are not covalently associated with each other, they may dissociate into HL monomers that then reassociate with HL monomers derived from other IgG4 molecules forming bispecific, heterodimeric IgG4 molecules.
- a bispecific IgG antibody the two Fabs of the antibody molecule differ in the epitopes that they bind.
- Substituting Ser228 in the hinge region of IgG4 with Pro results in “IgG1-like behavior,” i.e., the molecules form stable disulfide bonds between heavy chains and therefore, are not susceptible to HL exchange with other IgG4 molecules.
- the H—C H 2-C H 3 can be modified to make the mimetibodies of the invention more compatible with a selected host cell.
- a mimetibody of the invention when expressed recombinantly in a bacterial cell such as E. coli , the Pro-Ala sequence in the hinge may be removed to prevent digestion by the E coli enzyme proline iminopeptidase.
- a portion of the hinge region can be deleted or substituted with other amino acids in the mimetibodies of the invention to prevent heterogeneity in the products expressed in a selected host cell.
- One or more glycosylation sites can be removed in the mimetibodies of the invention.
- Residues that are typically glycosylated e.g., Asn
- Such residues may be deleted or substituted with residues that are not glycosylated such as Ala.
- Sites can be removed that affect binding to Fc receptors other than an FcRn salvage receptor in the mimetibodies of the invention.
- the Fc receptors involved in ADCC activity can be removed in the mimetibodies of the invention.
- mutation of Leu234/Leu235 in the hinge region of IgG1 to L234A/L235A or Phe234/Leu235 in the hinge region of IgG4 to P234A/L235A minimizes FcR binding and reduces the ability of the immunoglobulin to mediate complement dependent cytotoxicity and ADCC.
- One embodiment of the present invention is a GLP-2 mimetibody according to formula (II) where the Hg—C H 2-C H 3 is from the IgG4 subclass and contains a Ser228Pro (S228P) substitution and P234A/L235A mutations.
- S228P Ser228Pro
- P234A/L235A mutations The complete polypeptide sequences of exemplary GLP-2 mimetibodies having these mutations and A2S and A2G in GLP-2 peptide sequence are shown respectively in SEQ ID NOs: 4 and 5. These sequences contain all of the domains of the mimetibody construct, namely the GLP2RAg-Lk-V2-Hg—C H 2-C H 3 domains.
- mimetibody constructs are expected to be a homogeneous and stable population that does not trigger FcR-mediated effector functions.
- substitution and mutations shown here are exemplary; Hg—C H 2-C H 3 domains within the scope of this invention may include other substitutions, mutations and/or deletions.
- the partial polypeptide sequences of other exemplary GLP-2 mimetibodies of the invention based on the GLP-2 analogs having the amino acid sequences shown in SEQ ID NOs: 50, 51, 52, 53, 54, 55, 56, and 57 are shown in SEQ ID NOs: 58, 59, 60, 61, 62, 63, 64, and 65, respectively. These sequences show all domains with the exception of the C H 2 and C H 3 domains. It will be understood by those skilled in the art that a C H 2 and C H 3 domain would be contained in a functional mimetibody.
- the present invention includes GLP-2 mimetibodies that are capable of, upon binding, activating GLP-2R.
- the mimetibodies of the present invention can bind GLP-2R with a wide range of affinities.
- the affinity of a GLP-2 mimetibody for GLP-2R can be determined experimentally using any suitable method, for example, methods using Biacore or KinExA instrumentation, ELISA and competitive binding assays.
- the GLP-2 mimetibodies and polypeptides of the present invention are useful in treating disorders or symptoms characterized by inflammation, injury and/or dysfunction of the intestinal mucosal epithelium. Effects of GLP-2 are also noted in bone formation and maintenance, and in central nervous system mediated disorders due to its role as a central satiety factor.
- GLP-2 mimetibodies or polypeptides of the invention include, but are not limited to, GI diseases, including SBS, inflammatory bowel disease (IBD), Crohn's disease, colitis, pancreatitis, ileitis, inflammatory ileus (both postoperative and from other causes), mucositis associated with cancer chemotherapy and/or radiotherapy, intestinal atrophy caused by total parenteral nutrition or ischemia, bone related disorders such as osteoporosis, nutrient related disorders including obesity, and pediatric GI disorders including intestinal failure due to necrotizing enterocolitis in newborn infants.
- GLP-2 mimetibodies or polypeptides of the present invention can also be used to prevent, reduce the symptoms of, and treat inflammatory ileus.
- compositions comprising at least one GLP-2 mimetibody or polypeptide of the invention and a pharmaceutically acceptable carrier or diluent known in the art.
- the carrier or diluent can be a solution, suspension, emulsion, colloid or powder.
- a GLP-2 mimetibody or polypeptide of the invention is formulated as a pharmaceutical composition in a therapeutically or prophylactically effective amount.
- effective amount generally refers to the quantities of mimetibody or polypeptide necessary for effective therapy, i.e., the partial or complete alleviation of the symptom or disorder for which treatment was sought. Included within the definition of effective therapy are prophylactic treatments intended to reduce the likelihood of onset of the above-described symptoms or disorders.
- the composition can optionally comprise at least one further compound, protein or composition useful for treating the disease states discussed herein.
- the mimetibodies or polypeptides of the invention can be used in combination with glutamine or other nutritional supplements are contemplated to increase body weight, aid in intestinal healing or improve nutrient absorption.
