US20200306301A1 - Polynucleotides Encoding Immunostimulatory Fusion Molecules and Uses Thereof - Google Patents
Polynucleotides Encoding Immunostimulatory Fusion Molecules and Uses Thereof Download PDFInfo
- Publication number
- US20200306301A1 US20200306301A1 US16/628,363 US201816628363A US2020306301A1 US 20200306301 A1 US20200306301 A1 US 20200306301A1 US 201816628363 A US201816628363 A US 201816628363A US 2020306301 A1 US2020306301 A1 US 2020306301A1
- Authority
- US
- United States
- Prior art keywords
- immune cell
- molecule
- cell
- cytokine
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- BEMZOXCMCMCTHY-UHFFFAOYSA-N O=C(OCCSSCCOC(=O)ON1C(=O)CCC1=O)ON1C(=O)CCC1=O Chemical compound O=C(OCCSSCCOC(=O)ON1C(=O)CCC1=O)ON1C(=O)CCC1=O BEMZOXCMCMCTHY-UHFFFAOYSA-N 0.000 description 3
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
- C12N5/12—Fused cells, e.g. hybridomas
- C12N5/16—Animal cells
- C12N5/163—Animal cells one of the fusion partners being a B or a T lymphocyte
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/208—IL-12
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2086—IL-13 to IL-16
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4203—Receptors for growth factors
- A61K40/4204—Epidermal growth factor receptors [EGFR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4231—Cytokines
- A61K40/4234—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4244—Enzymes
- A61K40/4252—Phosphatases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4271—Melanoma antigens
- A61K40/4273—Glycoprotein 100 [Gp100]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6813—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin the drug being a peptidic cytokine, e.g. an interleukin or interferon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5434—IL-12
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5443—IL-15
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/76—Albumins
- C07K14/765—Serum albumin, e.g. HSA
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2812—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2815—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2839—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily
- C07K16/2845—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily against integrin beta2-subunit-containing molecules, e.g. CD11, CD18
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/289—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD45
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/88—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation using microencapsulation, e.g. using amphiphile liposome vesicle
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0637—Immunosuppressive T lymphocytes, e.g. regulatory T cells or Treg
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/23—Interleukins [IL]
- C12N2501/2315—Interleukin-15 (IL-15)
Definitions
- the present disclosure relates generally to polynucleotides encoding immunostimulatory fusion molecule engineered to comprise an immune stimulating moiety and an immune cell targeting moiety. Methods for making and using the same are also provided.
- Cytokines participate in the regulation of the immune system. When used in cancer therapy, cytokines can act as immunomodulatory agents that have anti-tumor effects and which can increase the immune response towards some types of tumors.
- cytokines can act as immunomodulatory agents that have anti-tumor effects and which can increase the immune response towards some types of tumors.
- rapid blood clearance and lack of tumor specificity require systemic administration of high doses of the cytokine in order to achieve a concentration of the cytokine at the tumor site and other relevant tissues (e.g., lymph nodes and spleen) sufficient to activate an immune response or have an anti-tumor effect.
- relevant tissues e.g., lymph nodes and spleen
- cytokine compositions with improved properties, e.g., having greater therapeutic effectiveness and a reduction in the number and severity of the side effects of these products (e.g., toxicity, destruction of non-tumor cells, among others).
- the present disclosure provides, inter alia, one or more polynucleotides encoding an immunostimulatory fusion molecule (IFM; used interchangeably with “tethered fusion”) comprising an immune stimulating moiety and an immune cell targeting moiety.
- IFN immunostimulatory fusion molecule
- composition comprising: (a) one or more engineered polynucleotides comprising mRNA, wherein the one or more engineered polynucleotides encode a fusion protein comprising a cytokine or growth factor molecule, or variant thereof, operably linked by a peptide linker to an immune cell targeting moiety comprising a full or partial binding site for a cell surface antigen on a target immune cell, and (b) the target immune cell.
- At least one of the one or more engineered polynucleotides further further comprises a sequence encoding a signal peptide.
- the mRNA is a modified mRNA.
- the one or more engineered polynucleotides comprise non-integrating RNA.
- a further aspect relates to a method of inducing transient gene expression in an immune cell comprising contacting a target immune cell with an effective amount of a first composition comprising one or more engineered polynucleotides comprising mRNA, wherein the one or more engineered polynucleotides encode a fusion protein comprising a cytokine or growth factor molecule, or variant thereof, operably linked by a peptide linker to an immune cell targeting moiety comprising a full or partial binding site for a cell surface antigen on the target immune cell, under conditions suitable to introduce the polynucleotides into the immune cell.
- the contacting occurs in vivo or ex vivo.
- the immune cell has the cell surface antigen expressed or otherwise displayed on its surface.
- the one or more engineered polynucleotides are introduced into the immune cell by lipofection, by electroporation, by nucleoporation, by hydrodynamic shock, or in nanoparticles.
- the contacting occurs in vivo or ex vivo.
- the method further includes contacting the immune cell with an effective amount of a second composition comprising one or more engineered polynucleotides under conditions suitable to introduce the one or more engineered polynucleotides of the second composition into the immune cell.
- the second composition comprises one or more engineered polynucleotides that together encode one or more of a cytokine molecule, growth factor molecule, co-stimulatory molecule, and a variant of any of the foregoing.
- the one or more engineered polynucleotides of first composition and the one or more engineered polynucleotides of the second composition are co-transfected into immune cell.
- Another aspect relates to a modified immune cell comprising:
- an immune cell having an one or more engineered polynucleotides transfected therein,
- the immune cell is a healthy and/or non-malignant immune cell, lymphocyte, or T cell.
- the cytokine molecule is selected from one or more of IL-15, IL-2, IL-6, IL-7, IL-12, IL-18, IL-21, IL-23, or IL-27. In some embodiments, the cytokine molecule is IL-12 and/or IL-15.
- the immune cell targeting moiety is selected from an antibody or antigen-binding fragment thereof, a non-antibody scaffold, or a ligand that binds to the immune cell surface receptor, wherein the immune cell surface receptor is selected from one or more of CD45, CD4, CD8, CD3, CD11a, CD11b, CD11c, CD18, CD25, CD127, CD19, CD20, CD22, HLA-DR, CD197, CD38, CD27, CD196, CXCR3, CXCR4, CXCR5, CD84, CD229, CCR1, CCR5, CCR4, CCR6, CCR8, CCR10, CD16, CD56, CD137, OX40, or GITR.
- CD45 CD4, CD8, CD3, CD11a, CD11b, CD11c, CD18, CD25, CD127, CD19, CD20, CD22, HLA-DR, CD197, CD38, CD27, CD196, CXCR3, CXCR4, CXCR5, CD84, CD229, CCR1, CCR5, C
- the immune cell targeting moiety comprises an antibody or antigen-binding fragment thereof that binds to CD45.
- the fusion molecule further comprises a linker for operably linking the immune cell targeting moiety and the cytokine molecule.
- the immune cell further comprises a fusion molecule bound on the surface of the immune cell, the fusion molecule comprising a cytokine or growth factor molecule, or variant thereof, operably linked to an immune cell targeting moiety having an affinity with a cell surface antigen expressed by or otherwise displayed on the immune cell.
- the cytokine or growth factor molecule, or variant thereof, encoded by the one or more engineered polynucleotides is different than the cytokine or growth factor molecule, or variant thereof, of the fusion molecule bound on the surface of the immune cell. In some embodiments, the cytokine or growth factor molecule, or variant thereof, encoded by the one or more engineered polynucleotides is the same as the cytokine or growth factor molecule, or variant thereof, of the fusion molecule bound on the surface of the immune cell. In some embodiments, the immune cell targeting moiety encoded by the one or more engineered polynucleotides is different than the immune cell targeting moiety of the fusion molecule bound on the surface of the immune cell. In some embodiments, the immune cell targeting moiety or encoded by the one or more engineered polynucleotides is the same as the immune cell targeting moiety of the fusion molecule bound on the surface of the immune cell.
- Also provided herein is a method for preparing the modified immune cell disclosed herein, comprising transfecting the one or more engineered polynucleotides into the immune cell.
- Also provided herein is a method of providing a cell therapy, comprising administering a plurality of the modified immune cells disclosed herein to a subject in need thereof. Use of the modified immune cells for providing a cell therapy are also disclosed herein.
- a further aspect relates to a method for the treatment of cancer in a subject, the method comprising administering to the human subject a composition comprising one or more engineered polynucleotides disclosed herein in a format and under conditions suitable for in vivo transfection of T cells and subsequent expression of the cytokine or growth factor molecule, or variant thereof, encoded by the one or more engineered polynucleotides; wherein the cytokine or growth factor molecule, or variant there, expressed by the one or more engineered polynucleotides acts in vivo upon the transfected T cells and/or other immune cells in the subject to stimulate an immune response against the cancer.
- the expression of the cytokine or growth factor molecule, or variant thereof, is transiently expressed.
- the administration is performed intravenously or by intratumoral injection.
- Another aspect relates to a method for the treatment of cancer in a subject, the method comprising:
- a cell therapeutic composition comprising a population of T cells that home to a cancer cell or a tissue in which cancer cells exist, wherein the T cells are modified by a plurality of immunostimulatory fusion molecules, each fusion molecule comprising (i) an immunostimulatory cytokine or growth factor molecule; and (ii) an immune cell targeting moiety having an affinity to cell surface antigen on the T cells, wherein the plurality of immunostimulatory fusion molecules are bound to the surface of the T cells, and
- composition comprising a one or more engineered polynucleotides according to claim 1 in a format and under conditions suitable for in vivo transfection of the modified T cells administered in step (a) and subsequent expression of the cytokine or growth factor molecule encoded by the one or more engineered polynucleotides,
- cytokine and/or growth factor molecules of the cell therapeutic composition administered in step (a) and/or expressed by the one or more engineered polynucleotides administered in step (b) act in vivo upon the population of T cells and/or other immune cells in the subject to stimulate an immune response against the cancer.
- composition e.g., engineered polynucleotides and/or modified immune cells
- composition for the treatment of cancer.
- an immunostimulatory fusion molecule comprising:
- an immune cell targeting moiety comprising an antigen-binding fragment of an antibody having an affinity to an antigen on the surface of a target immune cell
- immunostimulatory cytokine molecule is operably linked to the antigen-binding fragment.
- an immunostimulatory fusion molecule comprising:
- an immune cell targeting moiety comprising an antibody having an antigen-binding site specific for an antigen on the surface of a target immune cell, wherein the antibody comprises a light chain having a C-terminus and an N-terminus, and a heavy chain having a C-terminus and an N-terminus, wherein the light chain is linked to the heavy chain by a disulfide bond,
- immunostimulatory cytokine molecule is operably linked to the antibody at the C-terminus of the light chain, the N-terminus of the light chain, or the N-terminus of the heavy chain portion.
- an immunostimulatory fusion molecule comprising:
- a T cell targeting moiety comprising a Fab fragment having an antigen-binding site specific for a CD45 cell surface receptor
- Fab fragment and the IL-12 molecule are operably linked together as a fusion molecule.
- the immune cell targeting moiety targets a T cell selected from an effector T cell, a CD4+ T cell, a CD8+ T cell, and a CTL.
- the antigen is a CD45 receptor expressed on the cell surface of the T cell.
- the immune cell targeting moiety comprises a Fab fragment, F(ab′)2, Fv, a single chain Fv of anti-CD45 antibodies BC8, 4B2, GAP8.3 or 9.4, or humanized version of any of the foregoing.
- the immunostimulatory cytokine molecule comprises an IL-12, a single chain IL-12, a subunit of IL-12, or a variant form any of the foregoing.
- the immunostimulatory fusion molecule can further include a single-chain Fv having an affinity to an antigen on the surface of the target immune cell, wherein optionally the single-chain Fv has an affinity to the same antigen as the antigen-binding fragment. In some embodiments, the single-chain Fv has an affinity to a different antigen than the antigen-binding fragment.
- the antigen-binding fragment is a Fab fragment, which optionally comprises a light chain and a heavy chain fragment optionally linked by a disulfide bond, and wherein the immunostimulatory cytokine molecule is operably linked to the Fab fragment at a C-terminus of the light chain, an N-terminus of the light chain, a C-terminus of the heavy chain fragment, or an N-terminus of the heavy chain fragment.
- the immunostimulatory cytokine molecule is operably linked to the antigen-binding fragment by a linker.
- the linker is selected from a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, and a non-helical linker, e.g., a peptide linker comprising a Gly and a Ser.
- the peptide linker is a (GGGS) N (SEQ ID NO: 124) or (GGGGS) N (SEQ ID NO: 125) linker, wherein N indicates the number of repeats of the motif and is an integer selected from 1-10.
- the antigen-binding fragment has an affinity to a CD45 receptor and comprises:
- the cytokine molecule comprises an IL-12 molecule having an amino acid sequence corresponding to the amino acid sequence shown in SEQ ID NO: 50, or an amino acid sequence at least 85%, 90%, 95%, or higher identity to the cytokine portion of SEQ ID NO: 50.
- the cytokine molecule comprises a single-chain IL-12 molecule having an IL-12A subunit linked to an IL-12B subunit through a linker having an amino acid sequence corresponding to the amino acid sequence shown in SEQ ID NO: 70, or an amino acid sequence at least 85%, 90%, 95%, or higher identity to the cytokine portion of SEQ ID NO: 70.
- the linker comprises a peptide linker having an amino acid sequence corresponding to the amino acid sequence in SEQ ID NO: 36, or an amino acid sequence at least 85%, 90%, 95%, or higher identity to the cytokine portion of SEQ ID NO: 36.
- the single-chain Fv has an amino acid sequence corresponding to the Fv portion of SEQ ID NO: 80, or an amino acid sequence at least 85%, 90%, 95%, or higher identity to the Fv portion of SEQ ID NO: 80.
- the Fab fragment comprises a light chain having a variable domain (VL) and a constant domain (CL) and a heavy chain fragment having a variable domain (VH) and a constant domain (CH1), wherein the light chain and heavy chain fragment are optionally linked by a disulfide bond, and wherein the light chain and heavy chain fragment each comprise a C-terminus and an N-terminus.
- the IL-12 molecule is operably linked to the C-terminus or the N-terminus of the light chain or the heavy chain fragment.
- the immunostimulatory fusion molecule further comprises a peptide linker having a first terminus fused to the IL-12 molecule and a second terminus is fused to the Fab fragment, thereby operably linking the IL-12 molecule and the Fab fragment.
- Also provided herein is an isolated nucleic acid molecule encoding any one of the immunostimulatory fusion molecule disclosed herein.
- Also provided herein is a vector comprising one or more nucleic acids encoding a polypeptide corresponding to the amino acid sequence of SEQ ID NO: 36, 50, 70, 79, 80, or 82, or an amino acid sequence at least 85%, 90%, 95%, or higher identity to SEQ ID NO: 36, 50, 70, 79, 80, or 82.
- Also provided herein is a host cell comprising the nucleic acid molecule or the vector disclosed herein.
- a further aspect relates to a modified immune cell comprising:
- immunostimulatory fusion molecule is bound to the surface of the immune cell through interaction with the cell surface antigen.
- Another aspect relates to a modified immune cell comprising a healthy and/or non-malignant immune cell and the immunostimulatory fusion molecule disclosed herein bound thereto.
- Another aspect relates to a method of preparing modified immune cells, comprising:
- compositions for use in immune cell therapy comprising:
- Another aspect relates to a pharmaceutical composition
- a pharmaceutical composition comprising the immunostimulatory fusion molecule disclosed herein and a pharmaceutically acceptable carrier, excipient, or stabilizer.
- a population of T cells that homes to a cancer cells or a tissue in which cancer cells exist, and wherein the T cells express the cell surface antigen, wherein the plurality of immunostimulatory fusion molecules are bound to the surface of the T cells, and wherein the cytokine molecule acts in vivo upon the population of T cells and/or other immune cells in the human subject to stimulate an immune response against the cancer.
- the population of T cells comprise primary T cells, expanded primary T cells, T cells derived from PBMC cells, T cells derived from cord blood cells, T cells autologous to the human subject, T cells allogeneic to the human subject, genetically-engineered T cells, CAR-T cells, effector T cells, activated T cells, CD8+ T cells, CD4+ T cells, and/or CTLs.
- the cell therapeutic composition is administered to the human subject in a cell therapy course selected from an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, an antigen-trained T cell therapy, or an enriched antigen-specific T cell therapy.
- the immunostimulatory fusion molecule disclosed herein can further include a nanoparticle, a liposome and/or a biodegradable polymer.
- the nanoparticle comprises a protein nanogel, a nucleotide nanogel, a polymer nanoparticle, or a solid nanoparticle.
- the nanoparticle comprises a protein nanogel.
- the nanoparticle optionally comprises at least one polymer, cationic polymer, or cationic block co-polymer on the nanoparticle surface.
- the nanoparticle comprises a nanogel that is cross linked by a reversible linker that is sensitive to redox (disulfide) or pH (hydrolysable groups) or enzymes (proteases).
- composition comprising:
- an immunostimulatory fusion molecule comprising:
- a cytokine molecule selected from one or more of IL-15, IL-2, IL-6, IL-7, IL-12, IL-18, IL-21, IL-23, or IL-27, including;
- an immune cell targeting moiety having an affinity with an immune cell surface receptor on the immune cell, wherein the immune cell targeting moiety is selected from an antibody or antigen-binding fragment thereof, a non-antibody scaffold, or a ligand that binds to the immune cell surface receptor, wherein the immune cell surface receptor is selected from one or more of CD45, CD4, CD8, CD3, CD11a, CD11b, CD11c, CD18, CD25, CD127, CD19, CD20, CD22, HLA-DR, CD197, CD38, CD27, CD196, CXCR3, CXCR4, CXCR5, CD84, CD229, CCR1, CCR5, CCR4, CCR6, CCR8, CCR10, CD16, CD56, CD137, OX40, or GITR;
- cytokine molecule and the immune cell targeting moiety are operably linked together as a fusion molecule.
- the cytokine molecule can comprise IL-15 and/or IL-12.
- the immune cell targeting moiety can comprise an antibody or a ligand that binds to CD45.
- an immunostimulatory fusion molecule comprising:
- cytokine molecule selected from IL-12 and/or IL-15, or an variant form thereof
- an immune cell targeting moiety having an affinity with an immune cell surface receptor on the immune cell, wherein the immune cell targeting moiety is selected from an antibody or antigen-binding fragment thereof, a non-antibody scaffold, or a ligand that binds to the immune cell surface receptor, wherein the immune cell surface receptor is CD45;
- cytokine molecule and the immune cell targeting moiety are operably linked together as a fusion molecule.
- the cytokine molecule is IL-12 and/or IL-15.
- the immune cell targeting moiety can comprise an antibody or antigen-binding fragment thereof that binds to CD45.
- the immune cell is a healthy and/or non-malignant immune cell.
- the IFM can further include a linker for operably linking the targeting moiety and the cytokine molecule.
- the linker can be selected from: a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non-helical linker, preferably a peptide linker that optionally comprises Gly and Ser, wherein preferably the peptide linker is a (GGGS) N or (GGGGS) N linker, wherein N indicates the number of repeats of the motif and is an integer selected from 1-10.
- composition comprising the IFM disclosed herein and a pharmaceutically acceptable carrier, excipient, or stabilizer.
- Another aspect relates to a modified immune cell, comprising a healthy and/or non-malignant immune cell and the IFM disclosed herein bound or targeted thereto.
- a further aspect relates to a method of in vitro preparation of modified immune cells, comprising:
- Another aspect relates to a method of providing a cell therapy, comprising:
- the cell therapy can be used for treating a cancer, preferably a solid tumor cancer or a hematological cancer.
- the solid tumor cancer can be one or more of ovarian cancer, rectal cancer, stomach cancer, testicular cancer, cancer of the anal region, uterine cancer, colon cancer, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell carcinoma of the lung, cancer of the small intestine, cancer of the esophagus, melanoma, Kaposi's sarcoma, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, brain stem glioma, pituitary adenoma, epidermoid cancer, carcinoma of the cervix squamous cell cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the va
- the hematological cancer can be one or more of leukemia (e.g., acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), hairy cell leukemia, acute monocytic leukemia (AMoL), chronic myelomonocytic leukemia (CMML), juvenile myelomonocytic leukemia (JMML), or large granular lymphocytic leukemia), lymphoma (e.g., AIDS-related lymphoma, cutaneous T-cell lymphoma, Hodgkin lymphoma (e.g., classical Hodgkin lymphoma or nodular lymphocyte-predominant Hodgkin lymphoma), mycosis fungoides, non-Hodgkin lymphoma (e.g., B-cell non-Hodgkin lymphoma (e.g., Bur
- the cell therapy can be selected from an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, a tumor infiltrating lymphocyte therapy, an antigen-trained T cell therapy, an enriched antigen-specific T cell therapy or NK cell therapy.
- the plurality of healthy and/or non-malignant immune cells are autologous to the subject.
- the disclosure provides a particle, e.g., a nanoparticle, that comprises an IFM as described herein, e.g., nanoparticle that comprises a protein (e.g., a protein nanogel).
- the particle comprises the same IFM.
- the particle comprises one or more different types of IFM.
- Nanoparticles and methods of making are disclosed in PCT International Application No. PCT/US2017/037249 filed Jun. 13, 2017, e.g., on pages 57-79, which is incorporated herein by reference in its entirety.
- such nanoparticles can be used in connection with the backpack technology as disclosed in, e.g., U.S. Publication No. 2017/0080104, U.S. Pat. No. 9,603,944, U.S. Publication No. 2014/0081012, and PCT Application No. PCT/US2017/037249, each of which is incorporated herein by reference in its entirety.
- the immune stimulating moiety is chosen from a cytokine molecule, an agonist of a costimulatory molecule, or an inhibitor of a negative immune regulator, e.g., an inhibitor of a checkpoint inhibitor.
- the immune stimulating moiety is a cytokine molecule.
- the cytokine molecule includes a cytokine, e.g., includes a cytokine chosen from one or more of IL-2, IL-6, IL-7, IL-9, IL-12, IL-15, IL-18, IL-21, IL-23, or IL-27, including variant forms thereof (e.g., a cytokine derivative, a complex comprising the cytokine molecule with a polypeptide, e.g., a cytokine receptor complex, and other agonist forms thereof).
- the cytokine molecule is an IL-15 molecule.
- the immune stimulating moiety is an agonist of a costimulatory molecule, e.g., a costimulatory molecule chosen from CD137, OX40, CD28, GITR, VISTA, anti-CD40, or CD3.
- the agonist of the immune stimulatory molecule is an agonist antibody molecule against, or an agonist ligand of, CD137, OX40, GITR, CD3, or CD28.
- the immune stimulating moiety is an inhibitor of a negative immune regulator, e.g., an inhibitor of a checkpoint inhibitor, e.g., a checkpoint inhibitor chosen from PD-1, PD-L1, LAG-3, TIM-3, or CTLA-4.
- the inhibitor of the negative immune regulator is an antibody molecule or a ligand.
- the inhibitor of the checkpoint inhibitor e.g., the antibody molecule, binds to and/or inhibits PD-1, PD-L1, LAG-3, TIM-3, or CTLA-4.
- the immune cell targeting moiety is capable of binding to an immune cell surface target, thereby targeting the immune stimulating moiety to the immune cell, e.g., an immune effector cell (e.g., a lymphocyte).
- an immune effector cell e.g., a lymphocyte
- binding of the immune cell targeting moiety to the immune cell surface target is believed to increase the concentration, e.g., the concentration over time, of the immune stimulating moiety, e.g., cytokine molecule, with its corresponding receptor, e.g., a cytokine receptor, on the surface of the immune cell, e.g., relative to the association of the free cytokine molecule with its cytokine receptor.
- the immune cell surface target is abundantly present on the surface of an immune cell (e.g., outnumbers the number of receptors for the cytokine molecule present on the immune cell surface).
- the immune cell targeting moiety can be chosen from an antibody molecule or a ligand molecule that binds to an immune cell surface target, e.g., a target chosen from CD4, CD8, CD11a, CD19, CD20 or CD45.
- the immune cell targeting moiety comprises an antibody molecule or a ligand molecule that binds to CD45.
- the immune cell targeting moiety binds to an immune checkpoint inhibitor, such as PD-1, PD-L1, LAG-3, TIM-3, or CTLA-4.
- an immune checkpoint inhibitor such as PD-1, PD-L1, LAG-3, TIM-3, or CTLA-4.
- the immune cell targeting moiety may bind to, or may bind to and inhibit, the immune checkpoint inhibitor.
- the targeting moiety is believed to specifically deliver and/or increase the concentration of the cytokine molecule to the surface of an immune cell, thereby resulting in one or more of increased localization, distribution and/or enhancing the cell surface availability of the cytokine molecule.
- the IFM does not substantially interfere with the signaling function of the cytokine molecule. Such targeting effect results in localized and prolonged stimulation of proliferation and activation of the immune cells, thus inducing the controlled expansion and activation of an immune response.
- IFMs that include the aforesaid moieties, pharmaceutical compositions thereof and formulations, e.g., nanoparticles that comprise the IFMs (e.g., a protein nanogel as described herein), nucleic acids encoding the same, methods of producing the aforesaid molecules, and methods of treating a disorder, e.g., a cancer, an infectious disorder or an autoimmune disorder, using the aforesaid IFMs and compositions thereof.
- a disorder e.g., a cancer, an infectious disorder or an autoimmune disorder
- the disclosure provides an immunostimulatory fusion molecule (IFM) comprising an immune stimulating moiety (e.g., a cytokine molecule, an agonist of a costimulatory molecule, or an inhibitor of a negative immune regulator), and an immune cell targeting moiety.
- an immune stimulating moiety e.g., a cytokine molecule, an agonist of a costimulatory molecule, or an inhibitor of a negative immune regulator
- the immune stimulating moiety e.g., the cytokine molecule
- the immune cell targeting moiety e.g., directly or indirectly, e.g., via a peptide linker.
- the immune cell targeting moiety of the IFM binds to a surface target, e.g., surface receptor, on an immune cell, e.g., an immune effector cell.
- the IFM associates, e.g., links together, the immune stimulating moiety, e.g., the cytokine molecule, and the immune cell targeting moiety to the immune cell, e.g., the effector immune cell.
- the IFM increases the concentration of the cytokine molecule of the IFM (e.g., the concentration of the cytokine molecule of the IFM over time, e.g., a specified period of time) on the surface of the immune cell.
- the increased concentration of the cytokine molecule of the IFM on the surface of the immune cell results in one or more of: (i) increased localization (e.g., level) of the cytokine molecule of the IFM to the immune cell surface, e.g., relative to the free cytokine molecule; (ii) enhanced cell surface availability (e.g., concentration (e.g., level or amount) and/or duration of exposure) of the cytokine molecule of the IFM, e.g., relative to the free cytokine molecule; (iii) increased cytokine signaling in a targeted population of immune cells, e.g., a population of cells expressing a preselected surface target, e.g., a surface target as described herein, e.g., relative to the free cytokine molecule; (iv) prolongs cytokine signaling in the targeted cell population (e.g., increases the duration of cytokine signaling by at least 8
- the IFM changes, e.g., increases, any of (i)-(vii) to a greater extent than the free cytokine molecule, e.g., by at least 8 hours, e.g., 24 hours.
- the cytokine molecule is an IL-15 molecule as described herein
- the immune cell targeting moiety is an anti-CD45 antibody molecule, e.g., an antibody or antibody fragment that binds to CD45 as described herein.
- the disclosure provides a composition, e.g., an IFM, comprising a cytokine molecule, e.g., an IL-15 molecule, coupled to, e.g., fused to, an immune cell targeting moiety.
- a cytokine molecule e.g., an IL-15 molecule
- the immune cell targeting moiety binds to a target or a receptor on the immune cell.
- the immune cell targeting moiety includes, or is, an antibody molecule, e.g., an antibody or an antibody fragment, e.g., an anti-CD45 antibody molecule (e.g., an IgG, a Fab, scFv), that binds a CD45 receptor on a cell, e.g., an immune cell (e.g., an immune effector cell, such as a lymphocyte).
- an immune cell e.g., an immune effector cell, such as a lymphocyte.
- the composition e.g., an IFM, associates, e.g., links together, the cytokine molecule and the immune cell targeting moiety to the immune cell, e.g., the effector immune cell.
- the anti-CD45 antibody binding to the cell increases the association of the IL-15 molecule with the cell and improves one or more of IL-15 signaling, immunostimulation, over time, e.g., relative to a free IL-15 molecule (an IL-15 molecule not found in the composition).
- the signaling and/or immunostimulation occurs over a period of time, e.g., minutes, hours, days e.g., by at least 8 hours, e.g., 24 hours.
- the disclosure provides a particle, e.g., a nanoparticle, that comprises an IFM as described herein, e.g., nanoparticle that comprises a protein (e.g., a protein nanogel as described herein).
- the particle comprises the same IFM. In other embodiments, the particle comprises one or more different types of IFM.
- compositions e.g., pharmaceutical compositions, comprising the IFMs and/or the particles disclosed herein, are also disclosed.
- the pharmaceutical compositions further include a pharmaceutically acceptable carrier, excipient, or stabilizer.
- the disclosure provides an isolated nucleic acid molecule comprising the nucleotide sequence encoding the IFM disclosed herein, or comprising a nucleotide sequences substantially identical thereto (e.g., at least 95% identical thereto), as well as a vector, e.g., an expression vector, and a host cell comprising the nucleic acid molecule disclosed herein.
- Methods of making, e.g., producing, the IFM disclosed herein are also disclosed.
- the method includes culturing the host cell comprising the nucleic acid molecules disclosed herein, under suitable growth conditions.
- the disclosure provides a method of treating a disorder or condition in a subject, e.g., a human.
- the method includes administering to the subject, in need of treatment, a composition, e.g., an IFM or a particle as described herein, in an amount effective to treat the disorder or condition.
- the disorder is a cancer, e.g., a solid tumor or a hematological cancer.
- the disorder is an infection, e.g., a viral, bacterial or yeast infection.
- the disorder is an autoimmune disorder.
- the compositions disclosed herein can be used alone, or in combination with, but not limited to, cell therapy, and as a combination with chemotherapy or radiotherapy.
- the cell therapy is chosen from an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, a tumor infiltrating lymphocyte therapy, an antigen-trained T cell therapy, or an enriched antigen-specific T cell therapy.
- the disclosure provides a composition, e.g., an IFM and/or a particle disclosed herein, for use in a medicament, e.g., for use in treating a disorder or condition in a subject, e.g., a mammal (e.g., a human).
- a composition e.g., an IFM
- the use of a composition, e.g., an IFM, in the manufacture of a medicament for treating a disorder or condition in a subject, e.g., a mammal (e.g., a human) is disclosed.
- the disorder is a cancer, e.g., a solid tumor or a hematological cancer.
- the disorder is an infection, e.g., a viral (e.g., HIV), bacterial or yeast infection.
- the disorder is an autoimmune disorder.
- the compositions disclosed herein can be used alone, or in combination with, but not limited to, cell therapy, and as a combination with chemotherapy or radiotherapy.
- the cell therapy is chosen from an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, a tumor infiltrating lymphocyte therapy, an antigen-trained T cell therapy, or an enriched antigen-specific T cell therapy.
- the disclosure provides a method of selectively delivering a cytokine molecule, e.g., an IL-15 molecule, to an immune cell in a subject, e.g., a mammal (e.g., a human).
- the method includes administering an IFM as described herein to the subject, wherein the cytokine molecule is selectively delivered to the immune cell.
- the subject herein is in need of a cell-based therapy, e.g., an immune cell therapy.
- a cell therapy chosen from an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, a tumor infiltrating lymphocyte therapy, an antigen-trained T cell therapy, or an enriched antigen-specific T cell therapy.
- the subject is a patient, e.g., a human patient.
- the subject has a disease chosen from cancer, diabetes, an autoimmune disease, allergies or allergic conditions, asthma or a cardiovascular disease.
- the subject is in need of a transplant.
- the IFMs described herein can be administered directly to a subject suffering from the disorder to be treated (e.g., cancer) via e.g., intravenous or subcutaneous administration.
- the immune cell targeting moiety of the IFM delivers the cytokine molecule to the surface of an immune cell, thereby increasing the concentration of the cytokine molecule at the surface of the immune cell.
- the IFM results in one or more of: localizes the distribution and/or enhances the cell surface availability of the cytokine molecule, thereby activating and/or stimulating the immune cell.
- the IFMs described herein can be administered in combination with an immune cell therapy in order to activate and/or stimulate the immune cell therapy either in vivo or in vitro.
- an IFM described herein may be co-administered with a cell based therapy to a subject suffering from the disorder to be treated (e.g., cancer) via e.g., intravenous or subcutaneous administration.
- a cell therapy is pulsed in vitro with an IFM described herein prior to administration.
- the cell therapy is chosen from an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, a tumor infiltrating lymphocyte therapy, an antigen-trained T cell therapy, or an enriched antigen-specific T cell therapy.
- the IFM is a bifunctional or bispecific molecule, e.g., it has at least two different kinds of members, e.g., with different functions and/or binding specificities.
- the IFM comprises, or consists of, the immune stimulating moiety, e.g., the cytokine molecule, and the immune cell targeting moiety, wherein the immune stimulating moiety and the immune cell target moiety bind to two different cell surface targets or receptors in the same or different cells, e.g., one or more immune cells.
- the immune stimulating moiety and the immune cell target moiety bind to two different targets on the same immune cell, e.g., the same immune effector cell.
- a bifunctional or bispecific molecule can further comprise additional moieties, e.g., further binding and/or functional moieties.
- the IFM can be a multifunctional or multispecific molecule, e.g., it is a trifunctional or trispecific, or a tetrafunctional or tetraspecific, fusion molecule.