- combination with anti-inflammatory agents are also contemplated.
- the term “in combination with” as used herein and in the claims means that the described agents can be administered to a mammal together in a mixture, concurrently as single agents or sequentially as single agents in any order.
- nucleic acid molecules comprising, complementary to or having significant identity with a polynucleotide encoding at least one GLP-2 mimetibody or polypeptide of the invention.
- Other aspects of the present invention include recombinant vectors comprising at least one isolated GLP-2 mimetibody or polypeptide of the invention encoding nucleic acid molecule and cell lines and organisms that are capable of expressing the nucleic acid molecules.
- the nucleic acids, expression vectors and cell lines may generally be used to produce the mimetibody of the invention.
- nucleic acid compositions of the invention encode polypeptides having amino acid sequences identical to or substantially homologous to any one of SEQ ID NOs: 4, 5, 6, 7, 8, 9, 10, 11, 42, 43, 44, 45, 58, 59, 60, 61, 62, 63, 64, 65, 74, 75, and 77.
- nucleic acid sequences that encode the polypeptide sequences shown in SEQ ID NO: 5, 6, 7, 8, 9, 10, 11, 42, 43, 44, 45, 58, 59, 60, 61, 62, 63, 64, 65, 75, and 77 are shown in SEQ ID NO: 12, 13, 14, 15, 16, 17, 18, 46, 47, 48, 49, 66, 67, 68, 69, 70, 71, 72, 73, 76, and 78, respectively. Also provided are allelic variations of the above-described nucleic acids.
- the nucleic acids of the present invention are used in expression vectors for the preparation of the GLP-2 mimetibody or polypeptides of the invention.
- Vectors within the scope of the invention provide necessary elements for eukaryotic expression, including viral promoter driven vectors, such as CMV promoter driven vectors, e.g., pcDNA3.1, pCEP4 and their derivatives, Baculovirus expression vectors, Drosophila expression vectors and expression vectors that are driven by mammalian gene promoters, such as human Ig gene promoters.
- Other examples include prokaryotic expression vectors, such as T7 promoter driven vectors, e.g., pET41, lactose promoter driven vectors and arabinose gene promoter driven vectors.
- the present invention also relates to cell lines expressing GLP-2 mimetibodies or polypeptides of the invention.
- the host cells can be prokaryotic or eukaryotic cells.
- Exemplary eukaryotic cells are mammalian cells, such as but not limited to, COS-1, COS-7, HEK293, BHK21, CHO, BSC-1, HepG2, 653, SP2/0, NS0, 293, HeLa, myeloma, lymphoma cells, or any derivative thereof.
- the host cells are HEK293, NS0, SP2/0 or CHO cells.
- the cell lines of the present invention may stably express at least one GLP-2 mimetibody.
- the cell lines may be generated by stable or transient transfection procedures that are well known in the art.
- the present invention further provides methods for expressing at least one GLP-2 mimetibody or polypeptide comprising culturing the cell lines under conditions wherein the GLP-2 mimetibody or polypeptide is expressed in detectable or recoverable amounts.
- the present invention also provides methods for generating at least one GLP-2 mimetibody or polypeptide comprising translating the GLP-2 mimetibody or polypeptide encoding nucleic acids under conditions in vitro or in situ, such that the GLP-2 mimetibody or polypeptide is expressed in detectable or recoverable amounts.
- the present invention also encompasses GLP-2 mimetibodies or polypeptides produced by the above methods.
- a GLP-2 mimetibody can be recovered and purified by well-known methods including, but not limited to, protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylatpatite chromatography and lectin chromatography.
- Reversed phase high performance liquid chroatography RP-HPLC
- RP-HPLC Reversed phase high performance liquid chroatography
- GLP-2 derived polypeptide of the invention can be prepared by chemical synthesis techniques well known to those skilled in the art. Polypeptides of the invention produced by either recombinant or chemical methods can be recovered and purified by methods well known to those skilled in the art.
- the GLP-2 mimetibodies or polypeptides are useful as, inter alia, research reagents and therapeutic agents.
- the present invention relates to a method of modifying the biological activities of GLP-2 comprising providing at least one GLP-2 mimetibody or polypeptide to a mammal in need thereof.
- the GLP-2 mimetibody or polypeptide may activate cell signaling cascades through GLP-2R.
- the GLP-2 mimetibody or polypeptide may function as an agonist of GLP-2R.
- the term “agonist” is used in the broadest sense and includes a molecule that is capable of, directly or indirectly, partially or fully activating, increasing or promoting one or more biological activities of GLP-2R.
- the present invention also provides methods for reducing the symptoms of, or treating at least one GLP-2 related condition or disease comprising administering a therapeutically effective amount of at least one GLP-2 mimetibody or polypeptide pharmaceutical composition to a patient in need thereof.
- the conditions and diseases suitable for treatment using the methods of the present invention include but are not limited to GI diseases, including SBS, Crohn's disease, and pediatric GI disorders, mucositis associated with cancer chemotherapy, IBD, inflammatory ileus, and other diseases and conditions described above.
- GLP-2 interacts preferentially with GLP-2R found primarily on neurons of the enteric nervous system, and on GLP-2 containing enteroendocrine cells (Guan et al., Gastroenterology 130: 150-164 (2006)).