- the IFM can be represented with the following formula in an N to C terminal orientation: R1-(optionally L1)-R2 or R2-(optionally L1)-R1; wherein R1 comprises an immune cell targeting moiety, L1 comprises a linker (e.g., a peptide linker described herein), and R2 comprises an immune stimulating moiety, e.g., a cytokine molecule.
- R1 comprises an immune cell targeting moiety
- L1 comprises a linker (e.g., a peptide linker described herein)
- R2 comprises an immune stimulating moiety, e.g., a cytokine molecule.
- the immune stimulating moiety e.g., the cytokine molecule
- the immune stimulating moiety can be covalently coupled indirectly, e.g., via a linker to the immune cell targeting moiety.
- the linker is chosen from: a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non-helical linker.
- the linker is a peptide linker.
- the peptide linker can be 5-20, 8-18, 10-15, or about 8, 9, 10, 11, 12, 13, 14, 15-20, 20-25, or 25-30 amino acids long.
- the peptide linker can be 30 amino acids or longer; e.g., 30-35, 35-40, 40-50 50-60 amino acids long.
- the linker comprises the amino acid sequence of SEQ ID NO: 36, 37, 38, or 39, or an amino acid sequence substantially identical thereto (e.g., having 1, 2, 3, 4, or 5 amino acid substitutions).
- the linker comprises an amino acid sequence GGGSGGGS (SEQ ID NO: 37).
- the linker comprises amino acids derived from an antibody hinge region.
- the linker comprises amino acids derived from the hinge regions of IgG1, IgG2, IgG3, IgG4, IgGM, or IgGA antibodies.
- the linker comprises amino acids derived from an IgG hinge region, e.g., an IgG1, IgG2 or IgG4 hinge region.
- the linker comprises a variant amino acid sequence from an IgG hinge, e.g., a variant having one or more cysteines replaced, e.g., with serines.
- the linker comprises DKTHTCPPSCAPE (SEQ ID NO: 126), having one or both cysteines replaced with another amino acid, e.g., a serine.
- the linker comprises amino acids DKTHTSPPSPAP (SEQ ID NO: 38), EPKSSDKTHTSPPSPAPE (SEQ ID NO: 127), or a derivative thereof.
- the linker comprises amino acids derived from an IgG2 hinge region, e.g., amino acids SVESPPSP (SEQ ID NO: 128), ERKSSVESPPSP (SEQ ID NO: 129), or a derivative thereof.
- the linker comprises amino acids derived from an IgG4 hinge region, e.g., amino acids PPSPSSP (SEQ ID NO: 130), ESKYGPPSPSSP (SEQ ID NO: 131), or a derivative thereof.
- the linker is a non-peptide, chemical linker.
- the immune stimulating moiety is covalently coupled to the immune cell targeting moiety by crosslinking.
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
- the immune stimulating moiety is directly covalently coupled to the immune cell targeting moiety, without a linker.
- the immune stimulating moiety and the immune cell targeting moiety of the IFM are not covalently linked, e.g., are non-covalently associated.
- the linker can be a protein or a fragment or derivative thereof, e.g., human albumin or an Fc domain, or a fragment or derivative thereof.
- the immune cell targeting moiety is linked to the N-terminus and the immune stimulating moiety is linked to the C-terminus.
- the linker non-covalently associates the immune cell targeting moiety to the immune stimulating moiety.
- the linker comprises a dimerization domain, e.g., a coiled coil or a leucine zipper.
- Fusion based on other noncovalent interactions can also be used, e.g., using the high affinity of the IL-15/sushi interaction to join two other proteins.
- the immune cell is a nucleated cell, e.g., a nucleated cell as described herein below.
- the immune cell is a population of immune effector cells, e.g., a population of immune effector cells chosen from one or more of: T cells, e.g., CD4 T cells, CD8 T cells, alpha T cells, beta T cells, gamma T cells, and delta T cells; B cells; natural killer (NK) cells; natural killer T (NKT) cells; or dendritic cells.
- T cells e.g., CD4 T cells, CD8 T cells, alpha T cells, beta T cells, gamma T cells, and delta T cells
- B cells natural killer (NK) cells
- natural killer T (NKT) cells natural killer T (NKT) cells
- dendritic cells e.g., the immune effector cell, displays a cell surface receptor that binds the immune cell targeting moiety.
- the immune cell e.g., an immune effector cell, (e.g., an immune cell chosen from a lymphocyte, T cell, B cell, or a Natural Killer cell), or a hematopoietic stem cell).
- the immune cell comprises a lymphocyte.
- the immune cell comprises a T cell.
- the immune cell comprises a B cell.
- the immune cell comprises a Natural Killer (NK) cell.
- the immune cell comprises a hematopoietic stem cell.
- the immune cell is an immune cell (e.g., T cell or NK cell) that comprises, e.g., expresses, a Chimeric Antigen Receptor (CAR), e.g., a CAR that binds to a cancer antigen.
- CAR Chimeric Antigen Receptor
- the immune cell expresses an exogenous high affinity Fc receptor.
- the immune cell comprises, e.g., expresses an engineered T-cell receptor.
- the immune cell is a tumor infiltrating lymphocyte.
- the immune cell is a cytotoxic T cell (e.g., a CD8 T cell).
- the immune cell is a regulatory T-cell (“Treg”).
- the immune cell is an immune cell, e.g., an NK cell, acquired from a patient, e.g., a patient's blood.
- the immune cell is an immune cell, e.g., an NK cell, acquired from a healthy donor.
- the NK cell population is purified, e.g., depleted, of T cells, e.g., allogeneic T cells, before infusion to a patient.
- the immune cell is an immune cell, e.g., an NK cell, from an embryonic stem cell and/or an iPSC cell.
- the immune cell is a cell line, e.g., a stable or an immortalized cell line (e.g., an NK cell immortalized cell line).
- the immune cell is acquired from a patient, e.g., a patient with a hematological cancer, e.g., a leukemia or a lymphoma.
- the immune cell is an NK cell line, e.g., an NK cell line chosen from NK-92 (e.g., ATCC cat. no. CRL-2407), NK-YS, KHYG-1, NKL, NKG, SNK-6, IMC-1, e.g., as described in Klingemann, H. et al.
- the immune cell is an NK92 cell line, e.g., a variant NK92 cell that expresses a high affinity Fc receptor, e.g., Fc gamma RIIIa-expressing cell (e.g., 158V).
- the NK92 cell line comprises a CAR that binds to a cancer antigen, e.g., also as described in Klingemann et al. supra.
- the cytokine molecule of the IFM includes an immunomodulatory cytokine, e.g., a pro-inflammatory cytokine or an anti-inflammatory cytokine.
- the cytokine is a member of the common ⁇ -chain ( ⁇ c) family of cytokines.
- the cytokine molecule comprises a cytokine chosen from one or more of interleukin-15 (IL-15), interleukin-1, e.g., interleukin-1 alpha (IL-1 ⁇ ) or interleukin-1 beta (IL-1 ⁇ ), interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-6 (IL-6), interleukin-7 (IL-7), interleukin-9 (IL-9), interleukin-10 (IL-10), interleukin-12 (IL-12), interleukin-13 (IL-13), interleukin-18 (IL-18), interleukin-21 (IL-21), interleukin-23 (IL-23), interleukin-27 (IL-27), interleukin-35 (IL-35), IFN ⁇ , TNF ⁇ , IFN ⁇ , IFN ⁇ , GM-CSF, or GCSF, including variant forms thereof (e.g., a cytokine derivative, a complex comprising the cytokine,
- the cytokine molecule is a pro-inflammatory cytokine molecule chosen from an IL-1, IL-2, IL-6, IL-12, IL-15, IL-18, IL-21, IL-23, or IL-27 cytokine molecule.
- the cytokine molecule is an anti-inflammatory cytokine molecule chosen from an IL-4, IL-10, IL-13, IL-35 cytokine molecule.
- the cytokine molecule is chosen from IL-2, IL-6, IL-7, IL-12, IL-15, IL-21 or IL-27, including variant forms thereof (e.g., a cytokine derivative, a complex comprising the cytokine molecule with a polypeptide, e.g., a cytokine receptor complex, and other agonist forms thereof, e.g., a non-neutralizing anti-cytokine antibody molecule).
- the cytokine molecule is a superagonist (SA), e.g., as described herein.
- the superagonist can have increased cytokine activity, e.g., by at least 10%, 20%, or 30%, compared to the naturally-occurring cytokine.
- the cytokine molecule is a monomer or a dimer.
- the cytokine molecule further comprises a receptor or a fragment thereof, e.g., a cytokine receptor domain.
- the cytokine molecule comprises a wild type cytokine, e.g., a wild type, e.g., human amino acid sequence. In other embodiments, the cytokine molecule comprises an amino acid sequence substantially identical to the wild-type cytokine sequence, e.g., the human cytokine sequence. In some embodiments, the cytokine molecule comprises an amino acid sequence at least 95% to 100% identical, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to a wild-type cytokine sequence, e.g., a human cytokine sequence.
- substitutions, deletions, or insertions e.g., conservative substitutions
- the cytokine molecule comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to the wild-type cytokine sequence, e.g., the human cytokine sequence.
- cytokine amino acid sequences are disclosed herein, for example, the amino acid of IL-15 is provided as, e.g., SEQ ID NO:10 and SEQ ID NO:40; the amino acid of IL-7 is provided as, e.g., SEQ ID NO:42 and SEQ ID NO:43; the amino acid of IL-21 is provided as, e.g., SEQ ID NO:44 and SEQ ID NO:45; the amino acid of IL-12A is provided as, e.g., SEQ ID NO:46 and SEQ ID NO:47; the amino acid of IL-12B is provided as, e.g., SEQ ID NO:48 and SEQ ID NO:49; exemplary fusions of IL-12A and IL-12B are disclosed as e.g., SEQ ID NO:50 and SEQ ID NO:51.
- Any of the cytokine sequences disclosed herein and substantially identical sequences e.g., at least 90%, 95% or higher sequence identity
- the cytokine molecule is an IL-15 molecule.
- the IL-15 molecule (e.g., IL-15 polypeptide molecule) comprises a wild-type IL-15 amino acid sequence, e.g., a human IL-15 amino acid sequence, e.g., includes the amino acid sequence of SEQ ID NO: 10.
- the cytokine molecule is an IL-15 molecule, e.g., a full length, a fragment or a variant of IL-15, e.g., human IL-15, that retains IL-15 activity.
- the IL-15 molecule is a variant of human IL-5, e.g., having one or more amino acid alterations, e.g., substitutions, to the human IL-15 amino acid sequence.
- the IL-15 variant comprises, or consists of, a mutation at position 45, 51, 52, or 72, e.g., as described in US 2016/0184399.
- the IL-15 variant comprises, or consists of, an N, S or L to one of D, E, A Y or P substitution.
- the mutation is chosen from L45D, L45E, S51D, L52D, N72D, N72E, N72A, N72S, N72Y, or N72P (in reference to the sequence of human IL-15, SEQ ID NO: 11).
- the IL-15 molecule comprises an IL-15 variant, e.g., a human IL-15 polypeptide having one or more amino acid substitutions.
- the IL-15 molecule comprises a substitution at position 72, e.g., an N to D substitution.
- the IL-15 molecule is an IL-15N72D polypeptide of SEQ ID NO: 11 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, which has IL-15Ra binding activity.
- the IL-15 molecule comprises a complex of IL-15 (e.g., an IL-15 wild type or variant sequence) and an IL-15 binding fragment of an IL-15 receptor, e.g., IL-15 receptor alpha or an IL-15 binding fragment thereof.
- the IL-15 molecule comprises a complex of the IL-15 and an IL-15 receptor fragment, e.g., an extracellular domain of an IL-15 receptor or a fragment thereof.
- the IL-15 molecule and the IL-15 binding fragment of the IL-15 receptor are not covalently linked, e.g., are non-covalently associated.
- the IL-15 receptor fragment comprises, or consists of, the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 52, or a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., at least 95% identical thereto, or having at least one, two, three, four, five amino acid alterations, but not more than ten, fifteen, twenty alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 52, or a fragment thereof, and having IL-15 binding activity.
- amino acid sequence substantially identical thereto e.g., at least 95% identical thereto, or having at least one, two, three, four, five amino acid alterations, but not more than ten, fifteen, twenty alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 52, or
- the IL-15 molecule comprises a complex of the IL-15 and an IL-15 receptor fragment, e.g., a sushi domain (e.g., as described herein).
- the sushi domain is from human or a non-human animal, e.g., mammal, e.g., non-human primate.
- the sushi domain includes a human sequence, or a substantially identical thereto (e.g., at least 95% identical thereto).
- the extracellular domain of IL-15 Receptor alpha comprises a domain referred to as herein as “the sushi domain,” which binds IL-15.
- the sushi domain is provided as a 62-amino acid referred to herein as a “minimal domain” (e.g., having the amino acid sequence of SEQ ID NO: 52), or a 65-amino acid extended domain (e.g., having the amino acid sequence of SEQ ID NO: 9), or comprises a 77-amino acid domain comprising, e.g., consisting of, amino acids 31-107 or SEQ ID NO: 63.
- minimal domain e.g., having the amino acid sequence of SEQ ID NO: 52
- a 65-amino acid extended domain e.g., having the amino acid sequence of SEQ ID NO: 9
- 77-amino acid domain comprising, e.g., consisting of, amino acids 31-107 or SEQ ID NO: 63.
- the IL-15 receptor fragment has a wild type sequence. In other embodiments, the IL-15 receptor fragment has a mutated sequence, e.g., a substitution at position 77, e.g., an L77I substitution (with the numbering referring to the wild-type IL-15Ra of SEQ ID NO: 4).
- the sushi domain comprises the amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 52, SEQ ID NO: 65, or SEQ ID NO: 66, or an amino acid sequence substantially identical thereto (e.g., at least 95% identical thereto, or having at least one, two, three, four, five amino acid alterations, but not more than ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 52, SEQ ID NO: 65, or SEQ ID NO: 66, and having IL-15 binding activity.
- an amino acid sequence substantially identical thereto e.g., at least 95% identical thereto, or having at least one, two, three, four, five amino acid alterations, but not more than ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 9, SEQ ID NO
- an IL-15 receptor alpha extracellular domain consists of 62-171 amino acids of SEQ ID NO: 63 or an amino acid sequence substantially identical thereto (e.g., at least 95% identical thereto 96%, 97%, 98%, or 99% identity thereto or having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 15 alterations (e.g., substitutions) relative thereto, and having IL-15 binding activity).
- an IL-15 receptor alpha extracellular domain consists of 65-171 amino acids of SEQ ID NO: 63 or an amino acid sequence substantially identical thereto (e.g., at least 95% identical thereto 96%, 97%, 98%, or 99% identity thereto or having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 15 alterations (e.g., substitutions) relative thereto, and having IL-15 binding activity).
- an IL-15 receptor alpha extracellular domain consists of up to 171 amino acids of SEQ ID NO: 63 or an amino acid sequence substantially identical thereto (e.g., at least 95% identical thereto 96%, 97%, 98%, or 99% identity thereto or having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 15 alterations (e.g., substitutions) relative thereto, and having IL-15 binding activity).
- an IL-15 receptor alpha extracellular domain consists of 62-171, 62-160, 62-150, 62-140, 62-130, 62-120, 62-110, 62-100, 62-90, 62-80, 62-70, 65-171, 65-160, 65-150, 65-140, 65-130, 65-120, 65-110, 65-100, 65-90, 65-80, 65-70, or 65-77 amino acids of SEQ ID NO: 63 or a sequence having at least 95% identity thereto 96%, 97%, 98%, or 99% or having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 15 alterations (e.g., substitutions) relative thereto, and having IL-15 binding activity.
- an IL-15 receptor alpha extracellular domain consists of 62-171, 62-160, 62-150, 62-140, 62-130, 62-120, 62-110, 62-100, 62-90, 62-80, 62-70, 65-171, 65-160, 65-150, 65-140, 65-130, 65-120, 65-110, 65-100, 65-90, 65-80, 65-70, or 65-77 amino acids of SEQ ID NO: 63.
- the IFM containing an IL-15 molecule can further comprise a polypeptide, e.g., a cytokine receptor, e.g., a cytokine receptor domain, and a second, heterologous domain.
- the heterologous domain is an immunoglobulin Fc region.
- the heterologous domain is an antibody molecule, e.g., a Fab fragment, a FAB 2 fragment, a scFv fragment, or an affibody fragment or derivative, e.g. a sdAb (nanobody) fragment, a heavy chain antibody fragment.
- the polypeptide also comprises a third heterologous domain.
- the cytokine receptor domain is N-terminal of the second domain, and in other embodiments, the cytokine receptor domain is C-terminal of the second domain.
- the cytokine molecule comprises a complex of a cytokine and an anti-cytokine antibody molecule.
- the cytokine can be IL-2 and the anti-cytokine antibody can be a non-neutralizing anti-IL-2 antibody molecule (see e.g., Spangler, J. B., et al. (2015) www.dx.doi.org/10.1016/j.immuni.2015.04.015; Letourneau, S. et al. (2010) PNAS Vol 107(5): 2171-2176; Boyman, O. et al. (2006) Science 311, 1924); and Spangler, J. B. (2015) Annu Rev Immunol 33:139-167, the contents of which are entirely incorporated by reference).
- the immune cell targeting moiety of the IFM includes an antibody molecule or a ligand that selectively binds to an immune cell surface target, e.g., an immune cell surface receptor.
- the immune cell surface target or receptor can have one, two, three or more of the following properties: (i) is abundantly present on the surface of an immune cell (e.g., outnumbers the number of receptors for the cytokine molecule present on the immune cell surface); (ii) shows a slow downregulation, internalization, and/or cell surface turnover, e.g., relative to the receptors activated by the cytokine of the IFM; (iii) is present on the surface of the immune cell for a prolonged period of time, e.g., relative to the receptors activated by the cytokine of the IFM; or (iv) once internalized is substantially recycled back to the cell surface, e.g., at least 25%, 50%, 60%, 70%, 80%, 90% or more of the immune cell
- the immune cell targeting moiety of the IFM binds to a recycling cell surface receptor.
- binding to the recycling cell surface receptor mediates internalization of the receptor and the IFM.
- the IFM internalized along with the receptor may be sequestered into early endosomes and subsequently recycled back to the cell surface, instead of advancing to subsequent degradation (e.g. via either clathrin-mediated and clathrin-independent endocytosis).
- the return of the IFM/receptor to the cell surface can improve cytokine signaling by restoring the cytokine molecule of the IFM to the cell surface, thus increasing the time and availability of the cytokine molecule to bind its own cell-surface receptor.
- signaling events that are initiated at the surface membrane by binding of a fusion protein of the disclosure may continue from endosomal compartments.
- the immune cell surface target or receptor is present on the surface of an immune cell, but not present on a cancer or tumor cell, e.g., a solid tumor or hematological cancer cell. In some embodiments, the immune cell surface target or receptor is predominantly present on the surface of an immune cell compared to its presence on a cancer or tumor cell, e.g., is present at least 5:1, 10:1, 15:1, 20:1 higher ratio on the immune cell relative to the cancer or tumor cell.
- the immune cell targeting moiety of the IFM binds to a receptor expressed on a cell (e.g., an immune cell), e.g. the surface membrane of the cell, and further the cell also expresses a cytokine receptor (e.g., a receptor to the cytokine molecule of the IFM).
- a cell e.g., an immune cell
- a cytokine receptor e.g., a receptor to the cytokine molecule of the IFM.
- the immune cell targeting moiety of the IFM can be chosen from an antibody molecule or a ligand molecule that binds to an immune cell surface target, e.g., a target chosen from CD16, CD45, CD4, CD8, CD3, CD11a, CD11b, CD11c, CD18, CD25, CD127, CD56, CD19, CD20, CD22, HLA-DR, CD197, CD38, CD27, CD137, OX40, GITR, CD56, CD196, CXCR3, CXCR4, CXCR5, CD84, CD229, CCR1, CCR5, CCR4, CCR6, CCR8, or CCR10.
- a target chosen from CD16, CD45, CD4, CD8, CD3, CD11a, CD11b, CD11c, CD18, CD25, CD127, CD56, CD19, CD20, CD22, HLA-DR, CD197, CD38, CD27, CD137, OX40, GITR, CD56, CD196, CXCR3, CXCR4, C
- the immune cell targeting moiety binds to CD4, CD8, CD11a, CD18, CD20, CD56, or CD45.
- the immune cell surface target is chosen from CD19, CD20, or CD22.
- the immune cell targeting moiety comprises an antibody molecule or a ligand molecule that binds to CD45 (also interchangeably referred to herein as “CD45 receptor” or “CD45R”).
- the target is CD45 (e.g., a CD45 isoform chosen from CD45RA, CD45RB, CD45RC or CD45RO).
- CD45 is primarily expressed on T cells.
- CD45RA is primarily expressed on na ⁇ ve T cells
- CD45RO is primarily expressed on activated and memory T cells.
- the immune cell targeting moiety of the IFM binds a checkpoint inhibitor such as PD-1, PD-L1, LAG-3, TIM-3, or CTLA-4.
- the checkpoint inhibitor is present on an immune effector cell, e.g., a T cell or NK cell.
- the immune cell targeting moiety of the IFM comprises an antibody molecule (e.g., an antigen binding domain), a receptor molecule (e.g., a receptor, a receptor fragment or functional variant thereof), or a ligand molecule (e.g., a ligand, a ligand fragment or functional variant thereof), or a combination thereof, that binds to the immune cell target or receptor.
- an antibody molecule e.g., an antigen binding domain
- a receptor molecule e.g., a receptor, a receptor fragment or functional variant thereof
- a ligand molecule e.g., a ligand, a ligand fragment or functional variant thereof
- the antibody molecule of the immune cell targeting moiety of the IFM comprises a full antibody (e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains), or an antigen-binding fragment (e.g., a Fab, F(ab′)2, Fv, a single chain Fv, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody)) that binds to the immune cell target or receptor.
- a full antibody e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains
- an antigen-binding fragment e.g., a Fab, F(ab′)2, Fv, a single chain Fv, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or
- the heavy chain constant region of the antibody molecule can be chosen from IgG1, IgG2, IgG3, or IgG4, or a fragment thereof, and more typically, IgG1, IgG2 or IgG4.
- the Fc region of the heavy chain can include one or more alterations, e.g., substitutions, to increase or decrease one or more of: Fc receptor binding, neonatal-Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, complement function, or stabilize antibody formation (e.g., stabilize IgG4).
- the heavy chain constant region for an IgG4 can include a substitution at position 228 (e.g., a Ser to Pro substitution) (see e.g., Angal, S, King, D J, et al. (1993) Mol Immunol 30:105-108 (initially described as S241P using a different numbering system); Owens, R, Ball, E, et al. (1997) Immunotechnology 3:107-116).
- a substitution at position 228 e.g., a Ser to Pro substitution
- the light chain constant region of the antibody molecule can be chosen from the light chain constant regions of kappa or lambda, or a fragment thereof.
- the antibody molecule of the immune cell targeting moiety of the IFM can bind to the target antigen with a dissociation constant of less than about 100 nM, 50 nM, 25 nM, 10 nM, e.g., less than 1 nM (e.g., about 10-100 pM). In embodiments, the antibody molecule binds to a conformational or a linear epitope on the antigen. In certain embodiments, the antigen bound by the antibody molecule of the immune cell targeting moiety is stably expressed on the surface of the immune cell. In embodiments, the antigen is a cell surface receptor that is more abundant on the cell surface relative to a receptor for the cytokine molecule of the IFM on the cell surface.
- the immune cell targeting moiety is chosen from an antibody molecule (e.g., a full antibody (e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains), or an antigen-binding fragment (e.g., a Fab, F(ab′)2, Fv, a single chain Fv, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific or multispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody)), or a non-antibody scaffold, or a ligand that binds to an immune cell surface target or ligand.
- an antibody molecule e.g., a full antibody (e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains), or an antigen-binding fragment (e.g., a Fab, F(ab′)2, Fv
- the immune cell targeting moiety is an antibody molecule or a ligand that binds to CD45, CD2, CD4, CD8, CD11 (e.g., CD11a (integrin alpha-L), CD11b, or CD11c), CD18 (integrin beta-2), CD19, CD20, or CD25, or a combination thereof, e.g., a bispecific antibody that binds to two or more of the aforesaid targets.
- CD11 e.g., CD11a (integrin alpha-L), CD11b, or CD11c
- CD18 integratedin beta-2
- CD19 CD20, or CD25, or a combination thereof, e.g., a bispecific antibody that binds to two or more of the aforesaid targets.
- the antibody molecule (e.g., mono- or bi-specific antibodies) binds to one or more of CD45, CD8, CD18 or CD11a, e.g., it is an IgG, e.g., human IgG4, or an antigen binding domain, e.g., a Fab, a F(ab′)2, Fv, a single chain Fv, that binds to CD45, CD8, CD18 or CD11a.
- the antibody molecule is a human, a humanized or a chimeric antibody.
- the antibody molecule is a recombinant antibody.
- the anti-CD45 antibody is a human anti-CD45 antibody, a humanized anti-CD45 antibody, or a chimeric anti-CD45 antibody.
- the anti-CD45 antibody is an anti-CD45 monoclonal antibody.
- Exemplary anti-CD45 antibodies include antibodies BC8, 4B2, GAP8.3 or 9.4.
- Antibodies against other immune cell surface targets are also disclosed, e.g., anti-CD8 antibodies, such as OKT8 monoclonal antibodies, anti-CD18 antibodies, such as 1B4 monoclonal antibodies, and anti-CD11a antibodies, such as MHM24 antibodies.
- antibody molecules having the amino acid sequences disclosed herein, or an amino acid sequence substantially identical thereof), nucleic acid molecules encoding the same, host cells and vectors comprising the nucleic acid molecules.
- the antibody molecule that binds to CD45 is specific to one CD45 isoform or binds to more than on CD45 isoforms, e.g., is a pan-CD45 antibody.
- the anti-CD45 antibody molecule binds to CD45RA and CD45RO.
- the anti-CD45 antibody molecule is a BC8 antibody.
- the BC8 antibody binds to CD45RA and CD45RO.
- the anti-CD45 antibody molecule is CD45RO-specific or is a pan-CD45 antibody molecule, e.g., it binds to activated and memory T cells. Additional examples of anti-CD45 antibody molecules includes, but is not limited to, GAP8.3, 4B2, and 9.4.
- the anti-CD45 antibody molecule is a BC8 antibody, e.g., a chimeric or humanized BC8 antibody.
- the chimeric BC8 antibody comprises:
- the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:1, 2, 3, 4, 7, 21, or 22, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO: 1, 2, 3, 4, 7, 21, or 22); and/or
- the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence or a human IgG4 sequence having an S228P substitution) of the amino acid sequence shown in SEQ ID NO:5, 6, or 8, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NOs: 5, 6, or 8, respectively).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region, and/or the heavy chain variable region, of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 1-4, 7, 21, or 22, or 5-6, or 8.
- the amino acid of SEQ ID NO:1-4, or an amino acid substantially identical thereto includes, optionally via a linker, an IL-15 cytokine or receptor, e.g., a sushi domain as described herein (e.g., SEQ ID NO: 9 or an amino acid substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 9).
- the IL-15 cytokine or receptor is coupled to the N-terminus of the light chain of the BC8 antibody of SEQ ID NO:1-4. In other embodiments, the IL-15 cytokine or receptor is coupled to the C-terminus of the light chain of the BC8 antibody of SEQ ID NO:1-4.
- the linker comprises, or consists of, SEQ ID NO: 37 or 38.
- the amino acid of SEQ ID NO:21 or 22, or an amino acid substantially identical thereto includes, optionally via a linker, an IL-15 cytokine or receptor, e.g., a sushi domain as described herein (e.g., SEQ ID NO: 9 or an amino acid substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 9).
- the IL-15 cytokine or receptor is coupled to the N-terminus of the light chain of the Bc8 antibody of SEQ ID NO:21 or 22 via a linker of SEQ ID NO: 37 or 38. In other embodiments, the IL-15 cytokine or receptor is coupled to the C-terminus of the light chain of the Bc8 antibody of SEQ ID NO:21 or 22 via a linker of SEQ ID NO: 37 or 38.
- the amino acid of SEQ ID NO: 6 or 8, or an amino acid substantially identical thereto includes a heavy chain constant region.
- the amino acid of SEQ ID NO 6 or 8, or an amino acid substantially identical thereto includes an IL-15 cytokine or receptor, e.g., a sushi domain as described herein (e.g., SEQ ID NO: 9 or an amino acid substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 9).
- the IL-15 cytokine or receptor is coupled to the N-terminus of the light chain of the Bc8 antibody of SEQ ID NO:6 or 8.
- the IL-15 cytokine or receptor is coupled to the C-terminus of the light chain of the Bc8 antibody of SEQ ID NO:6 or 8.
- the humanized BC8 antibody comprises:
- the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:19, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO: 19); and/or
- the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence) of the amino acid sequence shown in SEQ ID NO:18, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:18).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region, and/or the heavy chain variable region, of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 18 or 19.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 18 or 19.
- the amino acid sequence of SEQ ID NO:19, or an amino acid sequence substantially identical thereof includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 19, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the amino acid sequence of SEQ ID NO:18, or an amino acid sequence substantially identical thereof includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 18, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the antibody molecule that binds to CD45 is a 9.4 antibody, e.g., a chimeric or humanized 9.4 antibody.
- the chimeric 9.4 antibody comprises:
- the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:15, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:15); and/or
- the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence) of the amino acid sequence shown in SEQ ID NO:14, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 14, respectively).
- the 9.4 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region, and/or the heavy chain variable region, of the 9.4 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO:14 or 15.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO:14 or 15.
- the amino acid sequence of SEQ ID NO:15 includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 15, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the amino acid sequence of SEQ ID NO:14 includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 14, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the antibody molecule that binds to CD45 is a 4B2 antibody, e.g., a chimeric or humanized 4B2 antibody.
- the chimeric 4B2 antibody comprises:
- the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:17, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:17); and/or
- the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence) of the amino acid sequence shown in SEQ ID NO:16, respectively, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 16, respectively).
- the 4B2 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region, and/or the heavy chain variable region, of the 4B2 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO:16 or 17.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO:16 or 17.
- the amino acid sequence of SEQ ID NO:17, or an amino acid sequence substantially identical thereof includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 17, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the amino acid sequence of SEQ ID NO:16 includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 16, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the antibody molecule that binds to CD8 is an OKT8 antibody, e.g., a chimeric or humanized OKT8 antibody.
- the chimeric OKT8 antibody comprises:
- the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:31, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:31); and/or
- the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence) of the amino acid sequence shown in SEQ ID NO:30, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:30).
- the OKT8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region, and/or the heavy chain variable region, of the OKT8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 30 or 31.
- the amino acid sequence of SEQ ID NO:31, or an amino acid sequence substantially identical thereof includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 31, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the amino acid sequence of SEQ ID NO:30 includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 30, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the antibody molecule that binds to CD18 is a 1B4 antibody, e.g., a chimeric or humanized 1B4 antibody.
- the chimeric 1B4 antibody comprises:
- the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:29, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:31); and/or
- the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence) of the amino acid sequence shown in SEQ ID NO:28, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:28).
- the 1B4 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region, and/or the heavy chain variable region, of the 1B4 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 28 or 29.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 28 or 29.
- the amino acid sequence of SEQ ID NO:29 includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 29, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the amino acid sequence of SEQ ID NO:28, or an amino acid sequence substantially identical thereof includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 28, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the antibody molecule that binds to CD11a is an MHM24 antibody, e.g., a chimeric or humanized MHM24 antibody.
- the chimeric MHM24 antibody comprises:
- the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:27, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:27); and/or
- the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence) of the amino acid sequence shown in SEQ ID NO:26, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:26).
- the MHM24 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region, and/or the heavy chain variable region, of the MHM24 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 26 or 27.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 26 or 27.
- the amino acid sequence of SEQ ID NO:27, or an amino acid sequence substantially identical thereof includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 27, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- the amino acid sequence of SEQ ID NO:26 includes an IL-15 cytokine molecule, e.g., an IL-15 cytokine, coupled to the N- or C-terminus of SEQ ID NO: 26, optionally, via a linker (e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- a linker e.g., a linker comprising the amino acid sequence of SEQ ID NO: 36-39, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO: 36-39).
- Exemplary formats for the IFM include a cytokine molecule (e.g., one or more cytokine molecules) coupled to an antibody molecule that binds to an immune cell surface target (e.g., immunoglobulin moiety (Ig), for example an antibody (e.g., a full antibody, IgG) or antibody fragment (Fab, scFv, a half antibody, or a single domain antibody and the like).
- an antibody e.g., a full antibody, IgG
- antibody fragment Fab, scFv, a half antibody, or a single domain antibody and the like
- the IFM includes a fusion to the amino-terminus (N-terminus) or carboxy-terminus (C-terminus) of the antibody molecule, typically, the C-terminus.
- the cytokine molecule can be coupled to the antibody molecule, optionally, via a linker.
- the cytokine or cytokine receptor e.g., receptor fragment (e.g., sushi domain) is coupled to the N-terminus or the C-terminus of the antibody molecule.
- the cytokine or cytokine receptor e.g., receptor fragment (e.g., sushi domain) is coupled to the N-terminus or the C-terminus of the light chain of the antibody molecule (e.g., a full antibody or fragment thereof, e.g., a Fab, a scFv, or a half antibody).
- the cytokine or cytokine receptor e.g., receptor fragment (e.g., sushi domain) is coupled to the N-terminus or the C-terminus of the heavy chain of the antibody molecule (e.g., a full antibody or fragment thereof, e.g., a Fab, a scFv, a half antibody, or a single domain antibody (VH)).