- One of the primary functions of GLP-2 is to promote columnar cell proliferation in the villus crypts where it enhances epithelial cell turnover and mucosal wound healing (Bulut et al., Regul. Pept. 121: 137-43 (2004)), enhances mucosal barrier function (Benjamin et al., Gut 47: 112-119 (2000)), and inhibits cell death by apoptosis (Brubaker and Drucker, Endocrinology 145: 2653-2659 (2004)).
- GLP-2R is not expressed in crypt columnar epithelial cells (Bjerknes and Cheng, Proc. Natl. Acad. Sci. U.S.A. 98: 12497-12502 (2001)).
- the presence of GLP-2R on enteric neurons suggests that GLP-2 may modify motility as well as neuro-immune interactions that play a role in intestinal inflammation.
- the present invention further provides methods of preventing, reducing the symptoms of, or treating inflammatory ileus, comprising administering a GLP-2 polypeptide composition or a GLP-2 mimetibody composition to a patient in need thereof.
- inflammatory ileus can be ileus of any portion of the gastrointestinal tract, e.g., the stomach, small intestine and/or the colon.
- inflammatory ileus can result from any factor that causes ileus, e.g., surgery, including abdominal surgery such as transplantation surgery or abdominal surgery other than transplantation surgery, bowel surgery such as bowel resection, and orthopedic surgery; traumatic injury, e.g., falls, car accident, personal assault, or any sequelae resulting from traumatic injury, e.g.
- limb fractures e.g., limb fractures, rib fractures, fractures of the spine, thoracic lesions, ischaemia, retroperitoneal hematoma; intraperitoneal inflammation, e.g., intraabdominal sepsis, acute appendicitis, cholecystitis, pancreatitis, ureteric colic, basal pneumonia; myocardial infarction; metabolic disturbances; or any combination thereof.
- intraperitoneal inflammation e.g., intraabdominal sepsis, acute appendicitis, cholecystitis, pancreatitis, ureteric colic, basal pneumonia
- myocardial infarction e.g., myocardial infarction
- metabolic disturbances e.g., metabolic disturbances; or any combination thereof.
- the GLP-2 mimetibody or polypeptide pharmaceutical composition comprises an effective amount of at least one GLP-2 mimetibody or polypeptide and a pharmaceutically acceptable carrier or diluent.
- the effective amount for a given therapy whether curative or preventative, will generally depend upon may different factors, including means of administration, target site and other medicants administered. Thus, treatment doses will need to be titrated to optimize safety and efficacy.
- the methods of the present invention can optionally further comprise co-administration or combination therapies with any standard therapy used to treat the diseases listed above.
- the mode of administration can be any suitable route to deliver the pharmaceutically effective amount of GLP-2 mimetibody or polypeptide of the present invention to a host.
- the GLP-2 mimetibody or polypeptide can be delivered via parenteral administration, such as subcutaneous, intramuscular, intradermal, intravenous or intranasal administration, or any other means known in the art.
- Nucleic acid sequence encoding A2S GLP-2 was generated in a 2-step PCR amplification.
- the first round amplification was performed using forward primer 5′-CCAAAGTATACAGGCGCATAGCGATGGTTCTTTCTCTGATGAGATGAACACCATTCTTG-3′ (SEQ ID NO: 37) and reverse primer 5′-TTGGTCTGAATCAACCAGTTTATAAAGTCTCGAGCGGCAAGATTATCAAGAATGGTGTTCA TCTC-3′ (SEQ ID NO: 38).
- the melting, annealing and extension temperature were set at 96° C., 48° C., and 72° C., respectively. Three cycles of reactions were carried out.
- the forward primer included a NotI restriction enzyme recognition site and the reverse primers included a BamHI site.
- the sequence of the forward primer is 5′-TTTGCGGCCGCCCAAAGTATACAGGCG-3′ (SEQ ID NO: 39) and reverse primer 5′-AAAGGATCCGTCAGTGATTTTGGTCTGAATCAACCAG-3′ (SEQ ID NO: 40).
- the melting, annealing and extension temperature were set at 96° C., 48° C., and 60° C., respectively. Thirty cycles of reactions were carried out.
- Nucleic acid sequence encoding A2G GLP-2 was generated in the same procedure except the forward primer used in the first round of amplification is 5′-CCAAAGTATACAGGCGCATGGCGATGGTTCTTTCTCTGATGAGATGAACACCATTCTTG-3′ (SEQ ID NO: 41).
- amplified PCR products (A2S and A2G GLP-2) were cloned into the NotI/BamHI sites of a CMV promoter driven, human IgG4 ⁇ CH1, Ser to Pro, Ala/Ala expression vector using standard cloning procedures.
- the A2S and A2G GLP-2 IgG4 mimetibodies were transiently expressed in HEK 293E cells and purified from the conditioned media using protein A affinity chromatography according to standard procedures.
- the eluted material from the protein A affinity column was further subjected to a size exclusion column for further purification.
- the purified A2S and A2G GLP-2 mimetibodies were analyzed by SDS-polyacrylamide gel electrophoresis (SDS-PAGE) and size exclusion chromatography coupled to static light scattering analysis (SEC-SLS).
- SDS-PAGE SDS-polyacrylamide gel electrophoresis
- SEC-SLS static light scattering analysis
- a CAMP expression assay was developed. To achieve this goal, a clonal cell line expressing a mutated human GLP-2R was generated by transfecting HEK 293E cells. The mutated human GLP-2R differs from the wild-type human GLP-2R (SEQ ID NO: 35) at three amino acid positions within the C-terminal intracellular region (SEQ ID NO: 36). GLP-2 peptide stimulated cAMP expression in this cell line and the stimulation was specific, as a control peptide did not stimulate cAMP expression.