- a full antibody or fragment thereof e.g., a Fab, a scFv, a half antibody, or a single domain antibody (VH)
- VH single domain antibody
- the IFM includes a light chain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti-CD11a, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15, IL-2, IL-6, IL-7, IL-12, IL-21, IL-27, or a cytokine receptor, e.g., IL-15Ralpha sushi domain, at either the N-terminal region or the C-terminal region of the light chain or heavy chain (as depicted in, e.g., FIGS. 1, 2A, 3A-3D, 6A, 11A and 12A . Any combination of orientation of light chain- or heavy chain-cytokine molecule can be present in the IFM.
- anti-CD45 e.g., BC8 antibody
- anti-CD8 antibody anti-CD8 antibody
- the IFM can include a full antibody or a tetramer of two identical half-antibodies, e.g., a first and second antibody, each having a light chain and a heavy chain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti-CD11a, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the N-terminal region of the light chain (e.g., a depicted in FIGS. 3A and 3C )
- the IFM can include a full antibody or a tetramer of two identical half-antibodies, e.g., a first and second antibodies, each having a light chain and a heavy chain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti-CD11a, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the C-terminal region of the light chain (e.g., a depicted in FIGS. 2A, 3A, 3C and 6A ).
- a cytokine molecule e.g., IL-15 or an IL-15 sushi domain
- the IFM can include a full antibody or a tetramer of two identical half-antibodies, e.g., a first and second antibodies, each having a light chain and a heavy chain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti-CD11a, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the C-terminal region of the heavy chain (e.g., a depicted in FIG. 6A ).
- anti-CD45 e.g., BC8 antibody
- anti-CD8 anti-CD18 e.g., anti-CD18
- anti-CD11a that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi
- the IFM can include a full antibody or a tetramer of two identical half-antibodies, e.g., a first and second antibodies, each having a light chain and a heavy chain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti-CD11a, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the N-terminal region of the heavy chain.
- anti-CD45 e.g., BC8 antibody
- anti-CD8 antibody anti-CD8 anti-CD18
- anti-CD11a that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the N-terminal region of the heavy chain.
- the IFM can include an antibody fragment (e.g., a scFv, a Fab) having a light chain variable domain and a heavy chain variable domain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti-CD11a, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the N- or C-terminal region of the heavy chain variable domain (e.g., a depicted in FIGS. 2A, 3B, 3D, 11A, and 12A ).
- an antibody fragment e.g., a scFv, a Fab having a light chain variable domain and a heavy chain variable domain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD
- the IFM can include an antibody fragment (e.g., a scFv, a Fab) having a light chain variable domain and a heavy chain variable domain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti-CD11a, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the N- or C-terminal region of the light chain variable domain.
- an antibody fragment e.g., a scFv, a Fab
- anti-CD45 e.g., BC8 antibody
- anti-CD8 anti-CD18 e.g., CD18
- anti-CD11a e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the N
- the IFM includes a tetramer of two different half-antibodies, e.g., a first and second antibodies, wherein the first antibody has a light chain and a heavy chain (or an fragment thereof, e.g., scFv or Fab) of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti-CD11a, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at the N-terminal region of the light chain; and the second antibody has a light chain and a heavy chain (or an fragment thereof, e.g., scFv or Fab) of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody), anti-CD8, anti-CD18, or anti
- the IFM includes a heavy chain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody) or anti-CD8, that is coupled to, e.g., covalently linked, to a cytokine molecule, e.g., IL-15 or an IL-15 sushi domain, at either the N-terminal region or the C-terminal region of the heavy chain (as depicted in, e.g., FIG. 6A ), and the corresponding light chain.
- the cytokine molecule is covalently linked to the C-terminus of the heavy chain.
- the IFM includes a heavy chain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody) or anti-CD8, that is coupled to, e.g., covalently linked, to a non-cytokine immunostimulatory molecule, e.g., an agonist of an immunostimulatory molecule.
- the immune stimulatory molecule is an agonist of CD137, OX40, GITR, CD3, or CD28.
- the agonist of the immune stimulatory molecule is an antibody molecule or a ligand.
- the agonist of the immune stimulatory molecule is an agonist antibody molecule against CD137, OX40, GITR, CD3, or CD28.
- the immune stimulatory molecule is linked at either the N-terminal region or the C-terminal region of the heavy chain and the corresponding light chain.
- the immunostimulatory molecule is covalently linked to the C-terminus of the heavy chain.
- the IFM includes a heavy chain of the anti-immune cell targeting antibody molecule, e.g., anti-CD45 (e.g., BC8 antibody) or anti-CD8, that is coupled to, e.g., covalently linked, to an inhibitor of a negative immune regulator, e.g., an inhibitor of a checkpoint inhibitor.
- the inhibitor of the negative immune regulator is an inhibitor of a checkpoint inhibitor chosen from PD-1, PD-L1, LAG-3, TIM-3, or CTLA-4.
- the agonist of the immune stimulatory molecule is an antibody molecule or a ligand.
- the inhibitor of the checkpoint inhibitor e.g., the antibody molecule, binds to and/or inhibits PD-1, PD-L1, LAG-3, TIM-3, or CTLA-4.
- the IFM described herein (LC-chBC8-sushi, sushi-LC-chBC8, LC-chBC8-L1-IL15, IL15-LC-chBC8 and HC-chBC8-Fab, HC-chBC8-IgG4S228P) can comprise:
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 1, 2, 3, or 4; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 5 or 6.
- the IFM described herein can comprise:
- the light chain variable amino acid sequence (optionally, further including a constant domain sequence from human kappa) shown in SEQ ID NO:7, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:7), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 7; and
- the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 8, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 8.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 7 or 8.
- the IFM described herein (e.g., HC-ch9.4-Fab and LC-ch9.4-IL15) can comprise:
- amino acid sequence shown in SEQ ID NO:15 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:15), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 15; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 14 or 15.
- the IFM described herein e.g., HC-ch4B2-Fab and LC-ch4B2-IL15
- the IFM described herein can comprise:
- amino acid sequence shown in SEQ ID NO:16 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:16), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 16; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 16 or 17.
- the IFM described herein e.g., HC-hBC8(23)-Fab and LC-hBC8(23)-IL15
- the IFM described herein can comprise:
- amino acid sequence shown in SEQ ID NO:18 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:18), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 18; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 18 or 19.
- the IFM described herein (e.g., HC-chBC8-Fab and LC-chBC8-L2-IL15) can comprise:
- amino acid sequence shown in SEQ ID NO:5 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:5), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 5; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 21 or 5.
- the IFM described herein (e.g., HC-chBC8-Fab and LC-chBC8-L3-IL15) can comprise:
- amino acid sequence shown in SEQ ID NO:5 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:5), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 5; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 22 or 5.
- the IFM described herein (e.g., HC-chMHM24-Fab and LC-chMHM24-IL15) can comprise:
- amino acid sequence shown in SEQ ID NO:26 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:26), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 26; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 26 or 27.
- the IFM described herein e.g., HC-chMHM24-Fab and LC-chMHM24-scIL12p70
- the IFM described herein can comprise:
- amino acid sequence shown in SEQ ID NO:26 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:26), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 26; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 50 or 51 or 26.
- the IFM described herein can comprise:
- amino acid sequence shown in SEQ ID NO:26 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:26), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 26; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 42 or 43 or 26.
- the IFM described herein (e.g., HC-chMHM24-Fab and LC-MHM24-IL15) can comprise:
- amino acid sequence shown in SEQ ID NO:26 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:26), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 26; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 27 or 26.
- the IFM described herein (e.g., HC-ch1B4-Fab and LC-ch1B4-IL15) can comprise:
- amino acid sequence shown in SEQ ID NO:28 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:28), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 28; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 28 or 29.
- the IFM described herein (e.g., HC-chOKT8-Fab and LC-chOKT8-IL15) can comprise:
- amino acid sequence shown in SEQ ID NO:30 or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:30), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO:30; and
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 30 or 31.
- the IFM described herein can comprise the amino acid sequence shown in SEQ ID NO:32, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:32), or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO:32.
- an amino acid sequence substantially identical thereto e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:32
- amino acid alterations e.g., substitutions, deletions, or insertions, e.g., conservative substitutions
- the IFM described herein can comprise an anti-CD45 humanized IgG4 (e.g. humanized BC8) covalently fused to the C-terminus of an anti-CD137 agonist single-chain variable fragment antibody.
- the IFM further includes an additional anti-CD137 scFv on the C-terminus of the IgG4, e.g., thus yielding a molecule that is bi-valent for CD45 and tetravalent for CD137.
- the IFM can also comprise the anti-CD45 IgG4 as stipulated above with scFv anti-CD137 agonist fused exclusively to the C-terminus of the IgG, thus yielding molecule that is bi-valent for CD45 and bi-valent for CD137.
- the IFM described herein can comprise an anti-CD45 humanized IgG1 Fab (e.g. humanized BC8) covalently fused to the N-terminus of anti-CD137 agonist single-chain variable fragment antibodies via the C-terminus of the heavy and light chains of the Fab, thus yielding a molecule that is mono-valent for CD45 and bi-valent for CD137.
- an anti-CD45 humanized IgG1 Fab e.g. humanized BC8 covalently fused to the N-terminus of anti-CD137 agonist single-chain variable fragment antibodies via the C-terminus of the heavy and light chains of the Fab, thus yielding a molecule that is mono-valent for CD45 and bi-valent for CD137.
- the disclosure provides a polymeric scaffold, e.g., a polymeric hydrogel such as poly(lactic-co-glycolic acid) (PLGA), that comprises an IFM as described herein, e.g., hydrogel that comprises an IFM.
- the polymer can also be a polypeptide, chitosan, PVA (polyvinyl alcohol), PLA (polylactic acid), PEG (polyethylene glycol), or block copolymers.
- the polymeric scaffold comprises multiple different polypeptides or polymers.
- the polymeric scaffold comprises one IFM.
- the polymeric scaffold comprises one or more different IFMs.
- the polymeric scaffold is biodegradable.
- the polymeric scaffold can release the IFM over time through passive diffusion and/or through degradation of the polymeric scaffold.
- the polymeric scaffold is formed at least in part by chemical crosslinking, e.g., without limitation, using linkers disclosed herein.
- the polymer can comprise crosslinked polymer networks using covalent crosslinkers or non-covalent interactions (e.g., H-bonds, electrostatic interactions, or van der Waals interactions) between the polymer chains.
- the crosslinker is reversible, for example, without limitation, by altered redox state or altered pH of the environment, e.g. by comprising a disulfide bond or an acid-labile ester group.
- acid-labile linkers may be, for example, a cis-aconitic acid linker, acetals, ketals, activated amides such as amides of 2,3 dimethylmaleamic acid, vinyl ether, other activated ethers and esters such as enol or silyl ethers or esters, imines, iminiums, enamines, carbamates, hydrazones, and other linkages known in the art.
- the polymeric scaffold comprising one or more IFMs is administered to a subject in need thereof. In embodiments the polymeric scaffold comprising one or more IFMs is administered locally (e.g. intratumorally). In embodiments the polymeric scaffold is a liquid that solidifies upon injection or implantation into the body, e.g., with a viscosity increase of 1000 cP or more.
- the disclosure provides a particle, e.g., a nanoparticle, that comprises an IFM as described herein, e.g., nanoparticle that comprises a protein (e.g., a protein nanogel as described herein).
- the particle comprises the same IFM. In other embodiments, the particle comprises one or more different types of IFM.
- a composition herein comprises a particle, e.g., a nanoparticle or a microparticle, or both of a nanoparticle and a microparticle.
- the particle, e.g., nanoparticle has an average hydrodynamic diameter (e.g., measured by dynamic light scattering) between 30 nm and 1200 nm, between 40 nm and 1,100 nm, between 50 nm and 1,000 nm, between such as 50-500 nm, more typically, between 70 and 400 nm.
- the nanoparticle comprises a liposome, a protein nanogel, a nucleotide nanogel, a polymer nanoparticle, or a solid nanoparticle.
- the particle optionally, comprises at least one polymer, cationic polymer, or cationic block co-polymer on the particle surface.
- the nanoparticle comprises a nanogel that is cross linked by a reversible linker that is sensitive to redox (disulfide) or pH (hydrolysable groups) or enzymes (proteases).
- the one or more IFMs disclosed herein can be crosslinked to each other, as provided herein.
- one or more IFMs can be formed or self-assemble into various nanostructures including, without limitation, protein-hydrophilic polymer conjugates (e.g., reversibly modified with PEG), protein-hydrophobic polymer conjugates (e.g., reversibly modified PLA or PLGA), bulk crosslinked protein hydrogels, crosslinked protein nanogel particles, protein nanocapsules with different shell materials (e.g., lipid, polymers or silica), protein-conjugated nanoparticles (e.g., micelle, polymeric nanoparticles, inorganic nanoparticles) and liposomes.
- proteins crosslinked to each other as provided herein, in some embodiments, can be formed or can self-assemble into protein nanostructures.
- the IFM is covalently coupled, e.g., crosslinked, to the protein-hydrophilic polymer of a nanoparticle, e.g., optionally via a degradable linker (e.g., disulfide linker), and remains biologically active, e.g., maintains its function.
- a degradable linker e.g., disulfide linker
- the particle comprising the IFM further comprises a nucleated cell, e.g., an immune cell (also referred to herein as a “nucleated cell-nanoparticle complex”).
- a nucleated cell e.g., an immune cell (also referred to herein as a “nucleated cell-nanoparticle complex”).
- the disclosure provides a composition comprising an IFM and a particle, e.g., a nanoparticle.
- the present disclosure provides a composition comprising a nucleated cell and at least one IFM and/or a particle as described herein.
- the particle is associated with the cell surface by electrostatic attraction to the nucleated cell.
- the nanoparticle comprises at least one ligand, wherein the ligand has affinity for proteins, carbohydrates or lipids on the surface of the nucleated cell.
- the particle is covalently conjugated, e.g., to the surface, of the nucleated cell, e.g., the immune cell.
- the nanoparticle is not covalently conjugated to the nucleated cell.
- the particle can further include one or more additional therapeutic proteins chosen from one or more (e.g., 2, 3, 4, 5 or more) therapeutic proteins, e.g., a cytokine molecule (e.g., an IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, IL-23, IL-4, IL-1alpha, IL-1beta, IL-5, IFNgamma, TNFalpha (TNFa), IFNalpha, IFNbeta, GM-CSF, or GCSF, including variant forms thereof, e.g., mutant; complex comprising the cytokine molecule with a polypeptide, e.g., a cytokine receptor complex; fusion or agonist forms thereof); growth factors; and other molecules, e.g., an antibody molecule or agonist ligand against a costimulatory molecule, e.g., wherein the costimulatory molecule is chosen from CD137, OX40,
- the present disclosure provides a method of making the aforesaid particles.
- FIG. 1 depicts exemplary fusion proteins of the present disclosure combining a cytokine and an immunoglobulin moiety for cell-surface targeting and stimulation.
- FIGS. 2A-2C depict IFMs comprising various antibody formats.
- FIG. 2A depicts a schematic of IL-15 IFMs comprising various antibody formats.
- FIGS. 3A-3D depict a schematic for various fusion strategies between the IL-15/sushi complex and an anti-CD45 antibody.
- FIGS. 3A and 3B depict schematics for fusion of IL-15 to the N- or C-terminus of chBC8 IgG ( FIG. 3A ) or chBC8 Fab ( FIG. 3B ) light-chain.
- Antibody fusions comprise a complex with IL-15R ⁇ -sushi through a high-affinity interaction with IL-15.
- FIGS. 3C and 3D depict schematics for fusion of IL-15R ⁇ -sushi to the N- or C-terminus of chBC8 IgG ( FIG. 3C ) or chBC8Fab ( FIG. 3D ) light-chain.
- Antibody fusions comprise a complex with IL-15 N72D through a high-affinity interaction with IL-15R ⁇ -sushi.
- FIGS. 4A-4B depict the effect of IFMs comprising various fusion strategies on CD8 T cell expansion.
- IFMs comprising IL-15 N72D and chBC8 Fab ( FIG. 4A ) or chBC8 IgG ( FIG. 4B ) were evaluated for T cell expansion in pulse bioassay.
- CD8 T cell proliferation was analyzed using CellTiter Blue; IL15 N72D /sushi L77I -Fc and unstimulated T-cells (neg ctrl) were included for comparison.
- FIGS. 5A-5D depict biological activity of IFMs comprising wild-type or mutated IL-15 and various fusion strategies of IL-15/sushi complex to anti-CD45 antibody.
- FIGS. 5A and 5B depict IFMs comprising wild-type IL-15 or IL-15 N72D and chBC8 Fab ( FIG. 5A ) or chBC8 IgG ( FIG. 5B ) that were evaluated for CD8 T cell expansion in pulse assay using CellTiter Blue three days after pulse incubation with IFMs.
- FIGS. 5C and 5D depict the evaluation of IFMs comprising chBC8 Fab ( FIG. 5C ) or chBC8 IgG ( FIG. 5D ) on CD8 T cell expansion in a constant exposure, e.g., static, assay format using CellTiter Blue following incubation with IFMs for three days.
- FIGS. 6A-6B depict IFMs comprising C-terminal fusion to chBC8 IgG light- or heavy-chain.
- FIG. 6A depicts schematics of IFMs comprising IL-15 fused to the C-terminus of chBC8 IgG light- or heavy-chain and a noncovalent complex between IL-15 and IL-15R ⁇ -sushi.
- FIG. 6B depicts effects of IFMs on CD8 T cell expansion in a pulse bioassay.
- FIGS. 7A-7C depict IFMs require functional binding of the antibody fragment for improved activity.
- FIGS. 8A-8C depict cell surface loading and persistence of IFMs.
- FIG. 8A depicts flow cytometry histograms showing MFI after pulse of IFMs as detected by staining with fluorescently labeled anti-IL15 or anti-IgG antibodies.
- FIG. 8B depicts persistence of cell surface staining of IL-15 over time.
- FIG. 8C depicts cell density over time, measured using flow cytometry counting beads.
- FIG. 9A-9B depict evaluation of IFMs comprising varied linker composition between IL-15 and chBC8.
- FIG. 9A depicts amino acid sequences of the three different linkers for fusion of IL-15 to the C-terminus of chBC8 Fab light-chain.
- FIG. 9B depicts evaluation of IFMs comprising different linker compositions for CD8 T cell expansion in pulse bioassay using CellTiter Blue.
- FIGS. 10A-10B depict evaluation of IFMs comprising alternative CD45 antibody clones.
- FIG. 10A depicts binding affinity of various CD45 antibody clones to CD45 expressed on T cells.
- FIG. 10B depicts evaluation of IL-15 IFMs comprising different anti-CD45 antibody clones in pulse bioassay using CellTiter Blue.
- FIGS. 11A-11B depict IFMs comprising antibodies targeting CD8, CD11a, or CD18.
- FIG. 11A depicts a schematic of IL-15 IFMs comprising fusion of IL-15 to the light-chain C-terminus of a Fab antibody fragment targeting alternative cell surface receptors; IFMs comprise a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- FIG. 11B depicts evaluation of IL-15 IFMs for CD8 T cell expansion in pulse bioassay using CellTiter Blue.
- FIGS. 12A-12B depict evaluation of IFM potency comprising anti-CD8 on CD4 or CD8 T cells.
- FIG. 12A depicts a schematic of IL-15 IFM comprising fusion of IL-15 to the C-terminus of an anti-CD8 Fab light-chain, and a noncovalent association with IL-15R ⁇ -sushi.
- FIG. 12B depicts evaluation of potency of anti-CD8 IFM on purified CD4 or CD8 T cells in pulse bioassay using CellTiter Blue.
- CD4 or CD8 T cells were purified from total T cells (which naturally comprise mixtures of CD4 and CD8 T cells) using magnetic bead sorting.
- FIGS. 13A-13C depict graphs showing that nanoparticles comprising IL-15 IFMs support T cell expansion.
- Backpacks comprising IL-15 IFM or IL15 N72D /sushiL77I-Fc were evaluated for CD8 T cell expansion in pulse bioassay ( FIG. 13C ).
- Cell density was analyzed using flow cytometry counting beads; data are presented as fold expansion.
- FIGS. 14A-14B show priming can improve ACT efficacy.
- FIG. 15 shows example immunotargeted surface receptors and cytokines, illustrating versatility of the platform.
- FIGS. 16A-16E show IL-15 tethered fusions improve tumor-specific T cell therapies in solid tumor models.
- FIGS. 17A-17G show tethered fusion platform enables selective cell targeting and improved expansion of CD8 T cells in cultures of activated total CD3 human T cells by pulse incubation with CD8-targeted IFMs.
- FIGS. 18A-18E shows cellular activities of various mutated forms of IL-15 and surface persistence of IFMs comprising IL-15 mutants.
- FIGS. 19A-19C shows selective cell targeting and CD8 T cell expansion by CD8-targeted IFMs comprising wild-type or mutated IL-15.
- FIG. 20 shows surface persistence of CD45-targeted IFM comprising wild-type or mutated IL-15.
- FIG. 21 shows IL-15 tethered fusion supports persistent signaling downstream of IL-15 receptors.
- FIGS. 22A-22D illustrate 4 exemplary constructs comprising anti-CD45 antibody and IL-12 (also referred to as “anti-CD45-IL12-TF” or “ ⁇ CD45-IL12-TF” or “IL12-TF”).
- IL-12 also referred to as “anti-CD45-IL12-TF” or “ ⁇ CD45-IL12-TF” or “IL12-TF”.
- FIG. 23 show anti-CD45-IL12-TF supports strong cell loading of IL-12 and strong surface persistence.
- FIG. 24 shows that IL-12 tethered fusions induce persistent STAT4 phosphorylation and STAT4 phosphorylation is augmented by combined treatment with IL-12 and IL-15 tethered fusions.
- FIG. 25 shows surface loading and persistence of combinations of IL-15 and IL-21 IFMs.
- FIG. 26 shows surface loading of combinations of CD45-targeted IL-15 and CD8-targeted IL-21 IFMs.
- FIGS. 27A-27B shows STAT5 phosphorylation from combinations of IL-15 and IL-21 IFMs.
- FIG. 28 shows surface loading from combinations of IL-12 and IL-15 IFMs.
- FIG. 29 shows STAT4 phosphorylation from combinations of IL-12 and IL-15 IFMs.
- FIG. 30 shows T cell expansion by combination of a CD45-tethered IL-15-D61H IFM and a CD18-tethered wild-type IL-15 IFM.
- FIG. 31 shows surface loading of IL-12 or IL-15 using various humanized antibodies targeting CD45, CD11a, or CD18.
- FIG. 32 shows surface persistence of mouse T cell tethered IL-12.
- FIG. 33 shows quantification of mouse T cell tethered IL-12.
- FIGS. 34A-34B shows schematic depicting tethered fusions can signal in cis, trans and by transfer to target cells, and shows activation of STAT4 phosphorylation in loaded (“cis”) non-loaded target cells (“trans” and “transferred”) by IL-12 tethered fusion.
- FIG. 35A shows tumor growth, mouse weight change, survival (up to day 100 post ACT).
- FIG. 35B shows Pmel cells carrying a surrogate IL12-TF lead candidate induce transient lymphopenia of transferred and endogenous immune cells.
- FIGS. 35C-35D show proliferation (via KI67 positivity) of circulating endogenous CD8 T cells.
- FIG. 35E shows endogenous NK cell proliferation (via Ki67 positivity) and activation (via CD69 positivity).
- FIG. 36 shows IL12-TF augments tumor-specific T cell therapy when either pre-loaded onto adoptively transferred T cells or when solubly co-administered.
- FIG. 37A shows tumor growth curves following single or multiple doses of tumor-specific T cells carrying IL12-TFs.
- FIG. 37B shows survival from single or multiple doses of tumor-specific T cells carrying IL12-TFs.
- FIG. 37C shows IL12-TFs enhance tumor-specific T cell expansion and engraftment in vivo.
- FIG. 37D shows body weight changes following treatment with one or two doses of tumor-specific T cells carrying IL12-TFs.
- FIG. 38 shows IFN- ⁇ plasma levels following ACT with Pmel carrying one of two IL12-TFs.
- FIG. 39 shows CXCL10 plasma levels following ACT with Pmel carrying one of two IL12-TFs.
- FIGS. 40A-40D shows specific binding of CD8-targeted IFMs comprising wild-type or mutated IL-15 to CD8 T cells in vivo and activity of CD8-targeted IFMs on circulating CD4 T, CD8 T, and NK cells.
- FIGS. 41A-41C shows toxicity of IL-15 following increasing dose or dosing schedule, compared with safety of CD8-targeted IFMs comprising wild-type or mutated IL-15 variants. * indicates after second dosing.
- FIGS. 42A-42B shows anti-tumor efficacy and body weight changes from dose escalation with IL-12, a CD8-targeted IL-12 IFM, or two different CD45-targeted IL-12 IFMs.
- the present disclosure provides, inter alia, compositions and related methods of making and using of immunostimulatory fusion molecules (IFMs) or tethered fusions (TFs).
- An “IFM” or “TF” as described herein includes an immune stimulating moiety, e.g., a cytokine molecule (e.g., a biologically active cytokine), and an immune cell targeting moiety, e.g., an antibody molecule (e.g. an antibody or antibody fragment) capable of binding to an immune cell, e.g., an immune effector cell.
- the immune stimulating moiety and the immune cell targeting moiety are functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise).
- the immune cell targeting moiety is capable of binding to an immune cell surface target, thereby targeting the immune stimulating moiety, e.g., cytokine molecule, to the immune cell, e.g., an immune effector cell (e.g., a lymphocyte).
- an immune stimulating moiety e.g., cytokine molecule
- an immune effector cell e.g., a lymphocyte
- the tethered fusion can be provided by transfecting into the immune cell a polynucleotide encoding the tethered fusion. This can be advantageous for at least several reasons. First, this saves the additional step of expressing the tethered fusion before loading onto the immune cells. Second, the transfected immune cells, once administered as a cell therapy into a patient, can continuously express the tethered fusion from the polynucleotide, thereby providing a more sustained level of the tethered fusion.
- the transfected immune cell can secret the tethered fusions, which, in turn, can bind the transfected immune cell itself (autocrine signaling) and/or bind a neighboring immune cell (paracrine signaling), to achieve dual autocrine and paracrine activity in vivo.
- the polynucleotide can be designed to express and secrete a cytokine molecule, with or without the immune cell targeting moiety.
- a signal peptide for the secretion of the cytokine molecule can be selected and engineered onto the polynucleotide, several suitable signal peptides have been well-described in the art (see, e.g., Stern et al., Improving mammalian cell factories: The selection of signal peptide has a major impact on recombinant protein synthesis and secretion in mammalian cells. Trends Cell Mol Biol. 2007; 2:1-7, incorporated herein by reference in its entirety).
- the polynucleotide includes a plasmid, a cDNA, or an mRNA that can include, e.g., a sequence (e.g., a gene) for expressing a cytokine.
- Suitable plasmids include standard plasmid vectors and minicircle plasmids that can be used to transfer a gene to an immune cell.
- the polynucleotides e.g., plasmids or minicircle plasmids
- the polynucleotides can include promoters, such as general promoters, tissue-specific promoters, cell-specific promoters, and/or promoters specific for the nucleus or cytoplasm.
- the cell-specific promoter is selected from the native promoter for CD3, CD4, CD8, CD19, CD20, CD56, NK1.1, CD11a, CD11b, or CD11c.
- the promoter can be constitutive promoter or inducible (positively or negatively) promoter.
- the promoter can be a promoter associated with T cell activation to couple tethered fusion expression with T cell activation.
- the promoter is selected from the native promoter for PD-1, CD25, CD137, CD69, CD45RO or promoters of other genes upregulated upon T cell activation.
- the promoter is selected from the promoters for CD27, CD62L, or CCR7.
- the promoter can be associated with T cell negative costimulation to transform negative regulatory signals into expression of the tethered fusion. Promoters and plasmids (e.g., minicircle plasmids) are generally well known in the art and can be prepared using conventional techniques.
- the polynucleotides can be used to transfect immune cells.
- transfect, transfected, or transfecting can be used to indicate the presence of exogenous polynucleotides or the expressed polypeptide therefrom in an immune cell, such as a lymphocyte.
- a number of methods and vectors are capable of mediating transfer of polynucleotides to lymphocytes, as is known in the art. Examples include use of viral vectors (see, e.g., Zhang et al. MicroRNA-31 negatively regulates peripherally derived regulatory T-cell generation by repressing retinoic acid-inducible protein 3. Nat. Commun.
- the polynucleotide can be synthetic, e.g., a synthetic mRNA that can be designed and synthesized in vitro using methods known in the art.
- the mRNA sequences can be adapted to the specific needs, improving stability and translation efficiency, which can be controlled or optimized by cis-acting structural elements in the mRNA: the 5′-cap (e.
- a methylated m7GpppN cap g., a methylated m7GpppN cap
- the poly(A)-tail defined length and absence of 3′-terminal ‘masking’ sequences are possible
- untranslated regions and the sequence of the coding region can be optimized for the cellular background and increased stability such as longer half-life in the cell (see, e.g., Kuhn et al. mRNA as a versatile tool for exogenous protein expression. Curr Gene Ther, 12 (2012), pp. 347-361; Petsch et al. Protective efficacy of in vitro synthesized, specific mRNA vaccines against influenza A virus infection. Nat Biotechnol, 30 (2012), pp. 1210-1216; Diken et al.
- nucleotide modifications can be inserted into the mRNA (see Warren et al. Highly efficient reprogramming to pluripotency and directed differentiation of human cells with synthetic modified mRNA. Cell Stem Cell, 7 (2010), pp. 618-630).
- mRNA can be synthesized by in vitro transcription of a cDNA template, such as plasmid DNA, using, e.g., a bacteriophage RNA polymerase. Additional aspect for the design, synthesis, purification, stabilization and delivery can be found in Tolmachov et al. (Nov. 26, 2015) Methods of Transfection with Messenger RNA Gene Vectors, Gene Therapy Doaa Hashad, IntechOpen, DOI: 10.5772/61688; Van der Jeught et al.
- binding of the immune cell targeting moiety to the immune cell surface target is believed to increase the concentration, e.g., the concentration over time, on the surface of the immune stimulating moiety, e.g., cytokine molecule, with its corresponding receptor, e.g., a cytokine receptor, on the immune cell, e.g., relative to the association of the free cytokine molecule with its cytokine receptor.
- This can result in an immune effect on the immune cell itself bound by the IFMs (autocrine signaling), and/or or on another (e.g., neighboring) immune cell (paracrine signaling).
- the tethered fusions of the present disclosure can provide balanced, dual autocrine and paracrine activity, combining the benefits of both sufficiently high activity and low toxicity.
- delivery of soluble cytokines while providing systemic activity is known for its high toxicity.
- Armored CAR-T can locally secrete cytokines that provide paracrine and systemic activity, as well as systemic toxicities.
- Nanogel backpacks such as those described in, e.g., U.S. Publication No. 2017/0080104, U.S. Pat. No. 9,603,944, U.S.
- tethered fusions can signal in cis once tethered (or loaded) onto an immune cell, in trans to a neighboring target immune cell, and by transfer to target immune cells that are not in close proximity to the original backpack-loaded cells.
- the immune cell targeting moiety results in an increase in one or more of: binding, availability, activation and/or signaling of the immune stimulating moiety on the immune cell, e.g., over a specified amount of time.
- the IFM does not substantially interfere with the signaling function of the cytokine molecule.
- Such targeting effect results in localized and prolonged stimulation of proliferation and activation of the immune cells, thus inducing the controlled expansion and activation of an immune response.
- the IFMs disclosed herein offer several advantages over art-known cytokines, including reduced side effects, e.g., a lower systemic toxicity, while retaining the immunostimulatory bioactivity (e.g., signaling activity and/or potency) of the cytokine molecule.
- Prior disclosures of immunocytokines-antibody-cytokine fusion proteins are typically designed to target disease antigens (e.g., tumor associated antigens e.g., cell membrane antigens and extracellular matrix components) via their antibody components in order to potentiate effector functions through their cytokine components.
- disease antigens e.g., tumor associated antigens e.g., cell membrane antigens and extracellular matrix components
- Exemplary barriers to the therapeutic use of cytokines relate to their short serum half-life and limited bioavailability. High doses of cytokines can overcome these barriers, but result in dose-limiting toxicities.
- the present disclosure provides, inter alia, fusion proteins as a covalent conjugate of a cytokine and a targeting moiety which functions to target the fusion protein to an immune cell (e.g., healthy and/or non-malignant) with a particular composition of receptors.
- Fusing a pro-inflammatory cytokine to a targeting moiety preferably an antibody or antibody fragment (e.g. single chain Fv, Fab, IgG), directs the fusion protein to a cell of interest and enhances cell surface availability of the cytokine.
- Cells of interest include, inter alia, immune cells, especially lymphocytes, and preferably T-cells (e.g., total CD3 T cells, CD4 T cells, or CD8 T cells), and can include other cell types.
- the fusion proteins can activate a subset of CD8 T cells.
- Cells of interest including immune cells, can be in vivo (e.g., in a subject), in vitro or ex vivo (e.g., a cell based therapy).
- the immune cell surface target is abundantly present on the surface of an immune cell (e.g., outnumbers the number of receptors for the cytokine molecule present on the immune cell surface).
- the immune cell targeting moiety can be chosen from an antibody molecule or a ligand molecule that binds to an immune cell surface target, e.g., a target chosen from CD4, CD8, CD18, CD11a, CD11b, CD11c, CD19, CD20 or CD45.
- the immune cell targeting moiety comprises an antibody molecule or a ligand molecule that binds to CD45.
- CD45 is an example of an abundant receptor.
- CD45 is also known as leukocyte common antigen, is a type I transmembrane protein present on hematopoietic cells except erythrocytes that assists in cell activation (see e.g., Altin, J G, Immunol Cell Biol. 1997 October; 75(5):430-45)).
- Other receptors of the targeting moiety of the IFM are ideally maintained on the cell surface and are resistant to internalization by the cell (e.g. persistent receptors).
- An example of an abundant and persistent receptor is CD45.
- receptors of the targeting moiety may be constitutively turned over, e.g. internalized by the cell and recycled back to the surface thus allowing significant binding opportunities for the fusion protein, despite their dynamic internalization (recycling receptors).
- CD22 is an example of a recycling receptor.
- cytokine receptors can vary based on a variety of factors, including the (i) cell type, and (ii) the activation state of the cell. In embodiments, the expression level can impact one or more of cytokine signal transduction, signal strength and duration.
- the receptors expressed on the immune cell surface are present in an effective ratio whereby the number of receptors to the targeting moiety is in excess of the number of receptors to the cytokine component, on the cell surface. Such an effective ratio is realized when the targeting moiety receptors are persistent; or alternatively; when their cell surface density is effectively maintained by a recycling mechanism which restores the receptors to the cell's surface and consequently permits binding opportunities for the targeting component in excess of the cytokine component.
- antibody receptors will be present in an effective ratio to allow binding opportunities for the targeting moiety in excess of binding opportunities for the cytokine component of the protein.
- Such an effective ratio allows cytokine localization to the cell surface and consequently increases the time and availability of the cytokine to bind its own cell-surface receptor (despite the dynamic presence, internalization and return to the surface of the targeting receptor).
- endocytosis In some cases, regulation of signaling initiated by plasma membrane receptors is coupled to endocytosis. Internalization of activated receptors is a means for signal attenuation, but also regulates the duration of receptor signaling and signaling output specificity (reviewed in Barbieri, P. P. Di Fiore, S. Sigismund. Endocytic control of signaling at the plasma membrane Curr. Opin. Cell Biol., 39 (2016), pp. 21-27). Endosomes can serve as mobile signaling platforms facilitating formation of multiprotein signaling assemblies and consequently enabling efficient signal transduction in space and time. Some signaling events, e.g. cytokine-signaling events, initiated at the plasma membrane may continue from endosomal compartments.
- IFMs of the disclosure can confer improved biological activity of agonistic cytokines in general, and of IL-15, IL-7, IL-21, and IL-12p70 in particular.
- Other agonistic cytokines include IL-2, IL-6, and IL-27.
- the cytokine molecule includes a pro-inflammatory cytokine, e.g., includes a cytokine chosen from one or more of IL-2, IL-6, IL-7, IL-12, IL-15, IL-21 or IL-27, including variant forms thereof (e.g., a cytokine derivative, a complex comprising the cytokine molecule with a polypeptide, e.g., a cytokine receptor complex, and other agonist forms thereof).
- the cytokine molecule includes IL-15 and/or IL-12 (in one IFM or two IFMs).
- the immune cell targeting moiety of the IFM is derived from an anti-CD45 antibody molecule and the cytokine molecule is interleukin-15 optionally complexed to the sushi domain of the IL-15 receptor alpha subunit ( ⁇ CD45-IL15 and ⁇ CD45-IL15/sushi).
- the immune cell targeting moiety of the IFM is derived from an anti-CD45 antibody molecule and the cytokine molecule is interleukin-12 ( ⁇ CD45-IL12).
- the ⁇ CD45-IL15/sushi IFM and ⁇ CD45-IL12 IFM can be used together in, e.g., a combination therapy.
- the IFMs can be tethered to different cell surface molecules, e.g., an IFM in which the immune cell targeting moiety is derived from an antibody targeting an abundant or persistence cell surface receptor other than CD45, e.g., a target chosen from CD4, CD8, CD18, CD11a, CD11b, CD11c, CD19, or CD20.
- the IFMs can contain cytokines such as interleukin-15 optionally complexed to the sushi domain of the IL-15 receptor alpha subunit and/or interleukin-12.
- the IFMs can be used together in, e.g., a combination therapy with ⁇ CD45-IL15, ⁇ CD45-IL15/sushi, or ⁇ CD45-IL12.
- IFMs comprising additional cytokines tethered to the same or different cell surface receptors are used together, e.g., in a combination therapy.
- the immune cell targeting moiety can be chosen from an antibody molecule or a ligand molecule that binds to an immune cell surface target, e.g., a target chosen from CD4, CD8, CD18, CD11a, CD11b, CD11c, CD19, CD20 or CD45, and a pro-inflammatory cytokine, e.g., includes a cytokine chosen from one or more of IL-2, IL-6, IL-7, IL-12, IL-15, IL-21 or IL-27, including variant forms thereof.
- combinations of two different IFMs are used.
- combinations of three different IFMs are used.
- combinations of more than three IFMs are used.
- Therapeutic uses for the fusion proteins of the disclosure include, inter alia, (1) as agents for specific delivery of therapeutic proteins via receptor mediated binding of receptors unique to specific cells (e.g., CD4 or CD8); (2) as ex vivo agents to induce activation and expansion of isolated autologous and allogenic cells prior to reintroduction to a patient; for example, in T cell therapies including ACT (adoptive cell transfer) and also with other important immune cell types, including for example, B cells, tumor infiltrating lymphocytes, NK cells, antigen-specific CD8 T cells, T cells genetically engineered to express chimeric antigen receptors (CARs) or CAR-T cells, T cells genetically engineered to express T-cell receptors specific to an tumor antigen, tumor infiltrating lymphocytes (TILs), and/or antigen-trained T cells (e.g., T cells that have been “trained” by antigen presenting cells (APCs) displaying antigens of interest, e.g. tumor associated antigens (
- a pharmaceutical composition comprising the IFM of the present disclosure and a pharmaceutically acceptable carrier, excipient, or stabilizer can be used to deliver therapeutic proteins to a subject in need thereof.
- a modified immune cell comprising a healthy and/or non-malignant immune cell and the IFM of the present disclosure bound or targeted thereto, is also provided. Such modified immune cell can be prepared in vitro or in vivo.
- the present disclosure also provides a method of in vitro preparation of modified immune cells, comprising: providing a plurality of healthy and/or non-malignant immune cells; and incubating the IFM of the present disclosure with the plurality of healthy and/or non-malignant immune cells so as to permit targeted binding of the IFM thereto, thereby producing a plurality of modified immune cells.
- Also provided herein is a method of providing a cell therapy comprising: providing a plurality of healthy and/or non-malignant immune cells; incubating the IFM of the present disclosure with the plurality of healthy and/or non-malignant immune cells so as to permit targeted binding of the IFM thereto, thereby producing a plurality of modified immune cells; and administering the plurality of modified immune cells to a subject in need thereof.
- the cell therapy is administered in the absence of pre-conditioning of the subject, wherein said pre-conditioning comprises CPX (cyclophosphamide) or other lymphodepletion conditioning chemotherapy.
- pre-conditioning comprises CPX (cyclophosphamide) or other lymphodepletion conditioning chemotherapy.
- the articles “a” and “an” refer to one or more than one, e.g., to at least one, of the grammatical object of the article.
- the use of the words “a” or “an” when used in conjunction with the term “comprising” herein may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.”
- “about” and “approximately” generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given range of values.
- the term “substantially” means more than 50%, preferably more than 80%, and most preferably more than 90% or 95%.
- compositions, methods, and respective component(s) thereof are used in reference to compositions, methods, and respective component(s) thereof, that are present in a given embodiment, yet open to the inclusion of unspecified elements.
- the term “consisting essentially of” refers to those elements required for a given embodiment. The term permits the presence of additional elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the disclosure.
- compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
- transcription refers to the synthesis of RNA from a DNA template; the term “translation” refers to the synthesis of a polypeptide from an mRNA template.
- Translation in general is regulated by the sequence and structure of the 5′ untranslated region (5′-UTR) of the mRNA transcript.
- 5′-UTR 5′ untranslated region
- RBS ribosome binding site
- the prokaryotic RBS is the Shine-Dalgarno sequence, a purine-rich sequence of 5′-UTR that is complementary to the UCCU core sequence of the 3′-end of 16S rRNA (located within the 30S small ribosomal subunit).
- Various Shine-Dalgarno sequences have been found in prokaryotic mRNAs and generally lie about 10 nucleotides upstream from the AUG start codon.
- Activity of a RBS can be influenced by the length and nucleotide composition of the spacer separating the RBS and the initiator (or start codon) AUG.
- ribosome recruitment is mediated by the 5′ capped mRNA.
- Internal ribosome entry sites can also mediate ribosome recruitment in eukaryotes. These are used by various viruses for mRNA translation and one skilled in the art would be familiar with their use in facilitating heterologous protein expression in eukaryotic hosts.
- the Kozak sequence lies within a short 5′ untranslated region and directs translation of mRNA.
- An mRNA lacking the Kozak consensus sequence may also be translated efficiently in an in vitro system if it possesses a moderately long 5′-UTR that lacks stable secondary structure.
- E. coli ribosome preferentially recognizes the Shine-Dalgarno sequence
- eukaryotic ribosomes can efficiently use either the Shine-Dalgarno or the Kozak ribosomal binding sites.
- promoter refers to a DNA sequence which when ligated to a nucleotide sequence of interest is capable of controlling the transcription of the nucleotide sequence of interest into mRNA.
- a promoter is typically, though not necessarily, located 5′ (i.e., upstream) of a nucleotide sequence of interest whose transcription into mRNA it controls, and provides a site for specific binding by RNA polymerase and other transcription factors for initiation of transcription.
- a promoter may be constitutively active (“constitutive promoter”) or be controlled by other factors such as a chemical, heat or light.
- an “inducible promoter” is induced by the presence or absence or biotic or abiotic factors.
- Commonly used constitutive promoters include CMV, EF1a, SV40, PGK1, Ubc, human beta actin, CAG, AcS, Polyhedrin, TEF1, GDS, ADH1 (repressed by ethanol), CaMV35S, Ubi, H1, U6, T7 (requires T7 RNA polymerase), and SP6 (requires SP6 RNA polymerase).
- Common inducible promoters include TRE (inducible by Tetracycline or its derivatives; repressible by TetR repressor), GAL1 & GAL10 (inducible with galactose; repressible with glucose), lac (constitutive in the absence of lac repressor (Lad); can be induced by IPTG or lactose), T7lac (hybrid of T7 and lac; requires 17 RNA polymerase which is also controlled by lac operator; can be induced by IPTG or lactose), araBAD (inducible by arabinose which binds repressor AraC to switch it to activate transcription; repressed catabolite repression in the presence of glucose via the CAP binding site or by competitive binding of the anti-inducer fucose), trp (repressible by tryptophan upon binding with TrpR repressor), tac (hybrid of lac and trp: regulated like the lac promoter; e.g.
- promoters can further be cell-specific or tissue-specific promoters, or dependent on activation by upstream intracellular signaling molecules.
- tissue-specific, or activation-dependent promoters can drive selective transcription of a protein of interest.
- Common promoters and their sequences are well known in the art.
- promoters have modular architecture and that the modular architecture may be altered.
- Bacterial promoters typically include a core promoter element and additional promoter elements.
- the core promoter refers to the minimal portion of the promoter required to initiate transcription.
- a core promoter includes a Transcription Start Site, a binding site for RNA polymerases and general transcription factor binding sites.
- the “transcription start site” refers to the first nucleotide to be transcribed and is designated +1. Nucleotides downstream of the start site are numbered +1, +2, etc., and nucleotides upstream of the start site are numbered ⁇ 1, ⁇ 2, etc.
- Additional promoter elements are located 5′ (i.e., typically 30-250 bp upstream of the start site) of the core promoter and regulate the frequency of the transcription.
- the proximal promoter elements and the distal promoter elements constitute specific transcription factor site.
- a core promoter usually includes two consensus sequences, a ⁇ 10 sequence or a ⁇ 35 sequence, which are recognized by sigma factors.
- the ⁇ 10 sequence (10 bp upstream from the first transcribed nucleotide) is typically about 6 nucleotides in length and is typically made up of the nucleotides adenosine and thymidine (also known as the Pribnow box). The presence of this box is essential to the start of the transcription.
- the ⁇ 35 sequence of a core promoter is typically about 6 nucleotides in length.
- the nucleotide sequence of the ⁇ 35 sequence is typically made up of the each of the four nucleosides. The presence of this sequence allows a very high transcription rate.
- the ⁇ 10 and the ⁇ 35 sequences are spaced by about 17 nucleotides.
- Eukaryotic promoters are more diverse than prokaryotic promoters and may be located several kilobases upstream of the transcription starting site. Some eukaryotic promoters contain a TATA box, which is located typically within 40 to 120 bases of the transcriptional start site.
- One or more upstream activation sequences (UAS) which are recognized by specific binding proteins can act as activators of the transcription. Theses UAS sequences are typically found upstream of the transcription initiation site. The distance between the UAS sequences and the TATA box is highly variable and may be up to 1 kb.
- the term “vector” refers to any genetic element, such as a plasmid (including microplasmids and miniplasmids), phage, transposon, cosmid, chromosome, artificial chromosome, episome, virus, virion, etc., capable of replication when associated with the proper control elements and which can transfer gene sequences into or between cells.
- the gene sequence is usually operably linked to one or more regulatory sequences, such as promoters, activator/repressor binding sites, terminators, enhancers and the like.
- the promoter sequences can be constitutive, inducible and/or repressible.
- autologous refers to any material derived from the same individual to whom it is later to be re-introduced into the individual.
- allogeneic refers to any material derived from a different animal of the same species as the individual to whom the material is introduced.
- Antibody or “antibody molecule” as used herein refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence.
- An antibody molecule encompasses antibodies (e.g., full-length antibodies) and antibody fragments.
- an antibody molecule comprises an antigen binding or functional fragment of a full length antibody, or a full length immunoglobulin chain.
- a full-length antibody is an immunoglobulin (Ig) molecule (e.g., IgG) that is naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes).
- an antibody molecule refers to an immunologically active, antigen-binding portion of an immunoglobulin molecule, such as an antibody fragment.
- An antibody fragment e.g., functional fragment, is a portion of an antibody, e.g., Fab, Fab′, F(ab′) 2 , F(ab) 2 , variable fragment (Fv), domain antibody (dAb), or single chain variable fragment (scFv).
- a functional antibody fragment binds to the same antigen as that recognized by the intact (e.g., full-length) antibody.
- antibody fragment or “functional fragment” also include isolated fragments consisting of the variable regions, such as the “Fv” fragments consisting of the variable regions of the heavy and light chains or recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker (“scFv proteins”).
- an antibody fragment does not include portions of antibodies without antigen binding activity, such as Fc fragments or single amino acid residues.
- Exemplary antibody molecules include full length antibodies and antibody fragments, e.g., dAb (domain antibody), single chain, Fab, Fab′, and F(ab′) 2 fragments, and single chain variable fragments (scFvs).
- Fab and “Fab fragment” are used interchangeably and refer to a region that includes one constant and one variable domain from each heavy and light chain of the antibody, i.e., V L , C L , V H , and C H 1.
- an “immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
- the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
- the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
- an antibody molecule is monospecific, e.g., it comprises binding specificity for a single epitope.
- an antibody molecule is multispecific, e.g., it comprises a plurality of immunoglobulin variable domain sequences, where a first immunoglobulin variable domain sequence has binding specificity for a first epitope and a second immunoglobulin variable domain sequence has binding specificity for a second epitope.
- an antibody molecule is a bispecific antibody molecule. “Bispecific antibody molecule” as used herein refers to an antibody molecule that has specificity for more than one (e.g., two, three, four, or more) epitope and/or antigen.
- Antigen refers to a macromolecule, including all proteins or peptides.
- an antigen is a molecule that can provoke an immune response, e.g., involving activation of certain immune cells and/or antibody generation. Antigens are not only involved in antibody generation. T cell receptors also recognized antigens (albeit antigens whose peptides or peptide fragments are complexed with an MHC molecule). Any macromolecule, including almost all proteins or peptides, can be an antigen. Antigens can also be derived from genomic recombinant or DNA.
- any DNA comprising a nucleotide sequence or a partial nucleotide sequence that encodes a protein capable of eliciting an immune response encodes an “antigen.”
- an antigen does not need to be encoded solely by a full length nucleotide sequence of a gene, nor does an antigen need to be encoded by a gene at all.
- an antigen can be synthesized or can be derived from a biological sample, e.g., a tissue sample, a tumor sample, a cell, or a fluid with other biological components.
- a “tumor antigen” or interchangeably, a “cancer antigen” includes any molecule present on, or associated with, a cancer, e.g., a cancer cell or a tumor microenvironment that can provoke an immune response.
- an “immune cell antigen” includes any molecule present on, or associated with, an immune cell that can provoke an immune response.
- the “antigen-binding site” or “antigen-binding fragment” or “antigen-binding portion” (used interchangeably herein) of an antibody molecule refers to the part of an antibody molecule, e.g., an immunoglobulin (Ig) molecule such as IgG, that participates in antigen binding.
- the antigen-binding site is formed by amino acid residues of the variable (V) regions of the heavy (H) and light (L) chains.
- hypervariable regions Three highly divergent stretches within the variable regions of the heavy and light chains, referred to as hypervariable regions, are disposed between more conserved flanking stretches called “framework regions” (FRs).
- FRs are amino acid sequences that are naturally found between, and adjacent to, hypervariable regions in immunoglobulins.
- the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface, which is complementary to the three-dimensional surface of a bound antigen.
- the three hypervariable regions of each of the heavy and light chains are referred to as “complementarity-determining regions,” or “CDRs.”
- CDRs complementarity-determining regions
- variable chain e.g., variable heavy chain and variable light chain
- Each variable chain is typically made up of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the amino acid order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
- VL CDRs are generally defined to include residues at positions 27-32 (CDR1), 50-56 (CDR2), and 91-97 (CDR3).
- VH CDRs are generally defined to include residues at positions 27-33 (CDR1), 52-56 (CDR2), and 95-102 (CDR3).
- CDR1 residues at positions 27-33
- CDR2 52-56
- CDR3 95-102
- the loops can be of different length across antibodies and the numbering systems such as the Kabat or Chotia control so that the frameworks have consistent numbering across antibodies.
- the antigen-binding fragment of an antibody can lack or be free of a full Fc domain.
- an antibody-binding fragment does not include a full IgG or a full Fc but may include one or more constant regions (or fragments thereof) from the light and/or heavy chains.
- the antigen-binding fragment can be completely free of any Fc domain.
- the antigen-binding fragment can be substantially free of a full Fc domain.
- the antigen-binding fragment can include a portion of a full Fc domain (e.g., CH2 or CH3 domain or a portion thereof).
- the antigen-binding fragment can include a full Fc domain.
- the Fc domain is an IgG domain, e.g., an IgG1, IgG2, IgG3, or IgG4 Fc domain.
- the Fc domain comprises a CH2 domain and a CH3 domain.
- a “cytokine molecule” refers to full length, a fragment or a variant of a naturally-occurring, wild type cytokine (including fragments and functional variants thereof having at least 10% of the activity of the naturally-occurring cytokine molecule).
- the cytokine molecule has at least 30, 50, or 80% of the activity, e.g., the immunomodulatory activity, of the naturally-occurring molecule.
- the cytokine molecule further comprises a receptor domain, e.g., a cytokine receptor domain, optionally, coupled to an immunoglobulin Fc region. In other embodiments, the cytokine molecule is coupled to an immunoglobulin Fc region.
- the cytokine molecule is coupled to an antibody molecule (e.g., an immunoglobulin Fab or scFv fragment, a Fab fragment, a FAB 2 fragment, or an affibody fragment or derivative, e.g., a sdAb (nanobody) fragment, a heavy chain antibody fragment, single-domain antibody, a bi-specific or multispecific antibody), or non-antibody scaffolds and antibody mimetics (e.g., lipocalins (e.g., anticalins), affibodies, fibronectin (e.g., monobodies or Adnectins), knottins, ankyrin repeats (e.g., DARPins), and A domains (e.g., avimers)).
- an antibody molecule e.g., an immunoglobulin Fab or scFv fragment, a Fab fragment, a FAB 2 fragment, or an affibody fragment or derivative, e.g.,
- cancer as used herein can encompass all types of oncogenic processes and/or cancerous growths.
- cancer includes primary tumors as well as metastatic tissues or malignantly transformed cells, tissues, or organs.
- cancer encompasses all histopathologies and stages, e.g., stages of invasiveness/severity, of a cancer.
- cancer includes relapsed and/or resistant cancer.
- cancer and tumor can be used interchangeably. For example, both terms encompass solid and liquid tumors.
- cancer or tumor includes premalignant, as well as malignant cancers and tumors.
- an “immune cell” refers to any of various cells that function in the immune system, e.g., to protect against agents of infection and foreign matter.
- this term includes leukocytes, e.g., neutrophils, eosinophils, basophils, lymphocytes, and monocytes.
- the term “immune cell” includes immune effector cells described herein.
- Immunune cell also refers to modified versions of cells involved in an immune response, e.g. modified NK cells, including NK cell line NK-92 (ATCC cat. No.
- haNK an NK-92 variant that expresses the high-affinity Fc receptor Fc ⁇ RIIIa (158V)
- taNK targeted NK-92 cells transfected with a gene that expresses a CAR for a given tumor antigen
- Immuno effector cell refers to a cell that is involved in an immune response, e.g., in the promotion of an immune effector response.
- immune effector cells include, but are not limited to, T cells, e.g., CD4T cells, CD8 T cells, alpha T cells, beta T cells, gamma T cells, and delta T cells; B cells; natural killer (NK) cells; natural killer T (NKT) cells; dendritic cells; and mast cells.
- the immune cell is an immune cell (e.g., T cell or NK cell) that comprises, e.g., expresses, a Chimeric Antigen Receptor (CAR), e.g., a CAR that binds to a cancer antigen.
- CAR Chimeric Antigen Receptor
- the immune cell expresses an exogenous high affinity Fc receptor.
- the immune cell comprises, e.g., expresses, an engineered T-cell receptor.
- the immune cell is a tumor infiltrating lymphocyte.
- the immune cells comprise a population of immune cells and comprise T cells that have been enriched for specificity for a tumor-associated antigen (TAA), e.g.
- TAA tumor-associated antigen
- immune cells comprise a population of immune cells and comprise T cells that have been “trained” to possess specificity against a TAA by an antigen presenting cell (APC), e.g. a dendritic cell, displaying TAA peptides of interest.
- APC antigen presenting cell
- the T cells are trained against a TAA chosen from one or more of MART-1, MAGE-A4, NY-ESO-1, SSX2, Survivin, or others.
- the immune cells comprise a population of T cells that have been “trained” to possess specificity against a multiple TAAs by an APC, e.g.
- the immune cell is a cytotoxic T cell (e.g., a CD8 T cell).
- the immune cell is a helper T cell, e.g., a CD4 T cell.
- effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- CTLs Cytotoxic T lymphocytes
- CTL activation can occur when two steps occur: 1) an interaction between an antigen-bound MHC molecule on the target cell and a T cell receptor on the CTL is made; and 2) a costimulatory signal is made by engagement of costimulatory molecules on the T cell and the target cell.
- CTLs then recognize specific antigens on target cells and induce the destruction of these target cells, e.g., by cell lysis.
- the CTL expresses a CAR.
- the CTL expresses an engineered T-cell receptor.
- subject includes living organisms in which an immune response can be elicited (e.g., mammals, human).
- the subject is a patient, e.g., a patient in need of immune cell therapy.
- the subject is a donor, e.g. an allogenic donor of immune cells, e.g., intended for allogenic transplantation.
- compositions and methods of the present disclosure encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
- substantially identical is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
- amino acid sequences that contain a common structural domain having at least about 85%, 90%. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
- nucleotide sequence the term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”.
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences.
- search can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- the molecules of the present disclosure may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
- amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids.
- exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
- amino acid includes both the D- or L-optical isomers and peptidomimetics.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- the term “functional variant” or “variant” or “variant form” in the context of a polypeptide refers to a polypeptide that is capable of having at least 10% of one or more activities of the naturally-occurring sequence.
- the functional variant has substantial amino acid sequence identity to the naturally-occurring sequence, or is encoded by a substantially identical nucleotide sequence, such that the functional variant has one or more activities of the naturally-occurring sequence.
- molecule can refer to a polypeptide or a nucleic acid encoding a polypeptide, as indicated by the context. This term includes full length, a fragment or a variant of a naturally-occurring, wild type polypeptide or nucleic acid encoding the same, e.g., a functional variant, thereof. In some embodiments, the variant is a derivative, e.g., a mutant, of a wild type polypeptide or nucleic acid encoding the same.
- isolated refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
- polypeptide “peptide” and “protein” (if single chain) are used interchangeably herein to refer to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
- nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- the polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.
- parent polypeptide refers to a wild-type polypeptide and the amino acid sequence or nucleotide sequence of the wild-type polypeptide is part of a publicly accessible protein database (e.g., EMBL Nucleotide Sequence Database, NCBI Entrez, ExPasy, Protein Data Bank and the like).
- EMBL Nucleotide Sequence Database NCBI Entrez, ExPasy, Protein Data Bank and the like.
- mutant polypeptide or “polypeptide variant” or “mutein” refers to a form of a polypeptide, wherein its amino acid sequence differs from the amino acid sequence of its corresponding wild-type (parent) form, naturally existing form or any other parent form.
- a mutant polypeptide can contain one or more mutations, e.g., replacement, insertion, deletion, etc. which result in the mutant polypeptide.
- corresponding to a parent polypeptide is used to describe a polypeptide of the present disclosure, wherein the amino acid sequence of the polypeptide differs from the amino acid sequence of the corresponding parent polypeptide only by the presence of at least amino acid variation. Typically, the amino acid sequences of the variant polypeptide and the parent polypeptide exhibit a high percentage of identity. In one example, “corresponding to a parent polypetide” means that the amino acid sequence of the variant polypeptide has at least about 50% identity, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95% or at least about 98% identity to the amino acid sequence of the parent polypeptide.
- the nucleic acid sequence that encodes the variant polypeptide has at least about 50% identity, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95% or at least about 98% identity to the nucleic acid sequence encoding the parent polypeptide.
- introducing (or adding etc.) a variation into a parent polypeptide” or “modifying a parent polypeptide” to include a variation (or grammatical variations thereof) do not necessarily mean that the parent polypeptide is a physical starting material for such conversion, but rather that the parent polypeptide provides the guiding amino acid sequence for the making of a variant polypeptide.
- “introducing a variant into a parent polypeptide” means that the gene for the parent polypeptide is modified through appropriate mutations to create a nucleotide sequence that encodes a variant polypeptide.
- introducing a variant into a parent polypeptide means that the resulting polypeptide is theoretically designed using the parent polypeptide sequence as a guide. The designed polypeptide may then be generated by chemical or other means.
- Cytokines are proteinaceous signaling compounds that are mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis; cytokines are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells, including those of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. Cytokines can be classified into two groups: pro- and anti-inflammatory. Pro-inflammatory cytokines, including IFN- ⁇ , IL-1, IL-6 and TNF- ⁇ , are predominantly derived from the innate immune cells and Th1 cells. Anti-inflammatory cytokines, including IL-10, IL-4, IL-13 and IL-5, are synthesized from Th2 immune cells.
- IFMs e.g., IFM polypeptides
- cytokine molecules e.g., immunomodulatory (e.g., proinflammatory) cytokines and variants, e.g., functional variants, thereof.
- the cytokine molecule is an interleukin or a variant, e.g., a functional variant thereof.
- the interleukin is a proinflammatory interleukin.
- the cytokine molecule is full length, a fragment or a variant of a cytokine, e.g., a cytokine comprising one or more mutations.
- the cytokine molecule comprises a cytokine chosen from interleukin-15 (IL-15), interleukin-1 alpha (IL-1 alpha), interleukin-1 beta (IL-1 beta), interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-7 (IL-7), interleukin-12 (IL-12), interleukin-18 (IL-18), interleukin-21 (IL-21), interleukin-23 (IL-23), interferon (IFN) a, IFN-(3, IFN- ⁇ , tumor necrosis factor alpha, GM-CSF, GCSF, or a fragment or variant thereof, or a combination of any of the aforesaid cytokines.
- IL-15 interleukin-15
- IL-1 alpha inter
- the cytokine molecule is chosen from interleukin-2 (IL-2), interleukin-12 (IL-12), interleukin-15 (IL-15), interleukin-18 (IL-18), interleukin-21 (IL-21), or interferon gamma, or a fragment or variant thereof, or a combination of any of the aforesaid cytokines.
- the cytokine molecule can be a monomer or a dimer.
- the cytokine molecule further comprises a receptor domain, e.g., a cytokine receptor domain.
- the cytokine or growth factor molecule can be a Treg inhibitory molecule selected from one or more of Ifn- ⁇ , IL-1 ⁇ , IL-1 ⁇ , IL-6, IL-12, IL-21, IL-23, IL-27 or TNF- ⁇ .
- Ifn- ⁇ promotes Treg fragility, and can reduce suppression in the tumor microenvironment.
- IL-1 and IL-6, IL-21 and IL-23 can induce Tregs to produce pro-inflammatory IL-17 and/or convert Tregs to Th17 T cell subset.
- IL-12 promotes Ifn- ⁇ production in Tregs, leading Treg fragility and a general pro-immunogenic environment.
- TNF- ⁇ both impairs Treg development and reduces the function of existing Tregs.
- these cytokines can impair Treg development, reduce Treg function or induce Treg trans-differentiation into immune activating cells.
- one or more of the Treg inhibitory cytokines can be delivered systemically via Treg-specific IFMs in order to reduce Treg suppression globally.
- Bi-specific targeting e.g., CD4:CD25, CD4:NRP1, CD4:CD39
- IFMs can be used to direct systemically injected IFMs to the Treg cells in vivo. This concept of targeting a specific cell population is described in the Examples. These IFMs then reduce Treg numbers and/or function, and drive them to a pro-inflammatory or immunogenic state.
- Treg-specific IFMs can be loaded onto anti-tumor immune cells ex vivo and delivered to the Tregs via trans or paracrine signaling.
- the anti-tumor cells create a local anti-suppressive environment by increasing the local concentration of Treg inhibitory cytokines. This can promote local as opposed to global Treg dysfunction.
- the cytokine molecule is an IL-15 molecule, e.g., a full length, a fragment or a variant of IL-15, e.g., human IL-15.
- the IL-15 molecule is a wild-type, human IL-5, e.g., having the amino acid sequence of SEQ ID NO: 10.
- the IL-15 molecule is a variant of human IL-5, e.g., having one or more amino acid modifications.
- the IL-15 variant comprises, or consists of, a mutation at position 45, 51, 52, or 72, e.g., as described in US 2016/0184399.
- the IL-15 variant comprises, or consists of, an N, S or L to one of D, E, A Y or P substitution.
- the mutation is chosen from L45D, L45E, S51D, L52D, N72D, N72E, N72A, N72S, N72Y, or N72P (in reference to the sequence of human IL-15, SEQ ID NO: 11). As those of skill will realize, any combination of the positions can be mutated.
- the IL-15 variant comprises two or more mutations.
- the IL-15 variant comprises three or more mutations.
- the IL-15 variant comprises four, five, or six or more mutations.
- the IL-15 molecule comprises a mutation, e.g., an N72D point mutation as shown in SEQ ID NO: 11 herein.
- the IL-15 molecule comprises a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 11, wherein the sequence comprises an N72D mutation relative to wild-type human IL-15, and having IL-15Ra binding activity.
- the IL-15 variant comprises, or consists of, one or more mutations at amino acid position 8, 10, 61, 64, 65, 72, 101, or 108 (in reference to the sequence of human IL-15, SEQ ID NO: 11).
- the IL-15 variant possesses increased activity as compared with wild-type IL-15.
- the IL-15 variant possesses decreased activity as compared with wild-type IL-15.
- the IL-15 variant possesses approximately two-fold, four-fold, ten-fold, 20-fold, 40-fold, 60-fold, 100-fold, or more than 100-fold decreased activity as compared with wild-type IL-15.
- the mutation is chosen from D8N, K10Q, D61N, D61H, E64H, N65H, N72A, N72H, Q101N, Q108N, or Q108H (in reference to the sequence of human IL-15, SEQ ID NO: 11).
- the IL-15 variant comprises two or more mutations.
- the IL-15 variant comprises three or more mutations.
- the IL-15 variant comprises four, five, or six or more mutations.
- the IL-15 variant comprises mutations at positions 61 and 64.
- the mutations at positions 61 and 64 are D61N or D61H and E64Q or E64H.
- the IL-15 variants comprises mutations at positions 61 and 108.
- the mutations at positions 61 and 108 are D61N or D61H and Q108N or Q108H.
- the cytokine molecule further comprises a receptor domain, e.g., a cytokine receptor domain.
- the cytokine molecule comprises an IL-15 receptor, or a fragment thereof (e.g., an IL-15 binding domain of an IL-15 receptor alpha) as described herein.
- the cytokine molecule is an IL-15 molecule, e.g., IL-15 or an IL-15 superagonist as described herein.
- a “superagonist” form of a cytokine molecule shows increased activity, e.g., by at least 10%, 20%, 30%, compared to the naturally-occurring cytokine.
- An exemplary superagonist is an IL-15 SA.
- the IL-15 SA comprises a complex of IL-15 and an IL-15 binding fragment of an IL-15 receptor, e.g., IL-15 receptor alpha or an IL-15 binding fragment thereof, e.g., as described herein.
- the cytokine molecule further comprises a receptor domain, e.g., an extracellular domain of an IL-15R alpha, optionally, coupled to an immunoglobulin Fc or an antibody molecule.
- the cytokine molecule is an IL-15 superagonist (IL-15SA) as described in WO 2010/059253.
- the cytokine molecule comprises IL-15 and a soluble IL-15 receptor alpha domain fused to an Fc (e.g., a sIL-15Ra-Fc fusion protein), e.g., as described in Rubinstein et al PNAS 103:24 p. 9166-9171 (2006).