- A2S and A2G IgG4 GLP-2 mimetibodies were compared with the corresponding GLP-2 peptides (A2S and A2G) for their ability to stimulate cAMP expression in the recombinant cell line. Briefly, cells were incubated with individual GLP-2 mimetibody or GLP-2 peptide for 30 minutes. The CAMP expression was quantitated using the cAMP Direct Screen System (Cat. No. CSD 200, Applied Biosystems, Bedford, Mass.). The EC 50 for A2S and A2G peptides are 0.5 nM and 0.8 nM, respectively; the EC 50 for A2S and A2G mimetibodies are 2.2 nM and 3.8 nM, respectively. Therefore, the potency of the GLP-2 mimetibodies in this assay was ⁇ 4-fold less than the peptide.
- GLP-2 mimetibodies In order to increase the stability of GLP-2 mimetibodies, a series of variants were constructed in which the amino acid residues at the proteolytic cleavage sensitive sites in the V2 or Hg region were substituted with Pro.
- the core region sequences of the GLP-2 mimetibody variants are shown below in Table 2.
- the Pro substitution variants were expressed transiently in HEK 293 cells, purified and analyzed by SDS-PAGE.
- the data from the cAMP expression assay demonstrated that the activities of these GLP-2 mimetibody variants, as measured by EC 50 , are comparable to that of the A2G GLP-2 mimetibody (SEQ ID NO: 5).
- the purified Pro substitution variants were incubated with U937 cell lysate in the presence of CompleteMini protease inhibitor tablets (Cat. No. 1 836 153, Roche Applied Science, Indianapolis, Ind.) for 0, 12, or 24 hours. Afterwards, GLP-2 mimetibody variants were purified using Protein A beads and resolved on a SDS-PAGE gel. As shown in FIG. 1 , in comparison with the A2G GLP-2 mimetibody (SEQ ID NO: 5), there was less degradation in Pro substitution variants (SEQ ID NO: 43 or 44) in the 24 hour test period. In conclusion, the Pro substitution variants are more resistant to proteolysis in vitro.
- GLP-2 Mimetibody Stimulates the Mucosal Weight Gain in Small Intestine
- CD1 mice were injected with the GLP-2 mimetibodies and endpoints within the small intestine were evaluated. Briefly, female CD1 mice were given daily subcutaneous injections of A2G GLP-2 peptide (SEQ ID NO: 3), A2G GLP-2 IgG4 mimetibody (SEQ ID NO: 5), or control mimetibody for 10 days. Afterwards, the mice were euthanized and the small intestines were removed, flushed with saline, and processed as described below.
- A2G GLP-2 peptide SEQ ID NO: 3
- A2G GLP-2 IgG4 mimetibody SEQ ID NO: 5
- the weight of the mucosal scrapings taken from the 15 cm segment between jejunum and ileum from different mice is shown in FIG. 2 .
- mice injected with A2G GLP-2 mimetibody a dose dependant increase in mucosal wet weight was observed.
- the increase was statistically significant comparing with the control mimetibody (p ⁇ 0.0001 and p ⁇ 0.0004, respectively).
- a statistically significant increase (p ⁇ 0.0001) was also seen in mice injected with the A2G GLP-2 peptide at 2.5 mg/kg (13.3 nmole).
- the A2G GLP-2 mimetibody is effective in vivo at a 50-fold lower dose than the A2G GLP-2 peptide (on a molar basis).
- CD1 mice were intravenously or subcutaneously dosed with 3 mg/kg of the A2G GLP-2 mimetibody (SEQ ID NO: 5). Blood was collected at different time points into citrate buffer containing protease inhibitors to minimize the possibility of ex vivo degradation and plasma was separated by centrifugation.
- TRF time resolved fluorescence
- the calculated half-life of the A2G GLP-2 mimetibody in mice was 26.5 hours.
- the reported half-life of GLP-2 peptide in humans is 7.2+/ ⁇ 2 minutes (Hartmann et al., J. Clin. Endocrinol. Metab. 85: 2884-2888 (2000)). Therefore, the half-life of A2G GLP-2 mimetibody is more than 200-fold higher than that of the GLP-2 peptide.
- mice were dosed daily, every other day, weekly, or once only at the start of the study.
- the negative control mimetibody i.e., the mimetibody immunoglobulin scaffold without the GLP-2 peptide.
- the doses of the A2G GLP-2 mimetibody and the negative control were 4 mg/kg (1.3 nmoles/kg) for all groups.
- the duration of the study was 11 days and tissue was processed as described in Example 4.
- Wild-type GLP-2 peptide dimerizes at high concentration.
- GLP-2 exists as a monomer at 0.4 mg/mL but as a mixture of monomers (about 20%) and reversibly self-associated dimer (about 80%) at 2 mg/mL (data not shown).
- the self-association poses a challenge to the development and manufacturing of a homogeneous therapeutic.
- Peptide analogs (SEQ ID NOs: 52, 54, 55, and 74) were designed that retain wild-type GLP-2 biological activity and exist as a monomer at high concentration.
- Peptides GLP-2 (SEQ ID NO: 1), GLP-2(A2G) (SEQ ID NO: 3), and GLP-1 (SEQ ID NO: 79) were included as controls in the characterization of the analogs.