- Fc e.g., a sIL-15Ra-Fc fusion protein
- the IL-15 molecule can further comprise a polypeptide, e.g., a cytokine receptor, e.g., a cytokine receptor domain, and a second, heterologous domain.
- the heterologous domain is an immunoglobulin Fc region.
- the heterologous domain is an antibody molecule, e.g., a Fab fragment, a FAB 2 fragment, a scFv fragment, or an affibody fragment or derivative, e.g. a sdAb (nanobody) fragment, a heavy chain antibody fragment.
- the polypeptide also comprises a third heterologous domain.
- the cytokine receptor domain is N-terminal of the second domain, and in other embodiments, the cytokine receptor domain is C-terminal of the second domain.
- Wild-type IL-15 Receptor alpha sequence (Genbank Acc. No. AAI21141.1): SEQ ID NO: 41.
- Wild-type IL-15 Receptor alpha extracellular domain (portion of accession number Q13261): SEQ ID NO: 63.
- Isoform CRA_d IL-15 Receptor alpha extracellular domain portion of accession number EAW86418,: SEQ ID NO: 64.
- IL-15 receptor alpha contains an extracellular domain, a 23 amino acid transmembrane segment, and a 39 amino acid cytoplasmic tail.
- the extracellular domain of IL-15 Receptor alpha is provided as SEQ ID NO: 63.
- an IL-15 agonist can be used.
- an agonist of an IL-15 receptor e.g., an antibody molecule (e.g., an agonistic antibody) to an IL-15 receptor, that elicits at least one activity of a naturally-occurring cytokine.
- the IL-15 receptor or fragment thereof is from human or a non-human animal, e.g., mammal, e.g., non-human primate.
- IL-15 receptor alpha contains an extracellular domain, a 23 amino acid transmembrane segment, and a 39 amino acid cytoplasmic tail.
- the sushi domain has been described in the literature including, e.g., Bergamaschi et al. (2008), JBC VOL. 283, NO. 7, pp. 4189-4199; Wei et al. (2001), Journal of Immunology 167:277-282; Schluns et al. (2004) PNAS Vol 110 (15) 5616-5621; US 2016/0184399 (the contents of each of which is incorporated by reference herein).
- the extracellular domain of IL-15 Receptor alpha is provided as SEQ ID NO: 63.
- the extracellular domain of IL-15 Receptor alpha comprises a domain referred to as the sushi domain, which binds IL-15.
- the general sushi domain also referred to as complement control protein (CCP) modules or short consensus repeats (SCR), is a protein domain found in several proteins, including multiple members of the complement system.
- the sushi domain adopts a beta-sandwich fold, which is bounded by the first and fourth cysteine of four highly conserved cysteine residues, comprising to a sequence stretch of approximately 60 amino acids (Norman, Barlow, et al. J Mol Biol. 1991 Jun. 20; 219(4):717-25).
- amino acid residues bounded by the first and fourth cysteines of the sushi domain in IL-15Ralpha comprise a 62 amino acid polypeptide that we refer to as the minimal domain (SEQ ID NO: 52).
- a sushi domain as described herein may comprise one or more mutations relative to a wild-type sushi domain.
- residue 77 of IL-15Ra is leucine in the wild-type gene (and is underlined in SEQ ID NO: 41), but can be mutated to isoleucine (L77I).
- L77I isoleucine
- SEQ ID NO: 65 a minimal sushi domain comprising L77I (with the numbering referring to the wild-type IL-15Ra of SEQ ID NO: 41) is provided as SEQ ID NO: 65.
- An extended sushi domain comprising L77I is provided as SEQ ID NO: 66.
- Minimal sushi domain wild-type: (SEQ ID NO: 52) CPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATN VAHWTTPSLKC Extended sushi domain, wild-type: (SEQ ID NO: 9) ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKA TNVAHWTTPSLKCIR Minimal sushi domain, L77I: (SEQ ID NO: 65) CPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVINKATN VAHWTTPSLKCI Extended sushi domain, L77I: (SEQ ID NO: 66) ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVINKA TNVAHWTTPSLKCIR
- a sushi domain consists of 62-171 amino acids of SEQ ID NO: 63 or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and having IL-15 binding activity.
- a sushi domain consists of 65-171 amino acids of SEQ ID NO: 63 or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and having IL-15 binding activity.
- a sushi domain consists of up to 171 amino acids of SEQ ID NO: 63 or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and having IL-15 binding activity.
- a sushi domain consists of 62-171, 62-160, 62-150, 62-140, 62-130, 62-120, 62-110, 62-100, 62-90, 62-80, 62-70, 65-171, 65-160, 65-150, 65-140, 65-130, 65-120, 65-110, 65-100, 65-90, 65-80, or 65-70 amino acids of SEQ ID NO: 63 or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and having IL-15 binding activity.
- a sushi domain consists of 62-171, 62-160, 62-150, 62-140, 62-130, 62-120, 62-110, 62-100, 62-90, 62-80, 62-70, 65-171, 65-160, 65-150, 65-140, 65-130, 65-120, 65-110, 65-100, 65-90, 65-80, or 65-70 amino acids of SEQ ID NO: 63.
- the sushi domain comprises, or consists of, an amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 52.
- a sushi domain consists of 62-171 amino acids of SEQ ID NO: 63 or a sequence having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, or 40 modifications (e.g., substitutions) relative thereto, and having IL-15 binding activity.
- a sushi domain consists of up to 171 amino acids of SEQ ID NO: 5 or a sequence having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, or 40 modifications (e.g., substitutions) relative thereto, and having IL-15 binding activity.
- a sushi domain consists of 62-171, 62-160, 62-150, 62-140, 62-130, 62-120, 62-110, 62-100, 62-90, 62-80, 62-70, 65-171, 65-160, 65-150, 65-140, 65-130, 65-120, 65-110, 65-100, 65-90, 65-80, or 65-70 amino acids of SEQ ID NO: 63 or a sequence having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, or 40 modifications (e.g., substitutions) relative thereto, and having IL-15 binding activity.
- a sushi domain comprises at least 62 amino acids of SEQ ID NO: 63 or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, wherein the sequence comprises an L77I mutation relative to wild-type IL-15Ra, and having IL-15 binding activity.
- a sushi domain comprises at least 65 amino acids of SEQ ID NO: 63 or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, wherein the sequence comprises an L77I mutation relative to wild-type IL-15Ra, and having IL-15 binding activity.
- a sushi domain comprises a portion of SEQ ID NO: 63 or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, wherein the sequence comprises an L77I mutation relative to wild-type IL-15Ra, and having IL-15 binding activity.
- the sushi domain comprises an amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 52.
- a sushi domain comprises at least 62 amino acids of SEQ ID NO: 63 or a sequence having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, or 40 modifications (e.g., substitutions) relative thereto, wherein the sequence comprises an L77I mutation relative to wild-type IL-15Ra, and having IL-15 binding activity.
- a sushi domain comprises a portion of SEQ ID NO: 66 or a sequence having up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, or 40 modifications (e.g., substitutions) relative thereto, wherein the sequence comprises an L77I mutation relative to wild-type IL-15Ra, and having IL-15 binding activity.
- the sushi domain comprises at least 10, 20, 30, 40, 50, 60, 62, 65, 70, 80, 90, 100, 110, 120, 130, 140, 150, or 160 consecutive amino acids of SEQ ID NO: 63, or a sequence having an L77I mutation relative thereto.
- the sushi domain consists of 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-110, 110-120, 120-130, 130-140, 140-150, 150-160, or 160-170 consecutive amino acids of SEQ ID NO: 63, or a sequence having an L77I mutation relative thereto.
- the sushi domain is a sushi domain from human or a non-human animal, e.g., mammal, e.g., non-human primate.
- the polypeptide can have a second, heterologous domain, e.g., an Fc domain or a Fab domain.
- the polypeptide comprising the IL-15 receptor or fragment thereof comprises an Fc domain.
- the Fc domain is an effector-attenuated Fc domain, e.g., a human IgG2 Fc domain, e.g., a human IgG2 Fc domain of SEQ ID NO: 54 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the effector-attenuated Fc domain has reduced effector activity, e.g., compared to a wild-type IgG1 Fc domain, e.g., compared to a wild-type IgG1 Fc domain of SEQ ID NO: 67.
- effector activity comprises antibody-dependent cellular toxicity (ADCC).
- ADCC antibody-dependent cellular toxicity
- the effector activity is reduced by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99% in an ADCC assay, e.g., compared to a wild-type IgG1 Fc domain of SEQ ID NO: 67.
- effector activity comprises complement dependent cytotoxicity (CDC).
- the effector activity is reduced by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99% in a CDC assay such as a CDC assay described in Armour et al., “Recombinant human IgG molecules lacking Fc gamma receptor I binding and monocyte triggering activities.” Eur J Immunol (1999) 29:2613-24′′ e.g., compared to a wild-type IgG1 Fc domain of SEQ ID NO: 67.
- the Fc domain comprises an IgG1 Fc domain of SEQ ID NO: 67 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the Fc domain comprises an IgG2 constant region of SEQ ID NO: 68 or fragment thereof, or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the Fc domain comprises an IgG2Da Fc domain of SEQ ID NO: 55 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the Fc domain comprises one or both of A330S and P331S mutations using Kabat numbering system.
- the Fc domain is one described in Armour et al. “Recombinant human IgG molecules lacking Fc gamma receptor I binding and monocyte triggering activities.” Eur J Immunol (1999) 29:2613-24.
- the Fc domain has dimerization activity.
- the Fc domain is an IgG domain, e.g., an IgG1, IgG2, IgG3, or IgG4 Fc domain. In some embodiments, the Fc domain comprises a CH2 domain and a CH3 domain.
- the nanoparticle comprises a protein having a sequence of SEQ ID NO: 56 (sushi-IgG2Da-Fc) or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the IFM that comprises a sushi domain described herein (e.g., in SEQ ID NO: 9) and an Fc domain described herein, e.g., an IgG2 Fc domain (e.g., SEQ ID NO: 54 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto).
- a sushi domain described herein e.g., in SEQ ID NO: 9
- an Fc domain described herein e.g., an IgG2 Fc domain (e.g., SEQ ID NO: 54 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto).
- the IFM comprises a sushi domain of SEQ ID NO: 9 and an Fc domain described herein, e.g., an IgG1 Fc domain, e.g., an Fc domain of SEQ ID NO: 67 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the IFM comprises a sushi domain of SEQ ID NO: 9 and an IgG2 Fc domain, e.g., an Fc domain of SEQ ID NO: 54 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the IFM comprises a sushi domain of SEQ ID NO: 9 and an IgG1 Fc domain, e.g., an Fc domain of SEQ ID NO: 67 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the IFM comprises a sushi domain of SEQ ID NO: 9 and an IgG2Da Fc domain of SEQ ID NO: 56 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In some embodiments, the IFM comprises a sushi domain of SEQ ID NO: 9 and an IgG2Da Fc domain of SEQ ID NO: 56 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the IFM comprises a sushi-IgG2Da-Fc protein having a sequence of SEQ ID NO: 56 or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the IL-15 molecule is a molecule described in PCT International Application Publication No. WO2017/027843, which is herein incorporated by reference in its entirety.
- Interleukin-12 is a heterodimeric cytokine composed of p35 and p40 subunits which are encoded by 2 separate genes, IL-12A and IL-12B, respectively.
- IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN- ⁇ ) and tumor necrosis factor-alpha (TNF- ⁇ ) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN- ⁇ .
- T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity.
- IL-12 plays an important role in the activities of NK cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8 cytotoxic T lymphocytes. There also seems to be a link between IL-2 and the signal transduction of IL-12 in NK cells. IL-2 stimulates the expression of two IL-12 receptors, IL-12R- ⁇ 1 and IL-12R- ⁇ 2, maintaining the expression of a critical protein involved in IL-12 signaling in NK cells. Enhanced functional response is demonstrated by IFN- ⁇ production and killing of target cells.
- IL-12 also has anti-angiogenic activity, which means it can block the formation of new blood vessels. It does this by increasing production of interferon gamma, which in turn increases the production of a chemokine called inducible protein-10 (IP-10 or CXCL10). IP-10 then mediates this anti-angiogenic effect. Because of its ability to induce immune responses and its anti-angiogenic activity, there has been an interest in testing IL-12 as a possible anti-cancer drug. There is a link that may be useful in treatment between IL-12 and the diseases psoriasis & inflammatory bowel disease.
- IP-10 inducible protein-10
- IL-12 binds to the IL-12 receptor, which is a heterodimeric receptor formed by IL-12R- ⁇ 1 and IL-12R- ⁇ 2.
- IL-12R- ⁇ 2 is considered to play a key role in IL-12 function, since it is found on activated T cells and is stimulated by cytokines that promote Th1 cells development and inhibited by those that promote Th2 cells development.
- IL-12R- ⁇ 2 Upon binding, IL-12R- ⁇ 2 becomes tyrosine phosphorylated and provides binding sites for kinases, Tyk2 and Jak2. These are important in activating critical transcription factor proteins such as STAT4 that are implicated in IL-12 signaling in T cells and NK cells.
- IL-12 is a potent cytokine with the potential to reshape the anti-inflammatory environment in solid tumors.
- its clinical utility has been limited by severe toxicities both from soluble administration or from adoptively transferred T cells engineered to secrete IL-12.
- the tethered fusion (TF) disclosed herein enables improved control of cytokine dose and biodistribution.
- the IL12-TF cytokine provides persistent loading of IL-12 on the surface of T cells and sustained T cell activation and signaling downstream of the IL-12 receptors. In turn, this can activate innate and adaptive immunity.
- the IL-12 in the tethered fusion can be in the form of a single chain containing both the IL-12A and IL-12B subunits.
- the IL-12 can be present as a non single-chain (i.e., as a heterodimer of IL-12A and IL-12B, which is the natural form of IL-12).
- the TF can be made by co-expression of three protein subunits (Fab heavy chain, Fab light-chain w/ IL-12A (or IL-12B), and IL-12B (or IL-12A).
- the immunostimulatory fusion molecules disclosed herein include an immune cell targeting moiety.
- the immune cell targeting moiety can be chosen from an antibody molecule (e.g., an antigen binding domain as described herein), a receptor or a receptor fragment, or a ligand or a ligand fragment, or a combination thereof.
- the immune cell targeting moiety associates with, e.g., binds to, an immune cell (e.g., a molecule, e.g., antigen, present on the surface of the immune cell).
- the immune cell targeting moiety targets, e.g., directs the immunostimulatory fusion molecules disclosed herein to an immune (e.g., a lymphocyte, e.g., a T cell).
- the immune cell targeting moiety is chosen from an antibody molecule (e.g., a full antibody (e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains), or an antigen-binding fragment (e.g., a Fab, F(ab′)2, Fv, a single chain Fv, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody)), non-antibody scaffold, or ligand that binds to the CD45 receptor.
- an antibody molecule e.g., a full antibody (e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains), or an antigen-binding fragment (e.g., a Fab, F(ab′)2, Fv, a single chain Fv, a single domain antibody
- the immune cell targeting moiety targets the IFM to persistent, abundant, and/or recycling cell surface receptors and molecules expressed on the surface of the immune cell.
- These receptors/molecules include, e.g., CD45 (via, e.g., BC8 (ACCT: HB-10507), 9.4 (ATTC: HB-10508), GAP8.3 (ATTC: HB-12), monoclonal antibodies), CD8 (via OKT8 monoclonal antibody), the transmembrane integrin molecules CD11a (via MHM24 monoclonal antibody) or CD18 (via chimeric1B4 monoclonal antibody).
- CD45 via, e.g., BC8 (ACCT: HB-10507), 9.4 (ATTC: HB-10508), GAP8.3 (ATTC: HB-12), monoclonal antibodies
- CD8 via OKT8 monoclonal antibody
- the transmembrane integrin molecules CD11a via MHM24 monoclonal antibody
- CD18 via
- the targeting moiety is directed to a marker selected from the group consisting of CD4, CD8, CD11a, CD18, CD19, CD20, and CD22.
- the immune cell targeting moiety is chosen from an antibody molecule, e.g., an antigen binding domain, non-antibody scaffold, or ligand that binds to CD45, CD4, CD8, CD3, CD11a, CD11b, CD11c, CD25, CD127, CD137, CD19, CD20, CD22, HLA-DR, CD197, CD38, CD27, CD196, CXCR3, CXCR4, CXCR5, CD84, CD229, CCR1, CCR5, CCR4, CCR6, CCR8, or CCR10.
- CD45 also known as leukocyte common antigen, refers to human CD45 protein and species, isoforms, and other sequence variants thereof.
- CD45 can be the native, full-length protein or can be a truncated fragment or a sequence variant (e.g., a naturally occurring isoform, or recombinant variant) that retains at least one biological activity of the native protein.
- CD45 is a receptor-linked protein tyrosine phosphatase that is expressed on leukocytes, and which plays an important role in the function of these cells (reviewed in Altin, J G (1997) Immunol Cell Biol. 75(5):430-45, incorporated herein by reference).
- the extracellular domain of CD45 is expressed in several different isoforms on T cells, and the particular isoform(s) expressed depends on the particular subpopulation of cell, their state of maturation, and antigen exposure. Expression of CD45 is important for the activation of T cells via the TCR, and that different CD45 isoforms display a different ability to support T cell activation.
- CD4 is a co-receptor for MHC Class II (with TCR, T-cell receptor); found on the surface of immune cells such as T helper cells, monocytes, macrophages, and dendritic cells.
- CD4 T cells are crucial in achieving a regulated effective immune response to pathogens.
- Naive CD4 T cells are activated after interaction with antigen-MHC complex and differentiate into specific subtypes depending mainly on the cytokine milieu of the microenvironment.
- T-helper 1 and T-helper 2 other subsets have been identified, including T-helper 17, regulatory T cell (Treg), follicular helper T cell, and T-helper 9, each with a characteristic cytokine profile.
- CD4 T cells carry out multiple functions, ranging from activation of the cells of the innate immune system, B-lymphocytes, cytotoxic T cells, as well as nonimmune cells, and also play critical role in the suppression of immune reaction. See e.g., Rishi Vishal et al. “CD4+ T Cells: Differentiation and Functions,” Clinical and Developmental Immunology, vol. 2012, Article ID 925135, 12 pages, 2012. doi:10.1155/2012/925135.
- CD8 is a transmembrane glycoprotein that serves as a co-receptor for the T cell receptor (TCR). Like the TCR, CD8 binds to a major histocompatibility complex (MHC) molecule, but is specific for the class I MHC protein. There are two isoforms of the protein, alpha and beta, each encoded by a different gene. In humans, both genes are located on chromosome 2 in position 2p12. The CD8 co-receptor is predominantly expressed on the surface of cytotoxic T cells, but can also be found on natural killer cells, cortical thymocytes, and dendritic cells. It is expressed in T cell lymphoblastic lymphoma and hypo-pigmented mycosis fungoides.
- MHC major histocompatibility complex
- CD8 forms a dimer, consisting of a pair of CD8 chains.
- the most common form of CD8 is composed of a CD8- ⁇ and CD8- ⁇ chain, both members of the immunoglobulin superfamily with an immunoglobulin variable (IgV)-like extracellular domain connected to the membrane by a thin stalk, and an intracellular tail. Less-common homodimers of the CD8- ⁇ chain are also expressed on some cells.
- the extracellular IgV-like domain of CD8- ⁇ interacts with the ⁇ 3 portion of the Class I MHC molecule. This affinity keeps the T cell receptor of the cytotoxic T cell and the target cell bound closely together during antigen-specific activation. Cytotoxic T cells with CD8 surface protein are called CD8 T cells.
- CD11a also known as “Integrin Alpha L (ITGAL)” and “the alpha subunit of LFA-1” is a membrane glycoprotein that provides cell-cell adhesion by interaction with ICAM-1.
- ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte function-associated antigen-1 (LFA-1), which is expressed on all leukocytes.
- LFA-1 plays an importantrole in leukocyte intercellular adhesion through interactions with its ligands, ICAMs 1-3 (intercellular adhesion molecules 1 through 3), and also functions in lymphocyte costimulatory signaling.
- ICAMs 1-3 intercellular adhesion molecules 1 through 3
- Two transcript variants encoding different isoforms have been found for this gene. See e.g, Cornwell R D et al. Description of the leukocyte function-associated antigen 1 (LFA-1 or CD11a) promoter. Proceedings of the National Academy of Sciences of the United States of America. 1993; 90(9):4221-4225; and Bose T O et al. CD11a Regulates Effector CD8 T Cell Differentiation and Central Memory Development in Response to Infection with Listeria monocytogenes . Flynn J L, ed. Infection and Immunity. 2013; 81(4):1140-1151. doi:10.1128/IAL00749-12.
- CD18 also known as Integrin Beta 2 chain (ITGB2) is the beta subunit of four different structures: LFA-1 (paired with CD11a); Macrophage-1 antigen (paired with CD11b); Integrin alphaXbeta2 (paired with CD11c); and Integrin alphaDbeta2 (paired with CD11d).
- LFA-1 paired with CD11a
- Macrophage-1 antigen paired with CD11b
- Integrin alphaXbeta2 paired with CD11c
- Integrin alphaDbeta2 paired with CD11d
- n humans lack of CD18 causes Leukocyte Adhesion Deficiency, a disease defined by a lack of leukocyte extravasation from blood into tissues.
- the beta 2 integrins have also been found in a soluble form.
- the soluble beta 2 integrins are ligand binding and plasma levels are inversely associated with disease activity in the autoimmune disease spondyloarthritis.
- CD20 is a type III transmembrane protein found on B cells that forms a calcium channel in the cell membrane allowing for the influx of calcium required for cell activation; expressed in B-cell lymphomas, hairy cell leukemia, and B-cell chronic lymphocytic leukemia.
- CD20 antibodies against CD20 exist: e.g. Rituximab and Ofatumumab, with several more in development.
- anti-CD20 monoclonal antibody Ocrelizumab is in trials for multiple sclerosis. See e.g., Cragg M S et al (2005). “The biology of CD20 and its potential as a target for mAb therapy”. Current Directions in Autoimmunity.
- the immunostimulatory moiety or the targeting moiety binds an inhibitor of an immunosuppressor, e.g., an inhibitor of a checkpoint inhibitor, such as PD-1, PD-L1, LAG-3, TIM-3, CTLA-4, inhibitory KIR, CD276, VTCN1, BTLA/HVEM, HAVCR2 and ADORA2A, e.g., as described in US 2016/0184399 incorporated herein by reference.
- the checkpoint inhibitor is present on an immune effector cell, e.g., a T cell or NK cell.
- the immunostimulatory or the targeting moiety binds PD-1.
- PD-1 for instance, Pidilizumab and other anti-PD-1 antibodies are disclosed in Rosenblatt, J. et al. (2011) J Immunotherapy 34(5): 409-18, U.S. Pat. Nos. 7,695,715, 7,332,582, and 8,686,119, incorporated by reference in their entireties.
- MEDI0680 and other anti-PD-1 antibodies are disclosed in U.S. Pat. No. 9,205,148 and WO 2012/145493, incorporated by reference in their entireties.
- anti-PD-1 antibodies include those described, e.g., in WO 2010/027827 WO 2011/066342, WO 2015/112800, WO 2016/092419, WO 2015/085847, WO 2014/179664, WO 2014/194302, WO 2014/209804, WO 2015/200119, U.S. Pat. Nos. 8,735,553, 7,488,802, 8,927,697, 8,993,731, and 9,102,727, incorporated by reference in their entireties.
- the immunostimulatory or the targeting moiety binds PD-L1.
- Atezolizumab and other anti-PD-L1 antibodies are disclosed in U.S. Pat. No. 8,217,149, incorporated by reference in its entirety.
- Avelumab and other anti-PD-L1 antibodies are disclosed in WO 2013/079174, incorporated by reference in its entirety.
- Durvalumab and other anti-PD-L1 antibodies are disclosed in U.S. Pat. No. 8,779,108, incorporated by reference in its entirety.
- BMS-936559 and other anti-PD-L1 antibodies are disclosed in U.S. Pat. No. 7,943,743 and WO 2015/081158, incorporated by reference in their entireties.
- anti-PD-L1 antibodies include those described, e.g., in WO 2015/181342, WO 2014/100079, WO 2016/000619, WO 2014/022758, WO 2014/055897, WO 2015/061668, WO 2013/079174, WO 2012/145493, WO 2015/112805, WO 2015/109124, WO 2015/195163, U.S. Pat. Nos. 8,168,179, 8,552,154, 8,460,927, and 9,175,082, incorporated by reference in their entireties.
- the immunostimulatory or the targeting moiety binds LAG-3.
- LAG-3 antibodies have been reported in the art, e.g., BMS-986016 (Bristol-Myers Squibb), TSR-033 (Tesaro), MK-4280 (Merck & Co), or REGN3767 (Regeneron).
- IMP731 and other anti-LAG-3 antibodies are disclosed in WO 2008/132601 and U.S. Pat. No. 9,244,059, incorporated by reference in their entireties.
- anti-LAG-3 antibodies include those described, e.g., in WO 2008/132601, WO 2010/019570, WO 2014/140180, WO 2015/116539, WO 2015/200119, WO 2016/028672, U.S. Pat. Nos. 9,244,059, 9,505,839, incorporated by reference in their entireties.
- the immunostimulatory or the targeting moiety binds TIM-3.
- the TIM-3 targeting moiety is chosen from TSR-022 (Tesaro), or LY3321367 (Eli Lilly).
- APE5137, APE5121, and other anti-TIM-3 antibodies are disclosed in WO 2016/161270, incorporated by reference in its entireties. Further anti-TIM-3 antibodies include those described, e.g., in WO 2016/111947, WO 2016/071448, WO 2016/144803, U.S. Pat. Nos. 8,552,156, 8,841,418, and 9,163,087, incorporated by reference in their entireties.
- the immunostimulatory or the targeting moiety binds CTLA-4.
- the antibody Ipilimumab and other anti-CTLA-4 antibodies are disclosed in U.S. Pat. No. 6,984,720, herein incorporated by reference.
- the antibody Tremelimumab and other anti-CTLA-4 antibodies are disclosed in U.S. Pat. No. 7,411,057, herein incorporated by reference.
- the immunostimulatory fusion molecules described herein may comprise one or more antibody molecule.
- the immune cell engager may comprise an antibody molecule.
- the antibody molecule binds to a cancer antigen, e.g., a tumor antigen or a stromal antigen.
- the cancer antigen is, e.g., a mammalian, e.g., a human, cancer antigen.
- the antibody molecule binds to an immune cell antigen, e.g., a mammalian, e.g., a human, immune cell antigen.
- the antibody molecule binds specifically to an epitope, e.g., linear or conformational epitope, on the cancer antigen or the immune cell antigen.
- an antibody molecule is a monospecific antibody molecule and binds a single epitope.
- a monospecific antibody molecule having a plurality of immunoglobulin variable domain sequences, each of which binds the same epitope.
- an antibody molecule is a multispecific antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domains sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap.
- the first and second epitopes do not overlap.
- first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a multispecific antibody molecule comprises a third, fourth or fifth immunoglobulin variable domain.
- a multispecific antibody molecule is a bispecific antibody molecule, a trispecific antibody molecule, or a tetraspecific antibody molecule.
- a multispecific antibody molecule is a bispecific antibody molecule.
- a bispecific antibody has specificity for no more than two antigens.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap.
- the first and second epitopes do not overlap.
- first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a bispecific antibody molecule comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody molecule comprises a scFv or a Fab, or fragment thereof, have binding specificity for a first epitope and a scFv or a Fab, or fragment thereof, have binding specificity for a second epitope.
- an antibody molecule comprises a diabody, and a single-chain molecule, as well as an antigen-binding fragment of an antibody (e.g., Fab, F(ab′) 2 , and Fv).
- an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
- VH heavy chain variable domain sequence
- VL light chain variable domain sequence
- an antibody molecule comprises or consists of a heavy chain and a light chain (referred to herein as a half antibody.
- an antibody molecule in another example, includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab′, F(ab′) 2 , Fc, Fd, Fd′, Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and mono or bispecific), triabodies (trivalent and mono or multispecific), and chimeric or humanized antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgG1, IgG2, IgG3, and IgG4) of antibodies.
- a preparation of antibody molecules can be monoclonal or polyclonal.
- An antibody molecule can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
- the antibody can have a heavy chain constant region chosen from, e.g., IgG1, IgG2, IgG3, or IgG4.
- the antibody can also have a light chain chosen from, e.g., kappa or lambda.
- immunoglobulin (Ig) is used interchangeably with the term “antibody” herein.
- antigen-binding fragments of an antibody molecule include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al.
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- a F(ab′)2 fragment a bivalent fragment comprising two Fab fragment
- Antibody molecules include intact molecules as well as functional fragments thereof. Constant regions of the antibody molecules can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
- Antibody molecules can also be single domain antibodies.
- Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
- Single domain antibodies may be any of the art, or any future single domain antibodies.
- Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
- a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example.
- variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
- VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the disclosure.
- Antibody molecules can include non-antibody scaffolds and antibody mimetics.
- Exemplary non-antibody scaffolds include: lipocalins (e.g. anticalins), affibodies, fibronectin (e.g. monobodies or Adnectins), knottins, ankyrin repeats (e.g. DARPins), and A domains (e.g. avimers).
- VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions” (CDR), interspersed with regions that are more conserved, termed “framework regions” (FR or FW).
- CDR complementarity determining regions
- FR framework regions
- CDR complementarity determining region
- the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of known schemes, including those described by Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (“Kabat” numbering scheme), Al-Lazikani et al., (1997) JMB 273,927-948 (“Chothia” numbering scheme). As used herein, the CDRs defined according the “Chothia” number scheme are also sometimes referred to as “hypervariable loops.”
- the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
- the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
- Each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the antibody molecule can be a polyclonal or a monoclonal antibody.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
- the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
- Phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Pat. No. 5,223,409; Kang et al. International
- the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
- a rodent mouse or rat
- the non-human antibody is a rodent (mouse or rat antibody).
- Methods of producing rodent antibodies are known in the art.
- Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al. International Application WO 91/00906, Kucherlapati et al. PCT publication WO 91/10741; Lonberg et al. International Application WO 92/03918; Kay et al. International Application 92/03917; Lonberg, N. et al. 1994 Nature 368:856-859; Green, L. L. et al.
- An antibody molecule can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the disclosure. Antibody molecules generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the disclosure. For example, anti-human CD45 antibodies such as 9.4, 4B2 and BC8 can be humanized using techniques known in the art, for making the tethered fusions disclosed herein.
- An “effectively human” protein is a protein that does substantially not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
- HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
- a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol. Immunother., 32:180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).
- Chimeric antibodies e.g. antibodies containing mouse variable domains and human constant domains
- can be produced by recombinant DNA techniques known in the art see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Pat. No. 4,816,567; Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240:1041-1043); Liu et al.
- a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
- the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding to the antigen.
- the donor will be a rodent antibody, e.g., a rat or mouse antibody
- the recipient will be a human framework or a human consensus framework.
- the immunoglobulin providing the CDRs is called the “donor” and the immunoglobulin providing the framework is called the “acceptor.”
- the donor immunoglobulin is a non-human (e.g., rodent).
- the acceptor framework is a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
- the term “consensus sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
- An antibody molecule can be humanized by methods known in the art (see e.g., Morrison, S. L., 1985 , Science 229:1202-1207, by Oi et al., 1986 , BioTechniques 4:214, and by Queen et al. U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, the contents of all of which are hereby incorporated by reference).
- Humanized or CDR-grafted antibody molecules can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S. Pat. No. 5,225,539; Jones et al. 1986 Nature 321:552-525; Verhoeyan et al. 1988 Science 239:1534; Beidler et al. 1988 J. Immunol. 141:4053-4060; Winter U.S. Pat. No. 5,225,539, the contents of all of which are hereby expressly incorporated by reference.
- humanized antibody molecules in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in U.S. Pat. No. 5,585,089, e.g., columns 12-16 of U.S. Pat. No. 5,585,089, e.g., columns 12-16 of U.S. Pat. No. 5,585,089, the contents of which are hereby incorporated by reference. Other techniques for humanizing antibodies are described in Padlan et al. EP 519596 A1, published on Dec. 23, 1992.
- the antibody molecule can be a single chain antibody.
- a single-chain antibody (scFv) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
- the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
- the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4.
- the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody has: effector function; and can fix complement.
- the antibody does not; recruit effector cells; or fix complement.
- the antibody has reduced or no ability to bind an Fc receptor. For example, it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 A1, U.S. Pat. Nos. 5,624,821 and 5,648,260, the contents of all of which are hereby incorporated by reference). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
- an antibody molecule can be derivatized or linked to another functional molecule (e.g., a cytokine molecule as described herein or other chemical or proteinaceous groups).
- a “derivatized” antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules of the disclosure are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
- an antibody molecule can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as a cytokine molecule, another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- a cytokine molecule e.g., another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- One type of derivatized antibody molecule is produced by crosslinking an antibody molecule to one or more proteins, e.g., a cytokine molecule, another antibody molecule (of the same type or of different types, e.g., to create bispecific antibodies).
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
- Such linkers are available from Pierce Chemical Company, Rockford, Ill.
- the IFM can be represented with the following formula in an N to C terminal orientation: R1-(optionally L1)-R2 or R2-(optionally L1)-R1; wherein R1 comprises an immune cell targeting moiety, L1 comprises a linker (e.g., a peptide linker described herein), and R2 comprises an immune stimulating moiety, e.g., a cytokine molecule.
- R1 comprises an immune cell targeting moiety
- L1 comprises a linker (e.g., a peptide linker described herein)
- R2 comprises an immune stimulating moiety, e.g., a cytokine molecule.
- the immune stimulating moiety e.g., the cytokine molecule
- the immune stimulating moiety is connected to, e.g., covalently linked to, the immune cell targeting moiety.