- Solution molecular weight of the peptides was measured by SEC-SLS. Briefly, peptide solutions in PBS (pH 7.5) at 0.4 to 2.0 mg/mL were fractionated over a Superdex peptide column (Amersham Pharmacia). The eluted peaks were monitored by static light scattering at 690 nm and solution molecular weight was determined at UV 280 nm using the Astra software package (Wyatt Inc.).
- GLP-1 eluted as a single peak with molecular weight within the expected monomer size.
- GLP-2 and GLP-2(A2G) displayed similar distributions of overlapping dimer and monomer peaks. Both analog peptides GLP-2(A2G, L17Q) and GLP-2(A2G, N16G, L17Q) eluted as single peaks with molecular weight consistent with mainly monomeric peptide.
- the secondary structures of tested peptides were determined using 0.2 mg/mL peptide solutions in PBS. Briefly, CD spectra were collected in triplicate at 1 nm intervals at 25° C. in 0.1 cm path length cell. Secondary structures were determined by fitting of the CD spectra using CD spectra software (CD Spectra Deconvolution software 2.1). All tested peptides contained peaks corresponding to the presence of alpha helices. However, helix content in the analog peptides GLP-2(A2G, L17Q) and GLP-2(A2G, N16G, L17Q) was ⁇ 17%, similar to that of GLP-1, and lower than that of GLP-2 and GLP-2(A2G) (Table 3).
- GLP-2 GLP-2 (A2G, GLP-2 (A2G, Structure GLP-2 (A2G) L17Q) N16G, L17Q) GLP-1 Helix 19.6% 20.7% 16.9% 17.0% 16.8% Random 37.9% 37.1% 41.8% 41.4% 41.9% coil
- TFE trifluoroethanol
- GLP-2 and GLP-2(A2G) displayed greater helical propensity, requiring ⁇ 16% TFE for transformation to maximum helix signal.
- GLP-1 had lower helical propensity, requiring >20% TFE for helical transformation.
- the analog peptides GLP-2(A2G, L17Q) and GLP-2(A2G, N16G, L17Q) both require >20% TFE for helical transformation, bearing a closer resemblance to GLP-1 than to GLP-2. Therefore, L17Q substitution decreased the helix-forming potential of the GLP-2 peptide.
- Nucleic acid sequences encoding GLP-2 mimetibodies with A2G, L17Q (SEQ ID NO: 75) and A2G, N16G, L17Q (SEQ ID NO: 77) analogs were generated using the QuickChange XL kit from Stratagene. These mimetibody variants were transiently expressed in HEK 293E cells and purified following procedures described in Example 1.
- GLP-2(A2G, N16G, L17Q) mimetibody exhibited molecular weight consistent with monomer while GLP-2(A2G, L17Q) mimetibody exhibited molecular weight reflective of a monomer and dimer mixture.
- the in vitro activity of GLP-2 analogs was tested in a cAMP expression assay.
- This assay was based on the cAMP Direct screen system from Applied Biosystems utilizing a cell line expressing mutated huGLP-2R in HEK 293E cells. Peptide at concentrations ranging from 0.01 nM to 1.0 uM in PBS with 0.5% BSA was added to ⁇ 50,000 cells suspended in 96-well plates. After a 30-minute incubation at 37° C., Lysis Buffer followed by luminescence reagents (Applied Biosystems) was added according to the manufacturers' procedures (Applied Biosystems Luminescence protocol: cAMP-Screen Direct System).
- Luminescence was quantitated using a TopCount liquid scintillation analyzer (PerkinElmer), and data was processed using Softmax software (Molecular Devices Corporation). The EC-50 values obtained from plots of cAMP levels versus peptide concentration are listed in Table 5 below.
- the data indicate only 2 ⁇ - and 3 ⁇ -less activity of GLP-2 (A2G,N16G, L17Q) and GLP-2 (A2G, L17Q) , respectively, relative to wild type GLP-2.
- mice were randomly assigned to 2 groups (14 animals per test group). Each group received daily subcutaneous injection (total volume 200 ml) of either A2G-GLP-2 peptide (50 ⁇ g/mouse) or the phosphate-buffered saline vehicle for 10 consecutive days.
- mice On the day of study, upper gastrointestinal transit was measured using the carmine dye technique. Mice were fed a test meal of 0.25 ml of a 6% (w/v) solution of carmine cochineal powder mixed into 0.5% (w/v) methylcellulose administered intragastrically by an 18 gauge curved feeding tube. Following oral test meal administration, mice were replaced into their home cages. Twenty minutes after marker meal administration, mice were rapidly euthanized by cervical dislocation and the entire gastrointestinal tract was excised starting from the distal colon and working towards the gastric pylorus. The resected gut was arranged lengthwise parallel to a linear metric scale ruler taking care to avoid stretching the organ.
- mice were randomly assigned to 2 groups (4 animals per group). Each group received a single injection of A2G GLP-2 mimetibody (SEQ ID NO: 5) (4 mg/kg) or the IgG4 negative control 4 days prior to measurement of gastrointestinal transit.
- SEQ ID NO: 5 A2G GLP-2 mimetibody
- mice On the day of study, upper gastrointestinal transit was measured using the FITC-dextran method. This method provides both, a measure of gastrointestinal transit and a readout of the pattern of distribution of the test meal along the gastrointestinal tract.