- the immune stimulating moiety e.g., the cytokine molecule
- is functionally linked e.g., covalently linked (e.g., by chemical coupling, fusion, noncovalent association or otherwise) to the immune cell targeting moiety.
- the immune stimulating moiety can be covalently coupled indirectly, e.g., via a linker to the immune cell targeting moiety.
- the linker is chosen from: a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non-helical linker.
- the linker is a peptide linker.
- the peptide linker can be 5-20, 8-18, 10-15, or about 8, 9, 10, 11, 12, 13, 14, or 15 amino acids long.
- the linker comprises the amino acid sequence of SEQ ID NO: 36, 37, 38, or 39, or an amino acid sequence substantially identical thereto (e.g., having 1, 2, 3, 4, or 5 amino acid substitutions).
- the linker comprises an amino acid sequence GGGSGGGS (SEQ ID NO: 37).
- the linker comprises amino acids from an IgG4 hinge region, e.g., amino acids DKTHTSPPSPAP (SEQ ID NO: 38).
- the linker is a non-peptide, chemical linker.
- the immune stimulating moiety is covalently coupled to the immune cell targeting moiety by crosslinking.
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
- the linker can be a biodegradable or cleavable linker.
- a cleavable linker allows for cleavage of the IFM such that the immune stimulating moiety, e.g., the cytokine molecule, can be released from the immune targeting moiety.
- the cleavage of the linker may be caused by biological activation within the relevant tissue or, alternatively, by external stimuli such as, e.g., electromagnetic radiation e.g., UV-radiation.
- the cleavable linker is configured for cleavage exterior to a cell, e.g., to be cleaved in conditions associated with cell or tissue damage or disease.
- conditions include, for example, acidosis; the presence of intracellular enzymes (that are normally confined within cells), including necrotic conditions (e.g., cleaved by calpains or other proteases that spill out of necrotic cells); hypoxic conditions such as a reducing environment; thrombosis (e.g., a linker may be cleavable by thrombin or by another enzyme associated with the blood clotting cascade); immune system activation (e.g., a linker may be cleavable by action of an activated complement protein); or other condition associated with disease or injury.
- necrotic conditions e.g., cleaved by calpains or other proteases that spill out of necrotic cells
- hypoxic conditions such as a reducing environment
- a cleavable linker may include an S—S linkage (disulfide bond), or may include a transition metal complex that falls apart when the metal is reduced.
- S—S linker may have the following structure (as disclosed in U.S. Pat. No. 9,603,944, incorporated herein by reference in its entirety:
- pH sensitive linkers which are cleaved upon a change in pH, e.g., at low pH, which will facilitate hydrolysis of acid (or base) labile moieties, e.g. acid labile ester groups etc.
- acid (or base) labile moieties e.g. acid labile ester groups etc.
- Such conditions may be found in the extracellular environment, such as acidic conditions which may be found near cancerous cells and tissues or a reducing environment, as may be found near hypoxic or ischemic cells and tissues; by proteases or other enzymes found on the surface of cells or released near cells having a condition to be treated, such as diseased, apoptotic or necrotic cells and tissues; or by other conditions or factors.
- An acid-labile linker may be, for example, a cis-aconitic acid linker.
- pH-sensitive linkages include acetals, ketals, activated amides such as amides of 2,3 dimethylmaleamic acid, vinyl ether, other activated ethers and esters such as enol or silyl ethers or esters, imines, iminiums, orthoesters, enamines, carbamates, hydrazones, and other linkages known in the art (see, e.g., PCT Publication No. WO 2012/155920 and Franco et al. AIMS Materials Science, 3(1): 289-323, incorporated herein by reference).
- pH sensitive refers to the fact that the cleavable linker in question is substantially cleaved at an acidic pH (e.g., a pH below 6.0, such as in the range of 4.0-6.0).
- the cleavable linker is configured for cleavage by an enzyme, such as a protease (e.g., pepsin, trypsin, thermolysine, matrix metalloproteinase (MMP), a disintegrin and metalloprotease (ADAM; e.g. ADAM-10 or ADAM-17)), a glycosidase (e.g., ⁇ -, ⁇ -, ⁇ -amylase, ⁇ -, ⁇ -glucosidase or lactase) or an esterase (e.g. acetyl cholinesterase, pseudo cholinesterase or acetyl esterase).
- a protease e.g., pepsin, trypsin, thermolysine, matrix metalloproteinase (MMP), a disintegrin and metalloprotease (ADAM; e.g. ADAM-10 or ADAM-17
- ADAM disintegrin and metalloprotease
- cleave the cleavable linker include urokinase plasminogen activator (uPA), tissue plasminogen activator (tPA), granzyme A, granzyme B, lysosomal enzymes, cathepsins, prostate-specific antigen, Herpes simplex virus protease, cytomegalovirus protease, thrombin, caspase, and interleukin 1 beta converting enzyme.
- uPA urokinase plasminogen activator
- tPA tissue plasminogen activator
- granzyme A granzyme B
- lysosomal enzymes cathepsins
- cathepsins prostate-specific antigen
- Herpes simplex virus protease Herpes simplex virus protease
- cytomegalovirus protease cytomegalovirus protease
- thrombin thrombin
- caspase and interleukin 1 beta
- Still another example is over-expression of an enzyme, e.g., proteases (e.g., pepsin, trypsin), in the tissue of interest, whereby a specifically designed peptide linker will be cleaved in upon arrival at the tissue of interest.
- proteases e.g., pepsin, trypsin
- suitable linkers in this respect are Gly-Phe-Ser-Gly (SEQ ID NO: 105), Gly-Lys-Val-Ser (SEQ ID NO: 106), Gly-Trp-Ile-Gly (SEQ ID NO: 107), Gly-Lys-Lys-Trp (SEQ ID NO: 108), Gly-Ala-Tyr-Met (SEQ ID NO: 109).
- over-expression of an enzyme e.g. of glycosidases (e.g. ⁇ -amylase)
- a specifically designed carbohydrate linker to be cleaved upon arrival at the tissue of interest.
- suitable linkers in this respect are -( ⁇ -1-4-D-Glucose)n- where n ⁇ 4.
- the cleavable linker is configured for cleavage by electromagnetic radiation, e.g., UV-radiation.
- UV-exposure of the tissue of interest resulting in cleavage of the linker B can facilitate drug release or facilitate nanoparticles uptake in the desired tissue.
- the cleavable linker may include a total of from 2 to 60 atoms, such as from 2 to 20 atoms.
- the cleavable linker may include amino acid residues, and may be a peptide linkage, e.g., of from 1 to 30, or from 2 to 10, amino acid residues.
- the cleavable linker B consists of from 1 to 30, such as from 2 to 10, or from 2 to 8, or from 3 to 9, or from 4-10, amino acids.
- the number of atoms is typically from 2 to 50, such as from 2-30.
- the linker includes an aminocaproic acid (also termed aminohexanoic acid) linkage or a linkage composed of from 1 to 30, or from 2 to 10 carbohydrate residues.
- aminocaproic acid also termed aminohexanoic acid
- the linker includes a peptide that can serve as a substrate of a matrix metalloproteinase.
- a matrix metalloproteinase for example, MMP-1 (interstitial collagenase), MMP-2 (gelatinase A), MMP-3, MMP-7, MMP-9 (gelatinase B), and the like are known, and a substrate peptide that can serve as a substrate of one or more kinds of matrix metalloproteinases among those mentioned above can be used.
- matrix metalloproteinases see for example, “Molecular mechanism of cancer metastasis”, Ed. by Tsuruo T., pp. 92-107, Medical View Co., Ltd., published in 1993.
- the substrate peptide that can serve as a substrate of a matrix metalloproteinase for example, the matrix metalloproteinases of particular types and substrate peptides specifically recognized thereby are explained in Nature Biotechnology, 19, pp. 661-667, 2001. Therefore, by referring to this publication, a substrate peptide specifically cleaved by a particular type of matrix metalloproteinase can be chosen.
- a substrate peptide specifically cleaved by a particular type of matrix metalloproteinase can be chosen.
- Val-Pro-Leu-Ser-Leu-Tyr-Ser-Gly SEQ ID NO: 110
- it is preferable to use the aforementioned octapeptide as a substrate peptide that can serve as a substrate of MMP-9.
- Illustrative examples of the substrate peptide that can serve as a substrate of a matrix metalloproteinase include Gly-Pro-Gln-Gly-Ile-Ala-Gly-Gln (SEQ ID NO: 111), Val-Pro-Met-Ser-Met-Arg-Gly-Gly (SEQ ID NO: 112), Ile-Pro-Val-Ser-Leu-Arg-Ser-Gly (SEQ ID NO: 113), Arg-Pro-Phe-Ser-Met-Ile-Met-Gly (SEQ ID NO: 114), Val-Pro-Leu-Ser-Leu-Thr-Met-Gly (SEQ ID NO: 115), Ile-Pro-Glu-Ser-Leu-Arg-Ala-Gly (SEQ ID NO: 116), Arg-His-Asp, Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys (SEQ ID NO: 117), Arg-
- the linker includes a peptide that can serve as a substrate of a disintegrase and metalloproteas (ADAM), an MMP, or a granzyme.
- ADAM disintegrase and metalloproteas
- the linker could comprise a peptide substrate of ADAM-8, ADAM-10, ADAM-12, ADAM-17, MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, granzyme A, or granzyme B.
- Substrates of ADAMs, MMPs, and granzymes have been well-described (e.g. in Miller, M A, et al. Integrative Biology (2011) 3:422-438, Van Damme et al.
- the linker may, besides the substrate peptide, contain connectors, involved in the bond or bonds with the therapeutic protein.
- Such connectors may each consist of one amino acid residue or of an oligopeptide containing from 2 to 10, such as from 3 to 9, or from 4 to 8, or from 2 to 8, amino acid residues.
- the amino acid residue or oligopeptide as the connectors may, if present, bind to both ends of the substrate peptide, or may bind only to one end of the substrate peptide so as to represent one of the structures.
- Types of one amino acid usable as the connector(s), and amino acid residues constituting an oligopeptide usable as the connector(s) are not particularly limited, and one amino acid residue of an arbitrary type, or an arbitrary oligopeptide containing, e.g., from 2 to 8 of the same or different amino acid residues of arbitrary types can be used.
- Examples of the oligopeptide usable as the connector(s) include, for example, connectors that are rich in Gly amino acids. Other organic moieties can also be used as connectors.
- the immune stimulating moiety is directly covalently coupled to the immune cell targeting moiety, without a linker.
- the immune stimulating moiety and the immune cell targeting moiety of the IFM are not covalently linked, e.g., are non-covalently associated.
- Exemplary formats for fusion of a cytokine molecule to an antibody molecule can include a fusion to the amino-terminus (N-terminus) or carboxy-terminus (C-terminus) of the antibody molecule, typically, the C-terminus of the antibody molecule.
- a cytokine-Ig moiety fusion molecule comprising a cytokine polypeptide, cytokine-receptor complex, or a cytokine-receptor Fc complex joined to an Ig polypeptide, a suitable junction between the cytokine polypeptide chain and an Ig polypeptide chain includes a direct polypeptide bond, a junction having a polypeptide linker between the two chains; and, a chemical linkage between the chains.
- a typical junction is a flexible linker composed of small Gly4Ser linker (GGGGS) N , where N indicates the number of repeats of the motif (GGGGS) 2 and (GGGGS) 3 are preferred embodiments of linkers for use in the fusion constructs of the disclosure.
- Exemplary immunostimulatory fusion molecules described herein can comprise the amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, S
- Described herein are exemplary immunostimulatory fusion molecules (or portion thereof) of the present disclosure. It should be noted that in certain scFv the arrangement is VH-linker-VL. However, the VL-linker-VH arrangement can also be used without affecting functionality. In addition, while specific linkers (Linker-1, Linker-2, etc.) were used in various constructs, other linkers disclosed herein can also be used interchangeably.
- Light-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental BC8 mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15R ⁇ -sushi domain genetically fused to antibody light-chain C-terminus using a flexible linker.
- a light chain portion of a chimeric BC8 Fab is shown fused via a peptide linker to an IL-15-binding sushi domain.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and single underline; and the sushi domain is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the chimeric BC8 antibody comprises the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) shown in SEQ ID NO:1, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 95% or higher identical to SEQ ID NO:1).
- the chimeric BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 1.
- the IFMs described herein can comprise the amino acid sequence selected from SEQ ID NO: 1, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 1, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 1.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 1.
- Light-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental BC8 mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15R ⁇ -sushi domain genetically fused to antibody light-chain N-terminus using a flexible linker.
- an IL-15-binding wild type sushi domain is fused via a peptide linker to a light chain portion of a chimeric BC8 Fab is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and single underline; and the sushi domain is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the chimeric BC8 antibody comprises the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) shown in SEQ ID NO:2, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:2).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable region of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 2.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 2.
- the IFMs described herein can comprise the amino acid sequence selected from SEQ ID NO: 2, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 2, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 2.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 2.
- LC-chBC8-IL15 also referred to as LC-chBC8-L1-IL15
- Light-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a flexible linker.
- a light chain portion of a chimeric BC8 Fab is shown fused via a peptide linker to an IL-15 cytokine.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and single underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the chimeric BC8 antibody comprises the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) shown in SEQ ID NO:3, or an amino acid sequence substantially identical thereof (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:3).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 3.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 3.
- the IFMs described herein can comprise the amino acid sequence selected from SEQ ID NO: 3, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 3, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 3.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 3.
- Light-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain N-terminus using a flexible linker.
- an IL-15 cytokine fused via a peptide linker to a light chain portion of a chimeric BC8 Fab is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the chimeric BC8 antibody comprises the light chain variable amino acid sequence (optionally, further including a kappa light chain sequence) shown in SEQ ID NO:4, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 95% or higher identical to SEQ ID NO:4).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the any of the CDR sequences of SEQ ID NO: 4.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the any of the CDR sequences of SEQ ID NO: 4.
- the IFMs described herein can comprise the amino acid sequence selected from SEQ ID NO: 4, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 2, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 4.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 4.
- An exemplary corresponding heavy chain of the chimeric BC8 antibody molecule e.g., a Fab or IgG, is shown below as SEQ ID NO:5 or SEQ ID NO:6, respectively.
- Fab heavy-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental BC8 mouse monoclonal antibody and CH1 domain from human IgG1.
- the chimeric BC8 antibody comprises the heavy chain variable amino acid sequence (optionally, further including a CH1 domain sequence from human IgG1) shown in SEQ ID NO:5, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:5).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 5.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 5.
- Heavy-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental BC8 mouse monoclonal antibody and constant region from human IgG4 containing S228P mutation (IgG4-S228P).
- the chimeric BC8 antibody comprises the heavy chain variable amino acid sequence (optionally, further including a constant domain sequence from human IgG4 containing S228P mutation (IgG4-S228P)) shown in SEQ ID NO:6, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:6).
- the chimeric BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 6.
- Light-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental BC8 mouse monoclonal antibody and human constant kappa domain.
- the BC8 antibody comprises the light chain variable amino acid sequence (optionally, further including a constant domain sequence from human kappa) shown in SEQ ID NO:7, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to SEQ ID NO:7).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 7.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 7.
- Heavy-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental BC8 mouse monoclonal antibody and constant region from human IgG4 containing S228P mutation (IgG4-S228P); contains wild-type IL-15 genetically fused to antibody heavy-chain C-terminus using a flexible linker.
- a heavy chain portion of a chimeric BC8 IgG4 fused to an IL-15 cytokine fused via a peptide linker is shown.
- the sequence of the heavy chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the BC8 antibody comprises the heavy chain variable amino acid sequence (optionally, further including human IgG4 constant sequence) shown in SEQ ID NO:8, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 95% or higher identical to SEQ ID NO:8).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the any of the CDR sequences of SEQ ID NO: 8.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the any of the CDR sequences of SEQ ID NO: 8.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 8, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 8, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 8.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 8.
- Fab heavy-chain of chimeric 9.4 anti-CD45 antibody contains variable domain from parental 9.4 mouse monoclonal antibody and CH1 domain from human IgG1.
- the chimeric 9.4 antibody comprises the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence) shown in SEQ ID NO:14, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 95% or higher identical to SEQ ID NO:14).
- the 9.4 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the 9.4 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO:14.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO:14.
- Light-chain of chimeric 9.4 anti-CD45 antibody contains variable domain from parental 9.4 mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a flexible linker.
- a light chain portion of a chimeric 9.4 IgG1 fused to an IL-15 cytokine fused via a peptide linker is shown.
- the sequence of the light-chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the light chain variable amino acid sequence of the chimeric 9.4 antibody (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:15, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:15).
- the 9.4 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the any of the CDR sequences of SEQ ID NO: 15.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the any of the CDR sequences of SEQ ID NO: 15.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 15, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 15, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 15.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 15.
- Fab heavy-chain of chimeric 4B2 anti-CD45 antibody contains variable domain from parental 4B2 mouse monoclonal antibody and CH1 domain from human IgG1.
- the chimeric 4B2 antibody comprises the heavy chain variable amino acid sequence (optionally, further including a human IgG1 heavy chain sequence) shown in SEQ ID NO:16, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 95% or higher identical to SEQ ID NO:16).
- the 4B2 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the 4B2 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO:16.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO:16.
- Light-chain of chimeric 4B2 anti-CD45 antibody contains variable domain from parental 4B2 mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a flexible linker.
- a light chain portion of a chimeric 4B2 IgG1 fused to an IL-15 cytokine via a peptide linker is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the light chain variable amino acid sequence of the chimeric 4B2 antibody (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:17, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:17).
- the 4B2 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the 4B2 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the any of the CDR sequences of SEQ ID NO: 17.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the any of the CDR sequences of SEQ ID NO: 17.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 17, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 17, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 17.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 17.
- Fab heavy-chain of humanized BC8 anti-CD45 antibody contains humanized variable domain and CH1 domain from human IgG1.
- the heavy chain variable amino acid sequence of a humanized BC8 antibody (optionally, further including a CH1 domain sequence from human IgG1) has the amino acid sequence shown in SEQ ID NO:18, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:18).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 18.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 18.
- Light-chain of humanized BC8 anti-CD45 antibody contains humanized variable domain and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a flexible linker.
- a light chain portion of a humanized BC8 IgG1 fused to an IL-15 cytokine via a peptide linker is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the light chain variable amino acid sequence of the humanized BC8 antibody (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:19, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:19).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any the CDR sequences of SEQ ID NO: 19.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any the CDR sequences of SEQ ID NO: 19.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 19, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO: 19, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 19.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 19.
- Fab heavy-chain of humanized BC8 anti-CD45 antibody contains humanized variable domain, an SGGGS (SEQ ID NO: 123) substitution in CDR-H3, and CH1 domain from human IgG1.
- Light-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a flexible linker with sequence
- a light chain portion of a chimeric BC8 IgG1 fused to an IL-15 cytokine via a peptide linker (L2) is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the light chain variable amino acid sequence of the chimeric BC8 antibody (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:21, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:21).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any the CDR sequences of SEQ ID NO: 21.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any the CDR sequences of SEQ ID NO: 21.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 21, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO:21, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 21.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 21.
- Light-chain of chimeric BC8 anti-CD45 antibody contains variable domain from parental mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a linker related to the human IgG1 hinge (SEQ ID NO: 38).
- a light chain portion of a chimeric BC8 IgG1 fused to an IL-15 cytokine via a peptide linker (L3) is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the light chain variable amino acid sequence of the chimeric BC8 antibody (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:22, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:22).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the BC8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 22.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 22.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 22, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO:22, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 22.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 22.
- Heavy-chain variable domain of humanized BC8 anti-CD45 antibody contains an SGGGS substitution in CDR-H3.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 25, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO:25, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 25.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 25.
- Fab heavy-chain of chimeric MHM24 anti-CD11a antibody contains variable domain from parental mouse monoclonal antibody and CH1 domain from human IgG1.
- the heavy chain variable amino acid sequence of a chimeric MHM24 antibody (optionally, further including a CH1 domain sequence from human IgG1) has the amino acid sequence shown in SEQ ID NO:26, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:26).
- the MHM24 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the MHM24 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 26.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 26.
- Fab heavy-chain of humanized MHM24 anti-CD11a antibody contains variable domain from a humanized MHM24 heavy-chain variable domain and CH1 domain from human IgG1.
- the heavy chain variable amino acid sequence of a humanized MHM24 antibody (optionally, further including a CH1 domain sequence from human IgG1) has the amino acid sequence shown in SEQ ID NO: 27, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO: 27).
- the MHM24 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the MHM24 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 27.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 27.
- LC-chMHM24-IL15 Light-chain of chimeric MHM24 anti-CD11a antibody; contains variable domain from parental mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a flexible linker.
- a light chain portion of a chimeric MHM24 IgG1 fused to an IL-15 cytokine via a peptide linker is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the light chain variable amino acid sequence of the chimeric MHM24 antibody (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:27, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:27).
- the chimeric MHM24 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 27.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 27.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 27, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO:27, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 27.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 27.
- Fab heavy-chain of chimeric 1B4 anti-CD18 antibody contains variable domain from parental mouse monoclonal antibody and CH1 domain from human IgG1.
- the heavy chain variable amino acid sequence of a chimeric 1B4 antibody (optionally, further including a CH1 domain sequence from human IgG1) has the amino acid sequence shown in SEQ ID NO:28, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:28).
- the chimeric 1B4 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the 1B4 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 28.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 28.
- Light-chain of chimeric 1B4 anti-CD18 antibody contains variable domain from parental mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a flexible linker.
- a light chain portion of a chimeric 1B4 IgG1 fused to an IL-15 cytokine via a peptide linker is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the light chain variable amino acid sequence of the chimeric 1B4 antibody (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:29, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:29).
- the chimeric 1B4 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 29.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 29.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 29, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO:29, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 29.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 29.
- Fab heavy-chain of chimeric OKT8 anti-CD8 antibody contains variable domain from parental mouse monoclonal antibody and CH1 domain from human IgG1.
- the heavy chain variable amino acid sequence of a chimeric OKT8 anti-CD8 antibody (optionally, further including a CH1 domain sequence from human IgG1) has the amino acid sequence shown in SEQ ID NO:30, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:30).
- the chimeric OKT8 anti-CD8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the heavy chain variable domain of the OKT8 anti-CD8 antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from the CDR sequence of SEQ ID NO: 30.
- Light-chain of chimeric OKT8 anti-CD8 antibody contains variable domain from parental mouse monoclonal antibody and human constant kappa domain; contains wild-type IL-15 genetically fused to antibody light-chain C-terminus using a flexible linker.
- a light chain portion of a chimeric OKT8 IgG1 fused to an IL-15 cytokine via a peptide linker is shown.
- the sequence of the light chain is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the kappa constant region is shown as SEQ ID NO: 74.
- the light chain variable amino acid sequence of the chimeric OKT8 antibody (optionally, further including a kappa light chain sequence) corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:31, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:31).
- the chimeric OKT8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of SEQ ID NO: 31.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 31, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO:31, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 31.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 31.
- IL-15 fused to the C-terminus of BC8-scFv using a short flexible linker and a hexahistidine tag.
- a light chain portion of a BC8 scFv fused to an IL-15 cytokine via a peptide linker is shown.
- the scFv sequence is shown in normal font; the location of the peptide linker is shown by italics and underline; and the cytokine molecule is shown by the double underline.
- the light chain variable amino acid sequence of the BC8 scFv antibody corresponding to the antibody portion of the amino acid sequence shown in SEQ ID NO:31, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95% or higher identical to the antibody portion of SEQ ID NO:32).
- the BC8 antibody comprises one, two, or all three CDR1, CDR2 or CDR3 of the light chain variable domain of the antibody, e.g., according to the Kabat definition, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences within SEQ ID NO: 32.
- a closely related CDR e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences within SEQ ID NO: 32.
- the IFMs described herein can comprise the amino acid sequence of SEQ ID NO: 32, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to SEQ ID NO:32, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 32.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to SEQ ID NO: 32.
- the IFM comprises a constant lamba or lamda region.
- exemplary constant lamba or lamda regions include SEQ ID NOS: 74-78.
- the IFMs described herein can comprise one or more of the amino acid sequences of SEQ ID NOS: 1-104, or an amino acid sequence substantially identical thereto (e.g., an amino acid sequence at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or higher identity to any one of SEQ ID NOS: 1-104, or having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more amino acid alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to any one of SEQ ID NOS: 1-104.
- the IFM comprises no more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to any one of SEQ ID NOS: 1-104.
- domain 24 hBC8(23) light- Humanized BC8(23) light-chain variable chain variable domain.
- domain 33 Leader-1 Leader sequence (e.g. signal sequence, signal peptide) used for antibody light- chain, IL-15, N-terminal IL-15 fusions, and N-terminal fusion of sushi to Fab-light-chain.
- 34 Leader-2 Leader sequence (e.g. signal sequence, signal peptide) used for antibody heavy-chain.
- Linker-1 (L1) (G4S)3 linker 37 Linker-2 (L2) (G3S)2 linker 38 Linker-3 (L3) Linker derived from IgG1 hinge 39 Linker-4 (L4) Linker for fusing IL-15 to C-terminus of BC8-scFv 40 Human IL-15 Genbank Accession No. CAA62616.1 full sequence 41 Human IL-15R ⁇ Genbank Accession No. AAI21141.1 full sequence 42 IL-7 full Genbank Accession No. AAA59156, sequence AAC63047. And NP_000871, and UniProtKB/Swiss-Prot- P13232 43 IL-7 mature sequence 44 IL-21 full Genbank Accession No.
- AAG29348, sequence AAH66262, AAH69124, and EAX05226 45 IL-21 mature sequence 46 IL-12A full Genbank Accession No. P29459 sequence (also referred to as IL-12p35) 47 IL-12A mature sequence 48 IL-12B full Genbank Accession No.
- P29460 sequence (also referred to as IL-12p40) 49 IL-12B mature sequence 50 scIL-12p70-BA Synthetic sequence; IL-12B and IL-12A joined by flexible linker 51 scIL-12p70-AB Synthetic sequence; IL-12A and IL-12B joined by flexible linker 52
- Minimal sushi domain 53 IgG1-Fc Fc domain (CH2 and CH3 domains) from human IgG1 54
- IgG2-Fc Fc domain (CH2 and CH3 domains) from human IgG2 55
- IgG2Da-Fc Fc domain from human IgG2 containing two point mutations 56 sushi-IgG2Da-Fc Sushi domain from IL-15R ⁇ fused to (also referred IgG2Da-Fc to as sushi- Fc2Da)
- BC8 heavy- chain variable domain 58
- BC8 light- chain variable domain 59 9.4 heavy- chain variable domain 60
- scIL-12p70-AB- Synthetic sequence IL-12A and IL-12B L5 joined by linker L5.
- 74 human immunoglobulin kappa constant domain 75 human immunoglobulin lambda constant 1 76 human immunoglobulin lambda constant 2 77 human immunoglobulin lambda constant 3 78 human immunoglobulin lambda constant 7 79 HC-h9.4Fab Heavy-chain of a humanized anti-CD45 antibody; contains humanized 9.4 (h9.4) heavy-chain variable domain and the CH1 domain from human IgG1 80 HC-h9.4Fab- Heavy-chain of a humanized anti-CD45 h9.4scFv antibody linked to a humanized anti- CD45 scFv; contains variable domain from h9.4 heavy-chain and the CH1 domain from human IgG1.
- h9.4 scFv is genetically fused to the Fab heavy chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- Linker-1 SEQ ID NO: 36.
- a humanized BC8 (hBC8) scFv is genetically fused to the Fab heavy chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- LC-h9.4Fab- Light-chain of a humanized anti-CD45 scIL-12p70 antibody contains variable domain from h9.4 light-chain and human constant kappa domain, a wild-type single-chain human IL-12p70 (SEQ ID NO: 50) genetically fused to antibody light-chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36); single-chain human IL-12p70 comprises a genetic fusion of human IL-12A and IL-12B using a flexible linker (Linker-5; SEQ ID NO: 70).
- HC-chM1Fab Heavy-chain of chimeric M1 (chM1) anti-CD45 antibody contains variable domain from rat monoclonal antibody clone M1/0.3.4.HL.2 (M1) heavy-chain and the CH1 domain from human IgG1.
- LC-chM1Fab- Light-chain of chM1 anti-CD45 scIL-12p70 antibody contains variable domain from rat monoclonal antibody clone M1/0.3.4.HL.2 (M1), light-chain and human constant kappa domain, and a wild-type single-chain mouse IL-12p70 genetically fused to antibody light- chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36); single-chain mouse IL-12p70 comprises a genetic fusion of mouse IL-12A(p40) and IL-12B(p35) using a flexible linker (Linker-6, SEQ ID NO: 71).
- LC-chM1Fab- Light-chain of chM1 anti-CD45 IL-15 antibody contains variable domain from rat monoclonal antibody clone M1/0.3.4.HL.2 (M1) light-chain and human constant kappa domain; contains wild-type human IL-15 genetically fused to antibody light-chain C- terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- Linker-1 SEQ ID NO: 36
- HC-chM1Fab- Heavy-chain of chM1 anti-CD45 M1scFv antibody contains variable domain from rat monoclonal antibody clone M1/0.3.4.HL.2 heavy-chain and the CH1 domain from human IgG1.
- An M1 scFv is genetically fused to the Fab heavy chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- Linker-1 SEQ ID NO: 36.
- LC-chY169Fab- Light-chain of chimeric YTS 169.4.2.1 IL-15 anti-CD8 antibody contains variable domain from rat monoclonal antibody Y169 light-chain and human constant kappa domain; contains wild-type human IL-15 genetically fused to antibody light- chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- Linker-1 SEQ ID NO: 36
- M1scFv anti-CD8 antibody contains variable domain from rat monoclonal antibody Y169 heavy-chain and the CH1 domain from human IgG1.
- An M1/0.3.4.HL.2 scFv is genetically fused to the Fab heavy chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- Linker-1 SEQ ID NO: 36
- 90 LC-chY169Fab- Light-chain of chimeric YTS 169.4.2.1 scIL-12p70 anti-CD8 antibody contains variable domain from rat monoclonal antibody Y169 light-chain and human constant kappa domain; contains a single-chain mouse IL-12 genetically fused to antibody light-chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- scFv comprising a humanized 9.4 antibody; heavy-chain and light-chain variable domains are genetically fused using a flexible linker (Linker-6; SEQ ID NO: 71).
- VH-h9.4 Heavy-chain variable domain of a humanized 9.4 variant 95 VL-h9.4 Light-chain variable domain of a humanized 9.4 variant.
- LC-h9.4Fab- Light-chain of a humanized anti-CD45 scIL-12p70AB antibody contains variable domain from h9.4 light-chain and human constant kappa domain; contains a single-chain human IL-12p70 (SEQ ID NO: 51) genetically fused to antibody light-chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36); single-chain human IL-12p70 comprises a genetic fusion of human IL-12A and IL-12B using a flexible linker (Linker-5; SEQ ID NO: 70).
- LC-h9.4Fab- Light-chain of a humanized anti-CD45 IL-12A antibody contains variable domain from h9.4 light-chain and human constant kappa domain; contains a human IL-12A (SEQ ID NO: 47) genetically fused to antibody light- chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- 104 LC-h9.4Fab- Light-chain of a humanized anti-CD45 IL-12B antibody contains variable domain from h9.4 light-chain and human constant kappa domain; contains a human IL-12B (SEQ ID NO: 49) genetically fused to antibody light- chain C-terminus using a flexible linker (Linker-1, SEQ ID NO: 36).
- Full length polypeptides and variants thereof are described below.
- Full-length IL-15 sequence (SEQ ID NO: 40) is taken from Genbank Accession No. CAA62616.1; mature IL-15 is devoid of the signal sequence and is defined in SEQ ID NO: 10.
- Full-length IL-15Ra (SEQ ID NO: 41) is taken from Genbank Accession No. AAI21141.1.
- the sushi domain of IL-15Ra (IL-15R ⁇ -sushi) is given by SEQ ID NO: 9.
- a minimal sushi domain encompassing the first and fourth cysteines and the intervening amino acids (SEQ ID NO: 52) have also been described elsewhere and are plausible substitutes.
- optional N-terminal additions to the minimal sushi domain comprising the native Thr or Ile-Thr and/or optional C-terminal additions to the minimal sushi domain comprising Ile or Ile-Arg residues are also plausible.
- Protein variants described below specify protein subunit names and SEQ ID NOs corresponding to the mature proteins. Each protein subunit was recombinantly expressed with an N-terminal signal peptide to facilitate secretion from the expressing cell.
- the native IL-15Ra signal peptide (SEQ ID NO: 35) was used for sushi, sushi-L77I-Fc, and sushi-Fc.
- the leader sequence in SEQ ID NO: 33 was used to support secretion of antibody light-chains, IL15-WT, N-terminal IL-15 fusions, IL15-N72D, and N-terminal fusion of sushi to Fab-light-chain.
- the leader sequence in SEQ ID NO: 34 was used to support secretion of antibody heavy chains.
- variable light-chain domain and constant kappa domain and cytokine fusion comprise the “light-chain” while the variable heavy-chain domain and CH1 domain comprises the “heavy-chain”.
- chBC8-IL15/sushi Fab (Also referred to as chBC8-L1-IL15/sushi Fab).
- This protein was made by coexpression of three subunits: HC-chBC8-Fab (SEQ ID NO: 5), LC-chBC8-IL15 (SEQ ID NO: 3), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric BC8 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- the chimeric BC8 Fab is an anti-human CD45R antibody Fab fragment comprising variable-heavy and variable-light chain domains (VH and VL) from the parental mouse monoclonal antibody (mAb) and constant domains from human (human constant kappa domain and human IgG1-CH1 domain).
- This protein was made by coexpression of three subunits: HC-chBC8-Fab (SEQ ID NO: 5), IL15-LC-chBC8 (SEQ ID NO: 4), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of IL-15 to the N-terminus of the chimeric BC8 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- This protein was made by coexpression of three subunits: HC-chBC8-Fab (SEQ ID NO: 5), LC-chBC8-sushi (SEQ ID NO: 1), and IL15-N72D (SEQ ID NO: 11).
- the resulting protein comprises a fusion of IL-15R ⁇ -sushi to the C-terminus of the chimeric BC8 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association between IL15-N72D and IL-15R ⁇ -sushi.
- This protein was made by coexpression of three subunits: HC-chBC8-Fab (SEQ ID NO: 5), sushi-LC-chBC8 (SEQ ID NO: 2), and IL15-N72D (SEQ ID NO: 11).
- the resulting protein comprises a fusion of IL-15R ⁇ -sushi to the N-terminus of the chimeric BC8 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association between IL15-N72D and IL-15R ⁇ -sushi.
- This protein was made by coexpression of three subunits: HC-chBC8-IgG4S228P (SEQ ID NO: 6), LC-chBC8-IL15 (SEQ ID NO: 3), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric BC8 IgG-S228P light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- the chimeric BC8 IgG4-S228P is an anti-human CD45R antibody comprising variable-heavy and variable-light chain domains (VH and VL) from the parental mouse mAb and constant domains from human (human constant kappa domain and human IgG4 containing an S228P point mutation, which reduces susceptibility of Fab-arm-exchange of IgG4).
- VH and VL variable-heavy and variable-light chain domains
- This protein was made by coexpression of three subunits: HC-chBC8-IgG4S228P (SEQ ID NO: 6), IL15-LC-chBC8 (SEQ ID NO: 4), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the N-terminus of the chimeric BC8 IgG4-S228P light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- This protein was made by coexpression of three subunits: HC-chBC8-IgG4S228P (SEQ ID NO: 6), LC-chBC8-sushi (SEQ ID NO: 1), and IL15-N72D (SEQ ID NO: 11).
- the resulting protein comprises a fusion of IL-15R ⁇ -sushi to the C-terminus of the chimeric BC8 IgG4-S228P light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association with between IL-15R ⁇ -sushi and IL-15.
- This protein was made by coexpression of three subunits: HC-chBC8-IgG4S228P (SEQ ID NO: 6), sushi-LC-chBC8 (SEQ ID NO: 2), and IL15-N72D (SEQ ID NO: 11).
- the resulting protein comprises a fusion of IL-15R ⁇ -sushi to the N-terminus of the chimeric BC8 IgG4-S228P light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association with between IL-15R ⁇ -sushi and IL-15.
- This protein was made by coexpression of three subunits: HC-chBC8-IgG4S228P-IL15 (SEQ ID NO: 8), LC-chBC8 (SEQ ID NO: 7), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of IL-15 to the C-terminus of the chimeric BC8 IgG4-S228P heavy-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association with between IL-15 and IL-15R ⁇ -sushi.
- BC8scFv-IL15 SEQ ID NO: 32
- IL-15R ⁇ -sushi SEQ ID NO: 9
- the resulting protein comprises a fusion of IL-15 to the C-terminus of BC8-scFv using linker-L1 (SEQ ID NO: 36), and a noncovalent association with between IL-15 and IL-15R ⁇ -sushi.
- BC8-scFv comprises the variable domains from the parental mouse mAb joined by a flexible linker.
- This protein was made by coexpression of two subunits: IL15-N72D (SEQ ID NO: 11) and sushi-L77I-Fc (SEQ ID NO: 12).
- the resulting protein comprises IL-15R ⁇ -sushi containing an L77I mutation fused to the N-terminus of human IgG1-Fc region, and a noncovalent association with between IL15-N72D and IL-15R ⁇ -sushi.
- This protein was made by coexpression of two subunits: IL15-WT (SEQ ID NO: 10) and sushi-Fc (SEQ ID NO: 13).
- the resulting protein comprises a fusion of IL-15R ⁇ -sushi to the N-terminus of human IgG1-Fc region, and a noncovalent association with between IL15-WT and IL-15R ⁇ -sushi.
- This protein was made by coexpression of two subunits: IL15-WT (SEQ ID NO: 10) and sushi-IgG2Da-Fc (SEQ ID NO: 56).
- the resulting protein comprises a fusion of IL-15R ⁇ -sushi to the N-terminus of human IgG2Da-Fc region, and a noncovalent association with IL15-WT (via interaction with IL-15R ⁇ -sushi).
- This protein was made by coexpression of three subunits: HC-ch9.4-Fab (SEQ ID NO: 14), LC-ch9.4-IL15 (SEQ ID NO: 15), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric 9.4 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- the chimeric 9.4 Fab is an anti-CD45R antibody Fab fragment comprising variable-heavy and variable-light chain domains (VH and VL) from the parental mouse mAb (corresponding to ATCC hybridoma HB-10508) and constant domains from human (human constant kappa domain and human IgG1-CH1 domain).
- This protein was made by coexpression of three subunits: HC-ch4B2-IL15 (SEQ ID NO: 16), LC-ch4B2-IL15 (SEQ ID NO: 17), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric 4B2 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- the chimeric 4B2 Fab is an anti-CD45R antibody Fab fragment comprising variable-heavy and variable-light chain domains (VH and VL) from the parental mouse mAb (corresponding to ATCC hybridoma HB-11186) and constant domains from human (human constant kappa domain and human IgG1-CH1 domain).
- This protein was made by coexpression of three subunits: HC-hBC8(23)-Fab (SEQ ID NO: 18), LC-hBC8(23)-IL15 (SEQ ID NO: 19), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the humanized BC8 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- the humanized BC8(23) Fab is an anti-CD45R antibody Fab fragment comprising variable-heavy and variable-light chain domains (VH and VL) humanized from the parental mouse mAb and constant domains from human (human constant kappa domain and human IgG1-CH1 domain).
- VH and VL variable-heavy and variable-light chain domains
- This protein was made by coexpression of three subunits: HC-chBC8(23)-null-Fab (SEQ ID NO: 20), LC-hBC8(23)-IL15 (SEQ ID NO: 19), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the humanized BC8 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- This protein differs from hBC8(23)-IL15/sushi Fab in that its heavy chain contains a GGGS substitution within the CDR-H3 loop, which results in ablated binding affinity towards CD45R (hence, the designation as “null” binding variant).
- This IL15 fusion protein thus serves as a negative control for the effect of CD45R engagement.
- This protein was made by coexpression of three subunits: HC-chBC8-Fab (SEQ ID NO: 5), LC-chBC8-L2-IL15 (SEQ ID NO: 21), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of IL-15 to the N-terminus of the chimeric BC8 Fab fragment light-chain using linker-L2 (SEQ ID NO: 37), and a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- This protein was made by coexpression of three subunits: HC-chBC8-Fab (SEQ ID NO: 5), LC-chBC8-L3-IL15 (SEQ ID NO: 22), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of IL-15 to the N-terminus of the chimeric BC8 Fab fragment light-chain using linker-L3 (SEQ ID NO: 38), and a noncovalent association between IL-15 and IL-15R ⁇ -sushi.
- This protein was made by coexpression of three subunits: HC-chMHM24-Fab (SEQ ID NO: 26), LC-MHM24-IL15 (SEQ ID NO: 27), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric MHM24 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- the chimeric MHM24 Fab is an anti-human CD11a antibody Fab fragment comprising variable-heavy and variable-light chain domains (VH and VL) from the parental mouse mAb and constant domains from human (human constant kappa domain and human IgG1-CH1 domain).
- This protein was made by coexpression of three subunits: HC-ch1B4-Fab (SEQ ID NO: 28), LC-ch1B4-IL15 (SEQ ID NO: 29), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric 1B4 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- the chimeric 1B4 Fab is an anti-human CD18 antibody Fab fragment comprising variable-heavy and variable-light chain domains (VH and VL) from the parental mouse mAb and constant domains from human (human constant kappa domain and human IgG1-CH1 domain).
- This protein was made by coexpression of three subunits: HC-chOKT8-Fab (SEQ ID NO: 30), LC-chOKT8-IL15 (SEQ ID NO: 31), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric OKT8 Fab fragment light-chain using linker-L1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- the chimeric OKT8 Fab is an anti-human CD8 antibody Fab fragment comprising variable-heavy and variable-light chain domains (VH and VL) from the parental mouse mAb and constant domains from human (human constant kappa domain and human IgG1-CH1 domain).
- This protein was made by coexpression of two subunits: HC-h9.4Fab (SEQ ID NO: 79) and LC-h9.4Fab-scIL-12p70 (SEQ ID NO: 82).
- the resulting protein comprises a fusion of a single-chain human IL-12p70 to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36).
- the h9.4 Fab is an anti-human CD45R antibody Fab fragment comprising variable-heavy and variable-light chain domains (VH and VL) from h9.4 and constant domains from human (human constant kappa domain and human IgG1-CH1 domain).
- This protein was made by coexpression of two subunits: HC-h9.4Fab-h9.4scFv (SEQ ID NO: 80) and LC-h9.4Fab-scIL-12p70 (SEQ ID NO: 82).
- the resulting protein comprises a fusion of a single-chain human IL-12p70 to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an h9.4 scFv to the h9.4 Fab fragment heavy-chain using Linker-1.
- This protein was made by coexpression of two subunits: HC-h9.4Fab-hBC8scFv (SEQ ID NO: 81) and LC-h9.4Fab-scIL-12p70 (SEQ ID NO: 82).
- the resulting protein comprises a fusion of a single-chain human IL-12p70 to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an hBC8 scFv to the h9.4 Fab fragment heavy-chain using Linker-1 (SEQ ID NO: 36).
- This protein is made by coexpression of two subunits: HC-h9.4Fab (SEQ ID NO: 79) and LC-h9.4Fab-scIL-12p70AB (SEQ ID NO: 102).
- the resulting protein comprises a fusion of a single-chain human IL-12p70 to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36).
- This protein is made by coexpression of two subunits: HC-h9.4Fab-h9.4scFv (SEQ ID NO: 80) and LC-h9.4Fab-scIL-12p70AB (SEQ ID NO: 102).
- the resulting protein comprises a fusion of a single-chain human IL-12p70 to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an h9.4 scFv to the h9.4 Fab fragment heavy-chain using Linker-1.
- This protein is made by coexpression of two subunits: HC-h9.4Fab-hBC8scFv (SEQ ID NO: 81) and LC-h9.4Fab-scIL-12p70AB (SEQ ID NO: 102).
- the resulting protein comprises a fusion of a single-chain human IL-12p70 to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an hBC8 scFv to the h9.4 Fab fragment heavy-chain using Linker-1 (SEQ ID NO: 36).
- This protein is made by coexpression of three subunits: HC-h9.4Fab (SEQ ID NO: 79), LC-h9.4Fab-IL-12A (SEQ ID NO: 103), and IL-12B (SEQ ID NO: 49).
- the resulting protein comprises a fusion of a human IL-12A to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36).
- the full IL-12p70 is formed by association between IL-12A and IL-12B.
- This protein is made by coexpression of three subunits: HC-h9.4Fab-h9.4scFv (SEQ ID NO: 80), LC-h9.4Fab-IL-12A (SEQ ID NO: 103), and IL-12B (SEQ ID NO: 49).
- the resulting protein comprises a fusion of a human IL-12A to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an h9.4 scFv to the h9.4 Fab fragment heavy-chain using Linker-1.
- the full IL-12p70 is formed by association between IL-12A and IL-12B.
- This protein is made by coexpression of three subunits: HC-h9.4Fab-hBC8scFv (SEQ ID NO: 81), LC-h9.4Fab-IL-12A (SEQ ID NO: 103), and IL-12B (SEQ ID NO: 49).
- the resulting protein comprises a fusion of a human IL-12A to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an hBC8 scFv to the h9.4 Fab fragment heavy-chain using Linker-1 (SEQ ID NO: 36).
- the full IL-12p70 is formed by association between IL-12A and IL-12B.
- This protein is made by coexpression of three subunits: HC-h9.4Fab (SEQ ID NO: 79), LC-h9.4Fab-IL-12B (SEQ ID NO: 104), and IL-12A (SEQ ID NO: 47).
- the resulting protein comprises a fusion of a human IL-12B to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36).
- the full IL-12p70 is formed by association between IL-12B and IL-12A.
- This protein is made by coexpression of three subunits: HC-h9.4Fab-h9.4scFv (SEQ ID NO: 80), LC-h9.4Fab-IL-12B (SEQ ID NO: 104), and IL-12A (SEQ ID NO: 47).
- the resulting protein comprises a fusion of a human IL-12B to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an h9.4 scFv to the h9.4 Fab fragment heavy-chain using Linker-1.
- the full IL-12p70 is formed by association between IL-12B and IL-12A.
- This protein is made by coexpression of three subunits: HC-h9.4Fab-hBC8scFv (SEQ ID NO: 81), LC-h9.4Fab-IL-12B (SEQ ID NO: 104), and IL-12A (SEQ ID NO: 47).
- the resulting protein comprises a fusion of a human IL-12B to the C-terminus of h9.4 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an hBC8 scFv to the h9.4 Fab fragment heavy-chain using Linker-1 (SEQ ID NO: 36).
- the full IL-12p70 is formed by association between IL-12B and IL-12A.
- This protein was made by coexpression of two subunits: HC-chM1Fab (SEQ ID NO: 83) and LC-chM1Fab-scIL-12p70 (SEQ ID NO: 84).
- the resulting protein comprises a fusion of a single-chain mouse IL-12p70 to the C-terminus of chM1 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36).
- This protein was made by coexpression of two subunits: HC-chM1Fab-M1scFv (SEQ ID NO: 86) and LC-chM1Fab-scIL-12p70 (SEQ ID NO: 84).
- the resulting protein comprises a fusion of a single-chain mouse IL-12p70 to the C-terminus of chM1 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36) and a fusion of an M1 scFv to the chM1 Fab fragment heavy-chain using Linker-1 (SEQ ID NO: 36).
- This protein was made by co-expression of three subunits: HC-chM1Fab (SEQ ID NO: 83), LC-chM1Fab-IL-15 (SEQ ID NO: 85), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type human IL-15 to the C-terminus of chM1 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- This protein was made by coexpression of three subunits: HC-chM1Fab-M1scFv (SEQ ID NO: 86) and LC-chM1Fab-IL-15 (SEQ ID NO: 85), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type human IL-15 to the C-terminus of chM1 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36), a fusion of an M1 scFv to the chM1 Fab fragment heavy-chain using Linker-1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- This protein was made by coexpression of three subunits: HC-chY169Fab (SEQ ID NO: 87), LC-chY169Fab-IL-15 (SEQ ID NO: 88), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric Y169 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- This protein was made by coexpression of three subunits: HC-chY169Fab-M1scFv (SEQ ID NO: 89), LC-chY169Fab-IL-15 (SEQ ID NO: 88), and IL-15R ⁇ -sushi (SEQ ID NO: 9).
- the resulting protein comprises a fusion of wild-type IL-15 to the C-terminus of the chimeric Y169 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36), a fusion of M1 scFv to the chY169 Fab fragment heavy-chain using Linker-1 (SEQ ID NO: 36), and a noncovalent association with IL-15R ⁇ -sushi (via interaction with IL-15).
- This protein was made by coexpression of two subunits: HC-chY169Fab-M1scFv (SEQ ID NO: 89) and LC-chY169Fab-scIL-12p70 (SEQ ID NO: 90).
- the resulting protein comprises a fusion of a single-chain mouse IL-12p70 to the C-terminus of the chimeric Y169 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36), and a fusion of M1 scFv to the chY169 Fab fragment heavy-chain using Linker-1 (SEQ ID NO: 36).
- This protein was made by coexpression of two subunits: HC-chY169Fab-(SEQ ID NO: 87) and LC-chY169Fab-scIL-12p70 (SEQ ID NO: 90).
- the resulting protein comprises a fusion of a single-chain mouse IL-12p70 to the C-terminus of the chimeric Y169 Fab fragment light-chain using Linker-1 (SEQ ID NO: 36).
- the disclosure also features nucleic acids comprising nucleotide sequences that encode the immunostimulatory fusion molecules described herein.
- vectors comprising the nucleotide sequences encoding an IFMs and the antibody molecule described herein.
- the vectors comprise nucleotides encoding the IFMs and the antibody molecules described herein.
- the vectors comprise the nucleotide sequences described herein.
- the vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC). Numerous vector systems can be employed.
- one class of vectors utilizes DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
- Another class of vectors utilizes RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern Equine Encephalitis virus and Flaviviruses.
- cells which have stably integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow for the selection of transfected host cells.
- the marker may provide, for example, prototropy to an auxotrophic host, biocide resistance (e.g., antibiotics), or resistance to heavy metals such as copper, or the like.
- the selectable marker gene can be either directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include splice signals, as well as transcriptional promoters, enhancers, and termination signals.
- the expression vectors may be transfected or introduced into an appropriate host cell.
- Various techniques may be employed to achieve this, such as, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid based transfection or other conventional techniques.
- protoplast fusion the cells are grown in media and screened for the appropriate activity.
- Methods and conditions for culturing the resulting transfected cells and for recovering the antibody molecule produced are known to those skilled in the art, and may be varied or optimized depending upon the specific expression vector and mammalian host cell employed, based upon the present description.
- the application features host cells and vectors containing the nucleic acids described herein.
- the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell.
- the host cell can be a eukaryotic cell, e.g., a mammalian cell, an insect cell, a yeast cell, or a prokaryotic cell, e.g., E. coli .
- the mammalian cell can be a cultured cell or a cell line.
- Exemplary mammalian cells include lymphocytic cell lines (e.g., NSO), Chinese hamster ovary cells (CHO), COS cells, oocyte cells, and cells from a transgenic animal, e.g., mammary epithelial cell.
- lymphocytic cell lines e.g., NSO
- CHO Chinese hamster ovary cells
- COS cells e.g., COS cells
- oocyte cells e.g., oocyte cells
- cells from a transgenic animal e.g., mammary epithelial cell.
- the disclosure also provides host cells comprising a nucleic acid encoding an antibody molecule as described herein.
- the host cells are genetically engineered to comprise nucleic acids encoding the antibody molecule.
- the host cells are genetically engineered by using an expression cassette.
- expression cassette refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences. Such cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.
- the disclosure also provides host cells comprising the vectors described herein.
- the cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell.
- Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells.
- Suitable insect cells include, but are not limited to, Sf9 cells.
- compositions including pharmaceutical compositions, comprising the immunostimulatory fusion molecules are provided herein.
- a composition can be formulated in pharmaceutically-acceptable amounts and in pharmaceutically-acceptable compositions.
- pharmaceutically acceptable means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredients (e.g., biologically-active proteins of the nanoparticles).
- Such compositions may, in some embodiments, contain salts, buffering agents, preservatives, and optionally other therapeutic agents.
- Pharmaceutical compositions also may contain, in some embodiments, suitable preservatives.
- Pharmaceutical compositions may, in some embodiments, be presented in unit dosage form and may be prepared by any of the methods well-known in the art of pharmacy.
- compositions suitable for parenteral administration comprise a sterile aqueous or non-aqueous preparation of the nanoparticles, which is, in some embodiments, isotonic with the blood of the recipient subject.
- This preparation may be formulated according to known methods.
- a sterile injectable preparation also may be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent.
- compositions include modified cells, such as modified immune cells further comprising one or more tethered fusions proteins on their cell surface.
- modified cells such as modified immune cells further comprising one or more tethered fusions proteins on their cell surface.
- This can be useful for ex vivo preparation of a cell therapy such as an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, a tumor infiltrating lymphocyte therapy, an antigen-trained T cell therapy, an enriched antigen-specific T cell therapy, or an NK cell therapy.
- the IFM of the present disclosure can be administered directly to a patient in need thereof, e.g., in the form of a nanogel or hydrogel or biogel, as agents for specific delivery of therapeutic proteins via receptor mediated binding of receptors unique to specific cells (e.g., CD4 or CD8).
- Such direct administration can be systemic (e.g., parenteral such as intravenous injection or infusion) or local (e.g., intratumoral, e.g., injection into the tumor microenvironment).
- parenteral administration and “administered parenterally” as used herein refer to modes of administration other than enteral (i.e., via the digestive tract) and topical administration, usually by injection or infusion, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection, and infusion.
- the IFM of the present disclosure can be used as ex vivo agents to induce activation and expansion of isolated autologous and allogenic cells prior to administration or reintroduction to a patient, via systemic or local administration.
- the expanded cells can be used in T cell therapies including ACT (adoptive cell transfer) and also with other important immune cell types, including for example, B cells, tumor infiltrating lymphocytes, NK cells, antigen-specific CD8 T cells, T cells genetically engineered to express chimeric antigen receptors (CARs) or CAR-T cells, T cells genetically engineered to express T-cell receptors specific to an tumor antigen, tumor infiltrating lymphocytes (TILs), and/or antigen-trained T cells (e.g., T cells that have been “trained” by antigen presenting cells (APCs) displaying antigens of interest, e.g. tumor associated antigens (TAA)).
- T cell therapies including ACT (adoptive cell transfer) and also with other important immune
- the immunostimulatory fusion molecules and compositions containing such have numerous therapeutic utilities, including, e.g., the treatment of cancers and infectious diseases.
- the present disclosure provides, inter alia, methods for inducing an immune response in a subject with a cancer in order to treat the subject having cancer. Exemplary methods comprise administering to the subject a therapeutically effective amount of any of the immunostimulatory fusion molecules described herein, wherein the IFM has been selected and designed to increase the cell surface availability of a cytokine and consequently potentiate its signaling.
- Methods described herein include treating a cancer in a subject by using an IFM, e.g., an IFM or a nanoparticle comprising the IFM as described herein, e.g., using a pharmaceutical composition described herein. Also provided are methods for reducing or ameliorating a symptom of a cancer in a subject, as well as methods for inhibiting the growth of a cancer and/or killing one or more cancer cells. In embodiments, the methods described herein decrease the size of a tumor and/or decrease the number of cancer cells in a subject administered with a described herein or a pharmaceutical composition described herein.
- the cancer is a hematological cancer.
- the hematological cancer is a leukemia or a lymphoma.
- a “hematologic cancer” refers to a tumor of the hematopoietic or lymphoid tissues, e.g., a tumor that affects blood, bone marrow, or lymph nodes.
- Exemplary hematologic malignancies include, but are not limited to, leukemia (e.g., acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), hairy cell leukemia, acute monocytic leukemia (AMoL), chronic myelomonocytic leukemia (CMML), juvenile myelomonocytic leukemia (JMML), or large granular lymphocytic leukemia), lymphoma (e.g., AIDS-related lymphoma, cutaneous T-cell lymphoma, Hodgkin lymphoma (e.g., classical Hodgkin lymphoma or nodular lymphocyte-predominant Hodgkin lymphoma), mycosis fungoides, non-Hodgkin lymphoma (e.g., B-cell non-Hodgkin lymphoma (e
- the cancer is a solid cancer.
- Exemplary solid cancers include, but are not limited to, ovarian cancer, rectal cancer, stomach cancer, testicular cancer, cancer of the anal region, uterine cancer, colon cancer, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell carcinoma of the lung, cancer of the small intestine, cancer of the esophagus, melanoma, Kaposi's sarcoma, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, brain stem glioma, pituitary adenoma, epidermoid cancer, carcinoma of the cervix squamous cell cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the vagina, sarcoma of soft tissue, cancer of the urethr
- the immunostimulatory fusion molecules are administered in a manner appropriate to the disease to be treated or prevented.
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease. Appropriate dosages may be determined by clinical trials. For example, when “an effective amount” or “a therapeutic amount” is indicated, the precise amount of the pharmaceutical composition (or immunostimulatory fusion molecules) to be administered can be determined by a physician with consideration of individual differences in tumor size, extent of infection or metastasis, age, weight, and condition of the subject.
- the pharmaceutical composition described herein can be administered at a dosage of 10 4 to 10 9 cells/kg body weight, e.g., 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. In embodiments, the pharmaceutical composition described herein can be administered multiple times at these dosages. In embodiments, the pharmaceutical composition described herein can be administered using infusion techniques described in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988).
- the immunostimulatory fusion molecules or pharmaceutical composition is administered to the subject parenterally.
- the cells are administered to the subject intravenously, subcutaneously, intratumorally, intranodally, intramuscularly, intradermally, or intraperitoneally.
- the cells are administered, e.g., injected, directly into a tumor or lymph node.
- the cells are administered as an infusion (e.g., as described in Rosenberg et al., New Eng. J. of Med. 319:1676, 1988) or an intravenous push.
- the cells are administered as an injectable depot formulation.
- the subject is a mammal.
- the subject is a human, monkey, pig, dog, cat, cow, sheep, goat, rabbit, rat, or mouse.
- the subject is a human.
- the subject is a pediatric subject, e.g., less than 18 years of age, e.g., less than 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 or less years of age.
- the subject is an adult, e.g., at least 18 years of age, e.g., at least 19, 20, 21, 22, 23, 24, 25, 25-30, 30-35, 35-40, 40-50, 50-60, 60-70, 70-80, or 80-90 years of age.
- immunostimulatory fusion molecules disclosed herein can be used in combination with a second therapeutic agent or procedure.
- the immunostimulatory fusion molecule is administered in combination with radiotherapy.
- the immunostimulatory fusion molecule is administered in conjunction with a cell therapy, e.g., a cell therapy chosen from an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, a tumor infiltrating lymphocyte therapy, an antigen-trained T cell therapy, or an enriched antigen-specific T cell therapy.
- a cell therapy e.g., a cell therapy chosen from an adoptive cell therapy, CAR-T cell therapy, engineered TCR T cell therapy, a tumor infiltrating lymphocyte therapy, an antigen-trained T cell therapy, or an enriched antigen-specific T cell therapy.
- the immunostimulatory fusion molecule and the second therapeutic agent or procedure are administered/performed after a subject has been diagnosed with a cancer, e.g., before the cancer has been eliminated from the subject.
- the immunostimulatory fusion molecule and the second therapeutic agent or procedure are administered/performed simultaneously or concurrently.
- the delivery of one treatment is still occurring when the delivery of the second commences, e.g., there is an overlap in administration of the treatments.
- the immunostimulatory fusion molecule and the second therapeutic agent or procedure are administered/performed sequentially. For example, the delivery of one treatment ceases before the delivery of the other treatment begins.
- combination therapy can lead to more effective treatment than monotherapy with either agent alone.
- the combination of the first and second treatment is more effective (e.g., leads to a greater reduction in symptoms and/or cancer cells) than the first or second treatment alone.
- the combination therapy permits use of a lower dose of the first or the second treatment compared to the dose of the first or second treatment normally required to achieve similar effects when administered as a monotherapy.
- the combination therapy has a partially additive effect, wholly additive effect, or greater than additive effect.
- the immunostimulatory fusion molecule is administered in combination with a therapy, e.g., a cancer therapy (e.g., one or more of anti-cancer agents, immunotherapy, photodynamic therapy (PDT), surgery and/or radiation).
- a cancer therapy e.g., one or more of anti-cancer agents, immunotherapy, photodynamic therapy (PDT), surgery and/or radiation.
- chemotherapeutic chemotherapeutic agent
- anti-cancer agent are used interchangeably herein.
- the administration of the immunostimulatory fusion molecule and the therapy can be sequential (with or without overlap) or simultaneous.
- Administration of the immunostimulatory fusion molecule can be continuous or intermittent during the course of therapy (e.g., cancer therapy).
- Certain therapies described herein can be used to treat cancers and non-cancerous diseases.
- PDT efficacy can be enhanced in cancerous and non-cancerous conditions (e.g., tuberculosis) using the methods and compositions described herein (reviewed in, e.g., Agostinis, P. et al. (2011) CA Cancer J. Clin. 61:250-281).
- the immunostimulatory fusion molecule is administered in combination with a low or small molecular weight chemotherapeutic agent.
- chemotherapeutic agents include, but not limited to, 13-cis-retinoic acid (isotretinoin, ACCUTANE®), 2-CdA (2-chlorodeoxyadenosine, cladribine, LEUSTATINTM), 5-azacitidine (azacitidine, VIDAZA®), 5-fluorouracil (5-FU, fluorouracil, ADRUCIL®), 6-mercaptopurine (6-MP, mercaptopurine, PURINETHOL®), 6-TG (6-thioguanine, thioguanine, THIOGUANINE TABLOID®), abraxane (paclitaxel protein-bound), actinomycin-D (dactinomycin, COSMEGEN®), alitretinoin (PANRETIN®), all-transretinoic acid (A)
- the immunostimulatory fusion molecule is administered in conjunction with a biologic.
- biologics include, e.g., HERCEPTIN® (trastuzumab); FASLODEX® (fulvestrant); ARIMIDEX® (anastrozole); Aromasin® (exemestane); FEMARA® (letrozole); NOLVADEX® (tamoxifen), AVASTIN® (bevacizumab); and ZEVALIN® (ibritumomab tiuxetan).
- IFMs comprising multiple formats: (i) IFMs comprising an IgG, Fab fragment, or scFv fragment, (ii) fusion to the N- or C-terminus of the antibody or antibody fragment; (iii) fusion of either IL-15 or the IL-15Ra sushi domain to the antibody or antibody fragment (e.g., FIG. 1 and FIGS. 2A-2C ); and (iv) IFMs comprising varied linker composition between the antibody and cytokine.
- IFMs comprising IL-15 and mAb clone BC8, which targets human CD45, an abundant receptor on the surface of immune cells (Cyster et al., EMBO Journal, Vol 10, no 4, 893-902, 1991).
- the IFMs comprised three different antibody formats: scFv, Fab, and full-length IgG.
- wild-type IL-15 was genetically fused to the C-terminus of the Fab or IgG light-chain using an amino acid linker consisting of (GGGGS)3 (SEQ ID NO: 36) or to the C-terminus of the scFv using the amino acid linker RSGSGGGGSLQ (SEQ ID NO: 39).
- the Fab and IgG antibody formats comprised human constant regions and variable domains from the mouse monoclonal antibody BC8 (e.g. chBC8 Fab or chBC8 IgG).
- the scFv comprised BC8 heavy- and light-chain variable domains genetically fused with a (GGGGS)3 linker.
- the IL-15/antibody fusions were co-expressed with IL-15R ⁇ -sushi; the high-affinity interaction between IL-15 and sushi resulted in an IL-15-antibody complex comprising a noncovalent association with IL-15R ⁇ -sushi. Together, this resulted in three IFM variants: chBC8-IL15/sushi scFv, chBC8-IL15/sushi Fab, and chBC8-IL15/sushi IgG ( FIG. 2A ; see Protein Variants section for more details).
- the effects of the IFMs on CD8 T cell expansion were evaluated using a pulse bioassay in which the cytokine is incubated with cells for a fixed amount of time followed by removal of unbound cytokine by washing.
- the pulse bioassay provides better characterization of the persistence of a biological effect. It also accommodates confounding factors associated with ligand-depletion, which is a well-appreciated challenge for quantitative analysis of high-affinity receptor/ligand interactions (Hulme, Tevethick, Ligand binding assays at equilibrium: validation and interpretation Br J Pharm 2010, 161:1219-1237).
- IFM immunodeficiency virus
- the first two IFMs were constructed by genetically fusing IL-15 to the N-terminus of chBC8 Fab or chBC8 IgG light-chains and the antibody fusions were co-expressed with IL-15Ra to result in the IFMs: IL15-chBC8/sushi Fab and IL15-chBC8/sushi IgG ( FIGS. 3A-3B ; see “Protein Variants” section for more details).
- chBC8-IL15 in Example 1A above and IL15-chBC8 here to refer to fusion of IL-15 to the antibody C- or N-terminus, respectively.
- the four additional IFMs were constructed by fusing wild-type IL-15R ⁇ -sushi to the N- or C-terminus of the chBC8 Fab or IgG light-chain, and co-expressed these antibody fusions with IL-15 1 ⁇ 72D ( FIGS.
- FIGS. 4A-4B and FIGS. 5A-5B We observed a trend in which fusion of IL-15 or sushi to the C-terminus of the chBC8 IgG or Fab resulted in greater CD8 T cell expansion than fusion to the antibody N-terminus ( FIGS. 4A-4B and FIGS. 5A-5B ).
- each of the IFM variants (including N-terminal fusion to the IgG or Fab) displayed greater potency than the control protein, IL15-N72D/sushiL77I-Fc, which does not contain CD45 receptor binding functionality ( FIGS. 3C-3D and FIGS. 4A-4B ).
- chimeric BC8 or the parental BC8 mouse mAb antibodies alone did not induce T cell expansion ( FIGS. 4A-4B and FIGS.
- IFMs Comprising IL-15 Fused to the C-Terminus of an Antibody Heavy Chain or Light Chain
- Wild-type IL-15 was genetically fused to the C-terminus of the chBC8 heavy-chain (HC) and this construct was co-expressed with IL15R ⁇ -sushi to yield the IFM variant chBC8(HC)-IL15/sushi IgG ( FIG. 6A ).
- chBC8(HC)-IL15/sushi IgG we compared chBC8(HC)-IL15/sushi IgG to the chBC8-IL15/sushi IgG described in the previous example, which comprises IL-15 fused to the light-chain C-terminus; for clarity we refer to this latter protein here as chBC8(LC)-IL15/sushi IgG in order to differentiate from the IFM comprising fusion to the heavy-chain C-terminus.
- Activated human CD8 T cells were pulsed with seven serial five-fold dilutions spanning 400 nM to 25.6 pM of chBC8(HC)-IL15/sushi IgG or chBC8-IL15(LC)/sushi IgG for 1 hr at 37° C., and then washed three times will full media and plated at 500,000 cells/mL. Serial dilution of media only, the parental BC8 antibody (which does not contain a fusion with IL-15), or IL-15 WT /sushi-Fc (which is devoid of immune-targeting function) were used as controls. Following 5 days of culture we measured CD8 T cell expansion using CellTiter Blue.