- Mice were fed a test meal of 150 ml of FITC-dextran solution (5 mg/ml of 70,000 molecular weight dextran conjugated to fluorescein-isothiocyanate in 0.5% methylcellulose/deionized water) administered intragastrically by an 18 gauge curved feeding tube. Following oral administration of the FITC-dextran test meal, mice were returned to their home cages.
- mice were sacrificed by carbon dioxide exposure. The entire gastrointestinal tract from the lower esophageal sphincter to the terminal colon was removed. The bowel segments were opened along the mesenteric border. The tissue and luminal contents of the stomach, 10 equal segments of small intestine, the cecum, and 3 equal segments of colon were placed in individual Eppendorf tubes containing 1 ml of PBS. The tissue was vigorously mixed on a table-top vortex, and solid materials were pelleted by centrifugation.
- GC Geometric Center
- mice There is reduced labeling in the stomach, and an overall shift of the bulk of the label to more distal segments of the small bowel.
- GLP-2 Mimetibody Attenuates Impaired GI Motility Associated with Post-Operative Inflammatory Ileus
- a murine GLP-2 mimetibody i.e., human A2G-GLP2 peptide in murine IgG2a scaffold (SEQ ID NO: 80) was used in the following experiments.
- mice were randomized into 3 groups (8 animals per group) and treated with 2 mg/kg murine A2G-GLP-2 mimetibody, IgG2a or PBS. One hour later, the mice were subject to laparotomy and manipulation of the small intestine. Briefly, male CD-1 mice were anesthetized by inhaled isoflurane and prepared for surgery. The abdomen was shaved of hair and treated with antiseptic solution. The animal was then covered with a surgical drape. The abdomen was opened via mid-line laparotomy, and the entire small intestine was exteriorized onto the sterile drape.
- mice received an oral test meal of FITC-dextran 48 hr after the operation. Gastrointestinal transit was determined 45 minutes after oral feeding. As shown in FIG. 5 , na ⁇ ve controls exhibited a normal 45-minute transit (GC 8.2). Abdominal surgery led to a significant delay in gastrointestinal transit in PBS-treated animals. Treatment with IgG2a had no effect on the surgically induced delay in transit, whereas treatment with murine A2G-GLP-2 mimetibody led to a significant improvement in transit.
- GLP-2 Mimetibody Reduces Cellular Inflammation Associated with Post-Operative Inflammatory Ileus
- mice To test the effects of GLP-2 mimetibody on cellular inflammation, post-operative inflammatory ileus was induced in mice as described in Example 12. Myeloperoxidase histochemistry was performed on tissues harvested from the mid-small bowel of the mice 48 hr after the operation.
- FIG. 6 Representative whole mounts of intestinal muscularis stained for myeloperoxidase (MPO) activity using Hanker-Yates reagent are shown in FIG. 6 .
- Black dots represent MPO-positive leukocytes infiltrating the small intestinal muscle layer. Few MPO-positive cells were found in tissue harvested from na ⁇ ve mice. A marked increase in the number of infiltrating leukocytes was found in mice treated with PBS prior to undergoing surgical manipulation of the small bowel. Treatment with IgG2a had no effect on the numbers of infiltrating cells. In contrast, treatment with murine A2G-GLP-2 mimetibody significantly reduced the number of infiltrating cells. Cell counts are compiled in FIG. 7 for statistical comparison.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Molecular Biology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Endocrinology (AREA)
- Physical Education & Sports Medicine (AREA)
- Rheumatology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pain & Pain Management (AREA)
- Diabetes (AREA)
- Hematology (AREA)
- Child & Adolescent Psychology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Obesity (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US11/848,635 US7812121B2 (en) | 2006-08-31 | 2007-08-31 | GLP-2 mimetibodies, polypeptides, compositions, methods and uses |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US82416006P | 2006-08-31 | 2006-08-31 | |
| US86248706P | 2006-10-23 | 2006-10-23 | |
| US11/848,635 US7812121B2 (en) | 2006-08-31 | 2007-08-31 | GLP-2 mimetibodies, polypeptides, compositions, methods and uses |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20090117104A1 US20090117104A1 (en) | 2009-05-07 |
| US7812121B2 true US7812121B2 (en) | 2010-10-12 |
Family
ID=39136940
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/848,635 Expired - Fee Related US7812121B2 (en) | 2006-08-31 | 2007-08-31 | GLP-2 mimetibodies, polypeptides, compositions, methods and uses |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US7812121B2 (de) |
| EP (1) | EP2076604A4 (de) |
| JP (1) | JP5290177B2 (de) |
| WO (1) | WO2008028117A2 (de) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020231199A1 (ko) | 2019-05-14 | 2020-11-19 | 주식회사 프로젠 | 신규 변형 면역글로불린 fc 융합단백질 및 그의 용도 |
| EP3706774A4 (de) * | 2017-11-06 | 2021-09-08 | Shire-NPS Pharmaceuticals, Inc. | Glp-2-analoga und peptide zur verabreichung vor, während oder nach der operation |
| US20210355187A1 (en) * | 2018-10-24 | 2021-11-18 | Shire-Nps Pharmaceuticals, Inc. | Glp-2 fusion polypeptides and uses for treating and preventing gastrointestinal conditions |
Families Citing this family (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090099031A1 (en) * | 2005-09-27 | 2009-04-16 | Stemmer Willem P | Genetic package and uses thereof |
| US7846445B2 (en) * | 2005-09-27 | 2010-12-07 | Amunix Operating, Inc. | Methods for production of unstructured recombinant polymers and uses thereof |
| US20130172274A1 (en) | 2005-12-20 | 2013-07-04 | Duke University | Methods and compositions for delivering active agents with enhanced pharmacological properties |
| US20100268055A1 (en) * | 2007-07-19 | 2010-10-21 | Arizona Board of Regents, a body corporate acting for and on behalf of Arizona State University | Self-Anchoring MEMS Intrafascicular Neural Electrode |
| JP2010536341A (ja) * | 2007-08-15 | 2010-12-02 | アムニクス, インコーポレイテッド | 生物学的に活性なポリペプチドの特性を改変するための組成物および方法 |
| CN102131516B (zh) | 2008-06-27 | 2016-03-16 | 杜克大学 | 包含弹性蛋白样肽的治疗剂 |
| ES2610356T3 (es) | 2009-02-03 | 2017-04-27 | Amunix Operating Inc. | Polipéptidos recombinantes extendidos y composiciones que comprenden los mismos |
| CA2771999A1 (en) | 2009-08-24 | 2011-03-10 | Amunix Operating Inc. | Coagulation factor vii compositions and methods of making and using same |
| WO2013096346A1 (en) * | 2011-12-22 | 2013-06-27 | Development Center For Biotechnology | Bispecific t-cell activator antibody |
| EP2822577B1 (de) | 2012-02-15 | 2019-02-06 | Bioverativ Therapeutics Inc. | Rekombinante faktor-viii-proteine |
| JP6256882B2 (ja) | 2012-02-15 | 2018-01-10 | アムニクス オペレーティング インコーポレイテッド | 第viii因子組成物、ならびに組成物の作製方法および用途 |
| TWI492953B (zh) * | 2013-01-04 | 2015-07-21 | Dev Center Biotechnology | 雙特異性t細胞活化劑抗體 |
| TW202003554A (zh) | 2013-08-14 | 2020-01-16 | 美商百歐維拉提夫治療公司 | 因子viii-xten融合物及其用途 |
| KR102455171B1 (ko) * | 2013-12-18 | 2022-10-14 | 더 스크립스 리서치 인스티튜트 | 변형된 치료제, 스테이플드 펩티드 지질 접합체, 및 이의 조성물 |
| DK3292135T3 (da) | 2015-05-06 | 2022-10-31 | Univ Wageningen | Anvendelse af et polypeptid til at fremkalde immunsignalering og/eller påvirke tarmbarrierefunktion og/eller modulere metabolsk status |
| EA201890423A1 (ru) | 2015-08-03 | 2018-07-31 | Биовератив Терапьютикс Инк. | Слитые белки фактора ix, способы их получения и применения |
| EP3526242A1 (de) * | 2016-10-12 | 2019-08-21 | University of Copenhagen | Duale peptidagonisten von gipr und glp2r |
| MX2019006444A (es) | 2016-12-02 | 2019-10-30 | Bioverativ Therapeutics Inc | Métodos de tratamiento de artropatía hemofílica utilizando factores de coagulación quiméricos. |
| BR112020003736A2 (pt) * | 2017-08-22 | 2020-09-08 | Shire-Nps Pharmaceuticals, Inc. | polipeptídeos de fusão de glp-2 e usos para tratar e prevenir condições gastrointestinais |
| PL3793588T3 (pl) | 2018-05-18 | 2025-09-01 | Bioverativ Therapeutics Inc. | Sposoby leczenia hemofilii a |
| WO2020198604A1 (en) * | 2019-03-28 | 2020-10-01 | United States Government As Represented By The Department Of Veterans Affairs | Compositions and methods of treating and preventing systemic complications of acute illness |
| KR20220150270A (ko) | 2019-10-07 | 2022-11-10 | 칼리오페, 인크. | Gpr119 효능제 |
| MX2022006861A (es) | 2019-12-04 | 2022-07-11 | Scripps Research Inst | Agonistas del receptor glp2 y metodos de uso. |
| TW202140440A (zh) | 2020-02-28 | 2021-11-01 | 美商克力歐普股份有限公司 | Gpr40激動劑 |
| WO2021236617A1 (en) | 2020-05-19 | 2021-11-25 | Kallyope, Inc. | Ampk activators |
| CN116390925A (zh) | 2020-06-26 | 2023-07-04 | 卡尔优普公司 | Ampk活化剂 |
| KR20240032010A (ko) | 2021-06-09 | 2024-03-08 | 더 스크립스 리서치 인스티튜트 | 장기 지속형 이중 gip/glp-1 펩타이드 접합체 및 사용 방법 |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5789379A (en) * | 1995-04-14 | 1998-08-04 | Allelix Biopharmaceutical Inc. | Glucagon-like peptide-2 analogs |
| US20010021767A1 (en) | 1995-04-14 | 2001-09-13 | Drucker Daniel J. | Glucagon-like peptide-2 analogs |
| WO2005097175A2 (en) | 2004-03-31 | 2005-10-20 | Centocor, Inc. | Human glp-1 mimetibodies, compositions, methods and uses |
| US7112567B2 (en) * | 2001-02-16 | 2006-09-26 | Conjuchem Inc. | Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders |
| US20070036806A1 (en) | 2003-06-12 | 2007-02-15 | Eli Lilly And Company | Glp-1 analog fusion proteins |
| WO2007067828A2 (en) | 2005-10-24 | 2007-06-14 | Centocor, Inc. | Glp-2 mimetibodies, polypeptides, compositions, methods and uses |
-
2007
- 2007-08-31 JP JP2009526928A patent/JP5290177B2/ja not_active Expired - Fee Related
- 2007-08-31 WO PCT/US2007/077364 patent/WO2008028117A2/en not_active Ceased
- 2007-08-31 US US11/848,635 patent/US7812121B2/en not_active Expired - Fee Related
- 2007-08-31 EP EP07814619A patent/EP2076604A4/de not_active Withdrawn
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5789379A (en) * | 1995-04-14 | 1998-08-04 | Allelix Biopharmaceutical Inc. | Glucagon-like peptide-2 analogs |
| US20010021767A1 (en) | 1995-04-14 | 2001-09-13 | Drucker Daniel J. | Glucagon-like peptide-2 analogs |
| US7112567B2 (en) * | 2001-02-16 | 2006-09-26 | Conjuchem Inc. | Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders |
| US20070036806A1 (en) | 2003-06-12 | 2007-02-15 | Eli Lilly And Company | Glp-1 analog fusion proteins |
| WO2005097175A2 (en) | 2004-03-31 | 2005-10-20 | Centocor, Inc. | Human glp-1 mimetibodies, compositions, methods and uses |
| WO2007067828A2 (en) | 2005-10-24 | 2007-06-14 | Centocor, Inc. | Glp-2 mimetibodies, polypeptides, compositions, methods and uses |
Non-Patent Citations (55)
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3706774A4 (de) * | 2017-11-06 | 2021-09-08 | Shire-NPS Pharmaceuticals, Inc. | Glp-2-analoga und peptide zur verabreichung vor, während oder nach der operation |
| US11660328B2 (en) | 2017-11-06 | 2023-05-30 | Takeda Pharmaceutical Company Limited | GLP-2 analogs and peptibodies for administration before, during or after surgery |
| US20210355187A1 (en) * | 2018-10-24 | 2021-11-18 | Shire-Nps Pharmaceuticals, Inc. | Glp-2 fusion polypeptides and uses for treating and preventing gastrointestinal conditions |
| WO2020231199A1 (ko) | 2019-05-14 | 2020-11-19 | 주식회사 프로젠 | 신규 변형 면역글로불린 fc 융합단백질 및 그의 용도 |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2008028117A2 (en) | 2008-03-06 |
| EP2076604A2 (de) | 2009-07-08 |
| JP5290177B2 (ja) | 2013-09-18 |
| US20090117104A1 (en) | 2009-05-07 |
| WO2008028117A3 (en) | 2008-10-23 |
| EP2076604A4 (de) | 2009-09-02 |
| JP2010502195A (ja) | 2010-01-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7812121B2 (en) | GLP-2 mimetibodies, polypeptides, compositions, methods and uses | |
| EP1948785B1 (de) | Glp-2-mimetikörper, polypeptide, zusammensetzungen, verfahren und verwendungen | |
| EP2185178B1 (de) | Verwendung einer fgf-21-verbindung und glp-1-verbindung zur behandlung von adipostias | |
| ES2897732T3 (es) | Composición para tratar la diabetes mellitus que comprende insulina y un agonista doble de glp-1/glucagón | |
| JP6320293B2 (ja) | 持続型インスリン結合体及び持続型インスリン分泌ペプチド結合体を含む糖尿病治療用組成物 | |
| TW201010729A (en) | GIP-based mixed agonists for treatment of metabolic disorders and obesity | |
| TW200938225A (en) | Ester-based peptide prodrugs | |
| JP7835367B2 (ja) | リラキシン-2融合タンパク質類似体及びそれを使用する方法 | |
| KR101767570B1 (ko) | 항 비만 펩타이드의 지속형 결합체 | |
| KR102826981B1 (ko) | 신규 이중 특이성 단백질 및 그의 용도 | |
| TW202317607A (zh) | 融合蛋白及其應用 | |
| CN107987170A (zh) | 一种用于治疗肠道疾病的融合蛋白 | |
| US20200282021A1 (en) | Glp-1 fusion proteins and uses thereof | |
| CN118076373A (zh) | 用于联合疗法的包括生长分化因子-15变体和胰高血糖素样肽-1受体激动剂的组合物 | |
| CN101331224A (zh) | Glp-2模拟体、多肽、组合物、方法和用途 | |
| WO2025050218A1 (en) | Combination therapy with actriib receptor variants and glp-1 agonists | |
| CN121985965A (en) | Combination therapy of ActRIIB receptor variants and GLP-1 agonists | |
| KR20210141406A (ko) | 신규 재조합 융합단백질 및 그의 용도 | |
| HK40009561B (en) | A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: CENTOCOR ORTHO BIOTECH INC., PENNSYLVANIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BAKER, AUDREY;NESSPOR, THOMAS;O'NEIL, KARYN;AND OTHERS;REEL/FRAME:024928/0040 Effective date: 20100831 |
|
| FPAY | Fee payment |
Year of fee payment: 4 |
|
| FEPP | Fee payment procedure |
Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.) |
|
| LAPS | Lapse for failure to pay maintenance fees |
Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
| STCH | Information on status: patent discontinuation |
Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362 |
|
| FP | Expired due to failure to pay maintenance fee |
Effective date: 20181012 |