- the IFM with the functional BC8 region comprised a Fab antibody fragment with humanized BC8 variable domain, in which CDRs from the parental BC8 antibody were grafted onto human variable domains, and a fusion of IL-15 WT to the humanized BC8 Fab light-chain.
- This complex was co-expressed with IL-15R ⁇ -sushi to result in the IFM variant hBC8(23)-IL15/sushi Fab (see “Protein Variants” section for more details).
- the humanized BC8 antibody (hBC8(23)) possesses similar binding affinity as the chimeric BC8 antibody ( FIG. 10A ).
- the IFM with the nonfunctional BC8 region comprised the same Fab fragment, with the exception of five amino acids of CDR3 in the antibody heavy-chain, which were replaced with the residues SGGGS. These amino acid substitutions resulted in a humanized BC8 antibody that did not exhibit detectable binding to cellular CD45 for the concentrations tested ( FIG. 10A ).
- Each of these proteins were pulsed with activated human CD8 T cells (seven serial five-fold dilutions spanning a concentration range of 400 nM to 25.6 pM), cells were then washed and plated at 500,000 cells/mL in 96-well plates. Following three days at 37° C.
- CD8 T cells at a density of 5 ⁇ 10 7 cells/mL were pulsed with 0.75 mg/mL hBC8(23)-IL15/sushi Fab, IL-15/sushi-Fc2Da, or IL-15 N72D /sushiL77I-Fc for 1 hr in a 1:1 mixture of PBS and HBSS, and then washed three times with full media.
- Sushi-Fc2Da is a fusion of wild-type IL-15R ⁇ -sushi to a variant of the human IgG2-Fc domain.
- Cells were then stained for IL-15 using a fluorescently-labeled anti-IL-15 antibody or for IgG domains (Fab or Fc fragments) using a fluorescently-labeled polyclonal antibody that recognizes human IgG light and heavy chains.
- Fab or Fc fragments fluorescently-labeled polyclonal antibody that recognizes human IgG light and heavy chains.
- the hBC8(23)-IL15/sushi Fab protein yielded substantially higher levels of IL-15 staining than the IL15/sushi-Fc2Da or IL15-N72D/sushiL77I-Fc proteins indicating a greater abundance of IL-15 on the cell surface ( FIG. 8A ).
- FIG. 8A We observed consistent results for IgG staining in which the IFMs resulted in a higher levels of staining than the IL15/sushi-Fc constructs ( FIG. 8A ).
- IL-15 As a positive control for proliferative effects of IL-15 we added approximately 10 nM of IL15/sushi-Fc2Da to a mock pulse control (a “mock then saturating” condition); this corresponds to a concentration above the EC90 for IL-15/sushi-containing variants (see FIGS. 3A-3D ) and thus serves as a positive control for a maximal proliferative effect by IL-15.
- the cells were propagated in culture and monitored for IL-15 surface levels for three days following the pulse incubation.
- IL-15 detection remained above background for hBC8(23)-IL15/sushi Fab, while both of the IL15/sushi-Fc variants were indistinguishable from background one day after the pulse incubation ( FIG. 8B ).
- the pulse of hBC8(23)-IL15/sushi Fab further resulted in similar cell expansion to the saturating amount of the IL15/sushi-Fc variant ( FIG. 8C ).
- IL-15 antibody that we used (clone no. 34559, R&D Systems) likely binds to an epitope on IL-15 that at least partially overlaps with IL-15R13, and thus may detect IL-15 that is not already productively engaged with IL-15 signaling receptors.
- This antibody has been described as a blocking/neutralizing antibody by several groups (see e.g., Neely, G G, Robbins, Amankwah, et al.
- IL-15 is presented on the dendritic cell surface via its interaction with IL-15R ⁇ , and this antibody has been used previously to detect such a presentation of IL-15 on dendritic cells (Ferlazzo, Pack, Thomas, Paludan, et al PNAS 2004). Consistent with these observations, we are able to detect hBC8(23)-IL15/sushi Fab and IL15/sushi-Fc variants on the T cell surface using this antibody ( FIGS. 8A-8B ; each protein variant comprises an association between IL-15R ⁇ -sushi and IL-15).
- the antibody's neutralizing activity may therefore derive from competitive binding with one of the other two cell surface receptors for IL-15, IL-2/IL-15R ⁇ or the common ⁇ chain.
- detection of IL-15 with this antibody may reflect an excess loading of IL-15 onto the T cell surface beyond the levels that saturate its cell surface receptors, e.g. IL-2/IL-15R ⁇ or the common ⁇ chain.
- This may also explain the low levels of cell surface IL-15 detected for the IL-15/sushi-Fc constructs ( FIGS. 8A-8B ), which would only interact with T cells through the IL-15 receptors, though the dimeric IL-15 that results from association with the sushi-Fc fusion could result in a slight abundance of the cytokine.
- IFMs both facilitate greater initial loading of IL-15 on the T cell surface and support elevated levels of biologically available IL-15 on the cell surface over time.
- the IFMs explored in Example 1 each comprised a flexible 15 amino acid linker between IL-15 or sushi and the antibody consisting of three tandem repeats of (GGGGS)3; Linker-1, SEQ ID NO: 36).
- linker compositions including a flexible eight amino acid linker ((GGGS)2; Linker-2, SEQ ID NO: 37) and a moderately flexible 12 amino acid linker derived from the human IgG1 hinge region (DKTHTSPPSPAP; Linker-3, SEQ ID NO: 38, underlined positions denote residues of the IgG1 hinge region that were mutated from cysteine to serine for this linker).
- IL-15 WT was fused to the C-terminus of the chBC8 Fab fragment light-chain using Linker-2 or Linker-3 and was co-expressed with IL-15R ⁇ -sushi to generate chBC8-L2-IL15/sushi Fab and chBC8-L3-IL15/sushi Fab, respectively ( FIG. 9A ).
- this IFM variant comprises a (GGGGS)3 linker (Linker-1, SEQ ID NO: 36) between IL-15 and the chBC8 light-chain; for consistency we refer to this construct here as chBC8-L1-IL15/sushi Fab ( FIG. 9A ).
- Protein expression Proteins were produced from suspension adapted HEK 293 cells in serum-free media. An exception was the parental mouse monoclonal antibody BC8, which was purified from the BC8 hybridoma culture obtained from American Type Cell Culture (ATCC, cat. no. HB-10507). Proteins were then purified by either protein A resin (for Fc fusions and full-length (IgG) antibodies), KappaSelect resin (GE Healthcare; for fusions to antibody Fab fragments), or histidine affinity resin (e.g. nickel-nitrilotriacetic acid, Ni-NTA; for 6-His-tagged scFv fusions) as appropriate. Purified proteins were buffer exchanged into phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- CD8 T-cells isolated from human blood were activated with CD3/CD28 beads (Dynabeads cat. No. 11132D, ThermoFisher Scientific, Inc.) according to the manufacturer's instructions and in the presence of 10 ng/mL human IL-2 (cat. no. 202-IL-050/CF, R&D Systems) according to the manufacturer's instructions, plated in 6 well 9.5 cm2 plates in full RPMI media containing RPMI 1640 (cat. No.
- T-cells were then seeded into 96-well plates at 0.5 ⁇ 10 6 cells/mL in the presence of six serial four-fold dilution of IFMs or control proteins spanning a concentration range of 20 nM to 4.9 pM, unless otherwise indicated, or with media only as a negative control. Following three days at 37° C. and 5% CO 2 cell expansion was analyzed via CellTiter-Blue (cat. no. G8081, Promega).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Pharmacology & Pharmacy (AREA)
- Wood Science & Technology (AREA)
- Toxicology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Hematology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Mycology (AREA)
- Transplantation (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/628,363 US20200306301A1 (en) | 2017-07-03 | 2018-07-03 | Polynucleotides Encoding Immunostimulatory Fusion Molecules and Uses Thereof |
Applications Claiming Priority (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762528411P | 2017-07-03 | 2017-07-03 | |
| US201762598433P | 2017-12-13 | 2017-12-13 | |
| US201862620107P | 2018-01-22 | 2018-01-22 | |
| US201862620418P | 2018-01-22 | 2018-01-22 | |
| US201862657455P | 2018-04-13 | 2018-04-13 | |
| US16/628,363 US20200306301A1 (en) | 2017-07-03 | 2018-07-03 | Polynucleotides Encoding Immunostimulatory Fusion Molecules and Uses Thereof |
| PCT/US2018/040783 WO2019010222A2 (en) | 2017-07-03 | 2018-07-03 | POLYNUCLEOTIDES ENCODING IMMUNOSTIMULATING FUSION MOLECULES AND USES THEREOF |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20200306301A1 true US20200306301A1 (en) | 2020-10-01 |
Family
ID=64950351
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/628,363 Abandoned US20200306301A1 (en) | 2017-07-03 | 2018-07-03 | Polynucleotides Encoding Immunostimulatory Fusion Molecules and Uses Thereof |
| US16/628,374 Abandoned US20210017247A1 (en) | 2017-07-03 | 2018-07-03 | Fusion Molecules Targeting Immune Regulatory Cells and Uses Thereof |
| US16/628,342 Active US11471490B2 (en) | 2017-07-03 | 2018-07-03 | T cells surface-loaded with immunostimulatory fusion molecules and uses thereof |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/628,374 Abandoned US20210017247A1 (en) | 2017-07-03 | 2018-07-03 | Fusion Molecules Targeting Immune Regulatory Cells and Uses Thereof |
| US16/628,342 Active US11471490B2 (en) | 2017-07-03 | 2018-07-03 | T cells surface-loaded with immunostimulatory fusion molecules and uses thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (3) | US20200306301A1 (enExample) |
| EP (3) | EP3675892A4 (enExample) |
| JP (2) | JP2020530440A (enExample) |
| KR (1) | KR20200037781A (enExample) |
| CN (2) | CN111094330A (enExample) |
| AU (4) | AU2018297248A1 (enExample) |
| CA (3) | CA3069105A1 (enExample) |
| GB (1) | GB2580228B (enExample) |
| WO (3) | WO2019010224A1 (enExample) |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022179613A1 (en) * | 2021-02-26 | 2022-09-01 | Nanjing Legend Biotech Co., Ltd. | Engineered immune effector cells expressing exogenously introduced cytokines |
| US11471490B2 (en) | 2017-07-03 | 2022-10-18 | Torque Therapeutics, Inc. | T cells surface-loaded with immunostimulatory fusion molecules and uses thereof |
| WO2023091954A3 (en) * | 2021-11-19 | 2023-08-03 | The Trustees Of The University Of Pennsylvania | Engineered pan-leukocyte antigen cd45 to facilitate car t cell therapy |
| WO2023137466A3 (en) * | 2022-01-14 | 2023-09-21 | Qilu Puget Sound Biotherapeutics Corporation | Anti-ccr8 antibodies |
| WO2023201008A1 (en) * | 2022-04-13 | 2023-10-19 | President And Fellows Of Harvard College | Compositions and methods for localized delivery of cytokines for adoptive cell therapy |
| WO2023183927A3 (en) * | 2022-03-24 | 2023-11-09 | Actinium Pharmaceuticals, Inc. | Humanized anti-cd45 antibodies |
| US11845797B2 (en) | 2018-07-03 | 2023-12-19 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US12152073B2 (en) | 2018-03-14 | 2024-11-26 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| US12247060B2 (en) | 2018-01-09 | 2025-03-11 | Marengo Therapeutics, Inc. | Calreticulin binding constructs and engineered T cells for the treatment of diseases |
| US12343379B2 (en) | 2017-09-06 | 2025-07-01 | Yale University | Interleukin-18 variants and methods of use |
| US12358982B2 (en) | 2019-02-21 | 2025-07-15 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to T cell related cancer cells and uses thereof |
| US12384842B2 (en) | 2019-02-21 | 2025-08-12 | Marengo Therapeutics, Inc. | Antibody molecules that bind to NKP30 and uses thereof |
| US12486326B2 (en) | 2020-01-03 | 2025-12-02 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
Families Citing this family (77)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| TW202235438A (zh) | 2016-11-28 | 2022-09-16 | 日商中外製藥股份有限公司 | 能夠調節配體結合活性的配體結合分子 |
| MX2019005756A (es) | 2016-11-28 | 2019-08-14 | Chugai Pharmaceutical Co Ltd | Dominio de union al antigeno y polipeptido que incluye seccion de transporte. |
| JP7165717B2 (ja) | 2017-03-15 | 2022-11-04 | パンディオン・オペレーションズ・インコーポレイテッド | 標的免疫寛容 |
| AU2018273914A1 (en) | 2017-05-24 | 2019-11-14 | Pandion Operations, Inc. | Targeted immunotolerance |
| EP3658172A4 (en) | 2017-07-25 | 2021-05-05 | TrueBinding, Inc. | TREATING CANCER BY BLOCKING THE INTERACTION OF TIM-3 AND HIS LIGAND |
| TWI901940B (zh) | 2017-08-03 | 2025-10-21 | 美商安進公司 | 介白素-21突變蛋白及治療方法 |
| TWI880235B (zh) | 2017-11-28 | 2025-04-11 | 日商中外製藥股份有限公司 | 可調整配體結合活性的配體結合分子 |
| EP3719035A4 (en) | 2017-11-28 | 2021-09-01 | Chugai Seiyaku Kabushiki Kaisha | POLYPEPTIDE WITH ANTIGEN-BINDING AREA AND CARRYING SECTION |
| US10946068B2 (en) | 2017-12-06 | 2021-03-16 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| US10174091B1 (en) | 2017-12-06 | 2019-01-08 | Pandion Therapeutics, Inc. | IL-2 muteins |
| USRE50550E1 (en) | 2017-12-06 | 2025-08-26 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
| JP2019122373A (ja) | 2018-01-12 | 2019-07-25 | アムジエン・インコーポレーテツド | 抗pd−1抗体及び治療方法 |
| US11904081B2 (en) | 2018-05-11 | 2024-02-20 | Lupagen, Inc. | Systems and methods for closed loop, real-time modifications of patient cells |
| EP3796977A4 (en) * | 2018-05-17 | 2022-03-02 | The Board of Trustees of the Leland Stanford Junior University | RECEPTOR INHIBITION BY PHOSPHATASE RECRUITMENT |
| WO2020141974A1 (en) * | 2018-12-31 | 2020-07-09 | Merus N.V. | Truncated multivalent multimers |
| CN113711036B (zh) | 2019-01-30 | 2025-03-18 | 真和制药有限公司 | 抗gal3抗体及其用途 |
| CA3128518A1 (en) * | 2019-02-01 | 2020-08-06 | Actinium Pharmaceuticals, Inc. | Molecules and their derivatives directed against cd45 |
| KR20210124236A (ko) * | 2019-02-08 | 2021-10-14 | 비온테크 쎌 & 제네 테라피스 게엠베하 | Car-조작된 t 세포 및 사이토카인을 수반한 치료 |
| WO2020165374A1 (en) * | 2019-02-14 | 2020-08-20 | Ose Immunotherapeutics | Bifunctional molecule comprising il-15ra |
| WO2020172631A2 (en) | 2019-02-21 | 2020-08-27 | Xencor, Inc. | Untargeted and targeted il-10 fc-fusion proteins |
| CN121971599A (zh) | 2019-02-25 | 2026-05-05 | 芝加哥大学 | 用与抗炎剂连接的ecm亲和肽治疗炎症性和自身免疫性病症的方法和组合物 |
| BR112021019471A2 (pt) * | 2019-03-29 | 2022-04-26 | Torque Therapeutics Inc | Composições imunoterapêuticas e uso das mesmas |
| AU2020279112A1 (en) | 2019-05-17 | 2021-12-02 | Xencor, Inc. | IL-7-Fc-fusion proteins |
| CA3141327A1 (en) * | 2019-05-20 | 2020-11-26 | Pandion Operations, Inc. | Madcam targeted immunotolerance |
| CN114008082A (zh) * | 2019-06-24 | 2022-02-01 | 南京金斯瑞生物科技有限公司 | 单克隆抗体-细胞因子融合蛋白二聚体及其应用 |
| TW202115115A (zh) * | 2019-07-02 | 2021-04-16 | 瑞士商赫孚孟拉羅股份公司 | 免疫結合物 |
| AU2020315213A1 (en) * | 2019-07-17 | 2022-02-03 | National University Of Singapore | Functional binders synthesized and secreted by immune cells |
| PH12022550165A1 (en) | 2019-07-26 | 2023-05-08 | Visterra Inc | Interleukin-2 agents and uses thereof |
| EP4019536A4 (en) * | 2019-08-19 | 2023-09-06 | Nantong Yichen Biopharma. Co. Ltd. | Immunocytokine, preparation for same, and uses thereof |
| CN110731968A (zh) * | 2019-09-10 | 2020-01-31 | 南京鼓楼医院 | Icos+cxcr3+调节性t细胞在制备预防重症肺炎药物中的应用 |
| RU2753282C2 (ru) * | 2019-09-19 | 2021-08-12 | Закрытое Акционерное Общество "Биокад" | ИММУНОЦИТОКИН, ВКЛЮЧАЮЩИЙ ГЕТЕРОДИМЕРНЫЙ БЕЛКОВЫЙ КОМПЛЕКС НА ОСНОВЕ IL-15/IL-15Rα, И ЕГО ПРИМЕНЕНИЕ |
| EP3795583A1 (en) * | 2019-09-19 | 2021-03-24 | Ecole Polytechnique Federale de Lausanne (EPFL) | Il10/fc fusion proteins useful as enhancers of immunotherapies |
| JP7716399B2 (ja) * | 2019-11-01 | 2025-07-31 | ブイオーアール バイオファーマ インコーポレーテッド | 抗-cd45抗体及びそのコンジュゲート |
| US10792360B1 (en) * | 2019-11-21 | 2020-10-06 | Chemocentryx, Inc. | Compositions and methods for treating inflammatory bowel disease using CCR9 inhibitor and anti-TNF-alpha blocking antibodies |
| EP4069291A1 (en) | 2019-12-03 | 2022-10-12 | Evotec International GmbH | Interferon-associated antigen binding proteins and uses thereof |
| CN115551887A (zh) * | 2019-12-05 | 2022-12-30 | 维萨列克斯股份有限公司 | 通用细胞疗法的免疫逃逸机制的调节剂 |
| IL293978A (en) | 2019-12-20 | 2022-08-01 | Regeneron Pharma | New il2 agonists and methods of using them |
| WO2021168079A1 (en) | 2020-02-21 | 2021-08-26 | Pandion Operations, Inc. | Tissue targeted immunotolerance with a cd39 effector |
| US20230141575A1 (en) * | 2020-03-18 | 2023-05-11 | City Of Hope | Multivalent chemokine receptor binding complexes |
| JP2023526282A (ja) | 2020-05-13 | 2023-06-21 | ボナム セラピューティクス,インク. | タンパク質複合体の組成物及びその使用方法 |
| CN116157151A (zh) | 2020-05-26 | 2023-05-23 | 真和制药有限公司 | 通过阻断半乳凝素-3治疗炎性疾病的方法 |
| WO2021242989A1 (en) * | 2020-05-29 | 2021-12-02 | Health Research, Inc. | Compositions and methods for inducing cas9 protein expression by use of autonomous pd-1 promoter activity |
| CN116322740A (zh) * | 2020-07-13 | 2023-06-23 | 特兰斯吉恩股份有限公司 | 免疫抑制的治疗 |
| US20230338531A1 (en) * | 2020-08-20 | 2023-10-26 | City Of Hope | Compositions and uses of cd45 targeted chimeric antigen receptor modified t cells |
| EP4228610A1 (en) | 2020-10-13 | 2023-08-23 | Kriya Therapeutics, Inc. | Viral vector constructs for delivery of nucleic acids encoding cytokines and uses thereof for treating cancer |
| US12024559B2 (en) | 2020-10-23 | 2024-07-02 | Asher Biotherapeutics, Inc. | Fusions with CD8 antigen binding molecules for modulating immune cell function |
| AU2021389989A1 (en) * | 2020-11-27 | 2023-06-08 | Elpiscience (Suzhou) Biopharma, Ltd. | Novel conjugate molecules targeting cd39 and tgfβeta |
| AU2021391924A1 (en) | 2020-12-04 | 2023-06-22 | The General Hospital Corporation | Methods of using interleukin-2 agents |
| AU2021397271A1 (en) * | 2020-12-09 | 2023-07-06 | Asher Biotherapeutics, Inc. | Targeted cytokine construct for engineered cell therapy |
| WO2022165260A1 (en) | 2021-01-29 | 2022-08-04 | Iovance Biotherapeutics, Inc. | Methods of making modified tumor infiltrating lymphocytes and their use in adoptive cell therapy |
| JP2024506292A (ja) * | 2021-02-05 | 2024-02-13 | サルブリス バイオセラピューティクス,インコーポレイティド | Il-15融合タンパク質と、その製造法ならびに利用法 |
| UY39638A (es) * | 2021-02-19 | 2022-08-31 | Janssen Biotech Inc | Materiales y métodos para dirigirse a las células t reguladoras para potenciar la vigilancia inmunitaria |
| EP4314073A4 (en) * | 2021-03-24 | 2025-02-19 | Alkermes, Inc. | Upar antibodies and fusion proteins with the same |
| WO2022212593A1 (en) * | 2021-03-31 | 2022-10-06 | The Regents Of The University Of California | Bispecific binding agent-ligand fusions for the degradation of target proteins |
| KR102604849B1 (ko) * | 2021-05-11 | 2023-11-22 | 가톨릭대학교 산학협력단 | 항-cd25 항체, il-10 및 cxcr3를 발현하는 미니서클 벡터 |
| GB2638094B (en) | 2021-05-19 | 2026-03-04 | Asher Biotherapeutics Inc | IL-21 Polypeptides And Targeted Constructs |
| TW202317623A (zh) | 2021-06-14 | 2023-05-01 | 美商再生元醫藥公司 | 基於il2之治療劑及其使用方法 |
| CN113444744A (zh) * | 2021-06-28 | 2021-09-28 | 北京鼎成肽源生物技术有限公司 | 一种用于基因编辑NK细胞的mRNA模板及构建方法、mRNA的体外转录方法和应用 |
| KR20240035556A (ko) | 2021-07-19 | 2024-03-15 | 추가이 세이야쿠 가부시키가이샤 | 융합 폴리펩타이드를 이용하는 프로테아제 매개성의 표적 특이적 사이토카인 송달 |
| JP2024538749A (ja) * | 2021-10-10 | 2024-10-23 | エリクシロン・イミュノセラピューティクス・(ホンコン)・リミテッド | 抗pd-l1/il-10融合タンパク質を用いて疾患を処置する方法 |
| CN120131911A (zh) * | 2021-12-01 | 2025-06-13 | 威特拉公司 | 使用白细胞介素-2药剂的方法 |
| CN116376942A (zh) * | 2021-12-31 | 2023-07-04 | 广州国家实验室 | mRNA疫苗 |
| US20250101107A1 (en) * | 2022-01-20 | 2025-03-27 | Repertoire Immune Medicines, Inc. | Cd8-targeted il-12 fusion proteins |
| WO2023147488A1 (en) | 2022-01-28 | 2023-08-03 | Iovance Biotherapeutics, Inc. | Cytokine associated tumor infiltrating lymphocytes compositions and methods |
| AU2023259161A1 (en) * | 2022-04-27 | 2024-11-28 | Asher Biotherapeutics, Inc. | Combination of cytokine fusion proteins with cd8 antigen binding molecules |
| CN116854821A (zh) * | 2022-08-15 | 2023-10-10 | 海徕科(北京)生物技术有限公司 | IL-15突变体-Fc/IL-15Rα亚基-Fc异源二聚体及其用途 |
| WO2024055040A2 (en) * | 2022-09-09 | 2024-03-14 | Actinium Pharmaceuticals, Inc. | Humanized anti-cd45 antibodies |
| TW202417511A (zh) * | 2022-10-12 | 2024-05-01 | 大陸商蘇州創勝醫藥集團有限公司 | 包含抗vegfr2抗體的製劑 |
| EP4611838A1 (en) * | 2022-11-01 | 2025-09-10 | Lupagen, Inc. | Devices and methods for extracorporeal cell treatment |
| EP4634216A1 (en) | 2022-12-16 | 2025-10-22 | Repertoire Immune Medicines, Inc. | T cell receptors binding hpv-16 epitopes |
| WO2024178305A1 (en) * | 2023-02-24 | 2024-08-29 | Modernatx, Inc. | Compositions of mrna-encoded il-15 fusion proteins and methods of use thereof for treating cancer |
| WO2024178414A2 (en) * | 2023-02-24 | 2024-08-29 | The Wistar Institute Of Anatomy And Biology | Epitope editing and multi-specific immunce-cell engager therapy and methods of use |
| CN121793982A (zh) * | 2023-04-17 | 2026-04-03 | 扎格生物公司 | 组织定向抗体以及其使用方法 |
| WO2024254514A1 (en) * | 2023-06-08 | 2024-12-12 | The University Of North Carolina At Chapel Hill | Engineered antibody fusion proteins with modulable binding constants and their applications |
| WO2025072623A1 (en) * | 2023-09-28 | 2025-04-03 | The Trustees Of The University Of Pennsylvania | Compositions and methods for targeting immune cells |
| WO2025080338A1 (en) * | 2023-10-11 | 2025-04-17 | Massachusetts Institute Of Technology | Cell-surface anchored cytokine therapy |
| WO2026015637A1 (en) * | 2024-07-10 | 2026-01-15 | The Trustees Of Dartmouth College | Treg targeted il-2 fusion proteins and therapeutic use thereof |
Family Cites Families (113)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5650150A (en) | 1990-11-09 | 1997-07-22 | Gillies; Stephen D. | Recombinant antibody cytokine fusion proteins |
| US5405940A (en) | 1992-08-31 | 1995-04-11 | Ludwig Institute For Cancer Research | Isolated nonapeptides derived from MAGE genes and uses thereof |
| PT1037927E (pt) | 1997-12-08 | 2004-10-29 | Emd Lexigen Res Ct Corp | Proteinas de fusao heterodimericas uteis para imunoterapia de abordagem selectiva e estimulacao imunologica geral |
| ATE329622T1 (de) | 1998-04-15 | 2006-07-15 | Lexigen Pharm Corp | Steigerung der antikörper-zytokin- fusionsproteinmediierten immunantwort durch mitverabreichung mit einem angiogeneseinhibitor |
| US8119101B2 (en) | 1999-05-10 | 2012-02-21 | The Ohio State University | Anti-CD74 immunoconjugates and methods of use |
| US8383081B2 (en) | 1999-05-10 | 2013-02-26 | Immunomedics, Inc. | Anti-CD74 immunoconjugates and methods of use |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| US7550143B2 (en) | 2005-04-06 | 2009-06-23 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
| US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| BR0013231A (pt) | 1999-08-09 | 2002-07-23 | Lexigen Pharm Corp | Complexos citocina-anticorpo múltiplos |
| JP5390055B2 (ja) * | 2000-06-29 | 2014-01-15 | メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツング | 免疫サイトカインの取り込み増強剤との併用治療による抗体−サイトカイン融合タンパク質媒介免疫応答の増強 |
| CA2445746C (en) * | 2001-04-30 | 2012-09-18 | City Of Hope | Chimeric immunoreceptor useful in treating human cancers |
| ATE542137T1 (de) | 2001-12-04 | 2012-02-15 | Merck Patent Gmbh | Immunocytokine mit modulierter selektivität |
| US20030175270A1 (en) * | 2002-01-17 | 2003-09-18 | Josef Penninger | Methods of regulating cytokine receptor signaling |
| US8287864B2 (en) | 2002-02-14 | 2012-10-16 | Immunomedics, Inc. | Structural variants of antibodies for improved therapeutic characteristics |
| US20070003514A1 (en) | 2002-04-05 | 2007-01-04 | The Regents Of The University Of California | Mono-and bi-functional antibody conjugates as effective adjuvants of protein vaccination |
| US7906118B2 (en) | 2005-04-06 | 2011-03-15 | Ibc Pharmaceuticals, Inc. | Modular method to prepare tetrameric cytokines with improved pharmacokinetics by the dock-and-lock (DNL) technology |
| US7615223B2 (en) | 2002-07-15 | 2009-11-10 | Board Of Regents, The University Of Texas System | Selected immunoconjugates for binding to aminophospholipids |
| EP1418184A1 (en) | 2002-11-08 | 2004-05-12 | Cell Center Cologne GmbH | Recombinant fusion protein consisting of the p40 and p35 subunits of IL-12 and a ScFv and use thereof |
| EP1638510B1 (en) | 2003-07-01 | 2015-09-02 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| ES2399050T3 (es) | 2003-12-10 | 2013-03-25 | Medarex, Inc. | Anticuerpos contra interferón alfa y sus usos |
| US20110020273A1 (en) | 2005-04-06 | 2011-01-27 | Ibc Pharmaceuticals, Inc. | Bispecific Immunocytokine Dock-and-Lock (DNL) Complexes and Therapeutic Use Thereof |
| US8652484B2 (en) | 2004-02-13 | 2014-02-18 | Immunomedics, Inc. | Delivery system for cytotoxic drugs by bispecific antibody pretargeting |
| US8034352B2 (en) | 2005-04-06 | 2011-10-11 | Ibc Pharmaceuticals, Inc. | Tetrameric cytokines with improved biological activity |
| US9550838B2 (en) | 2004-02-13 | 2017-01-24 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (DNL) complexes for therapeutic and diagnostic use |
| US9931413B2 (en) | 2005-04-06 | 2018-04-03 | Ibc Pharmaceuticals, Inc. | Tetrameric cytokines with improved biological activity |
| US20120237442A1 (en) | 2005-04-06 | 2012-09-20 | Ibc Pharmaceuticals, Inc. | Design and Construction of Novel Multivalent Antibodies |
| US9623115B2 (en) | 2005-04-06 | 2017-04-18 | Ibc Pharmaceuticals, Inc. | Dock-and-Lock (DNL) Complexes for Disease Therapy |
| AU2006232310B9 (en) | 2005-04-06 | 2011-07-21 | Ibc Pharmaceuticals, Inc. | Improved stably tethered structures of defined compositions with multiple functions or binding specificities |
| US8067006B2 (en) | 2005-04-06 | 2011-11-29 | Immunomedics, Inc. | Polymeric carriers of therapeutic agents and recognition moieties for antibody-based targeting of disease sites |
| KR101281208B1 (ko) | 2005-05-11 | 2013-07-26 | 필로겐 에스.피.에이. | 피브로넥틴 ed-b에 대한 항체 l19 및 인터루킨12의 융합 단백질 |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US20100226884A1 (en) | 2009-01-20 | 2010-09-09 | Immunomedics, Inc. | Novel Class of Monospecific and Bispecific Humanized Antibodies that Target the Insulin-like Growth Factor Type I Receptor (IGF-1R) |
| CN105709237A (zh) | 2005-12-16 | 2016-06-29 | Ibc 医药公司 | 基于免疫球蛋白的多价生物活性装配体 |
| EP1966238B1 (en) | 2005-12-30 | 2012-04-25 | Merck Patent GmbH | Interleukin-12p40 variants with improved stability |
| JP5779090B2 (ja) * | 2008-04-09 | 2015-09-16 | マックスサイト インコーポレーティッド | 新規に単離された細胞の治療組成物の操作および送達 |
| EP3936122A1 (en) | 2008-11-24 | 2022-01-12 | Massachusetts Institute Of Technology | Methods and compositions for localized agent delivery |
| EP3243527B1 (en) | 2009-02-13 | 2019-06-05 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
| CA2774260C (en) | 2009-09-16 | 2018-10-09 | Immunomedics, Inc. | Class i anti-cea antibodies and uses thereof |
| US20110165122A1 (en) * | 2009-11-10 | 2011-07-07 | The Regents Of The University Of California | Method for targeted and sustained antiviral therapy |
| US20130017199A1 (en) | 2009-11-24 | 2013-01-17 | AMPLIMMUNE ,Inc. a corporation | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011090492A1 (en) | 2010-01-19 | 2011-07-28 | Immunomedics, Inc. | Novel class of monospecific and bispecific humanized antibodies that target the insulin-like growth factor type i receptor (igf-1r) |
| CN101829322A (zh) * | 2010-03-05 | 2010-09-15 | 孙嘉琳 | 细胞因子-超抗原融合蛋白在制备抗实体瘤药物的应用 |
| WO2011112935A2 (en) | 2010-03-12 | 2011-09-15 | The Regents Of The University Of California | Antibody fusion proteins with disrupted heparin-binding activity |
| JP6040148B2 (ja) | 2010-04-20 | 2016-12-07 | ゲンマブ エー/エス | ヘテロ二量体抗体Fc含有タンパク質およびその産生方法 |
| ES2674567T3 (es) * | 2010-05-21 | 2018-07-02 | Merrimack Pharmaceuticals, Inc. | Proteínas de fusión biespecíficas |
| WO2012019157A2 (en) * | 2010-08-06 | 2012-02-09 | The Regents Of The University Of California | Expression and purification of fusion protein with multiple mbp tags |
| EP2619229B1 (en) * | 2010-09-21 | 2016-04-06 | Altor BioScience Corporation | Multimeric il-15 soluble fusion molecules and methods of making and using same |
| ES3005233T3 (en) * | 2010-10-01 | 2025-03-14 | Modernatx Inc | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| CA2819074C (en) * | 2010-12-06 | 2020-04-14 | Shell Internationale Research Maatschappij B.V. | Process for removing mercaptans from a gas stream |
| EP3626739A1 (en) * | 2011-06-24 | 2020-03-25 | Stephen D. Gillies | Light chain immunoglobulin fusion proteins and methods of use thereof |
| WO2013014149A1 (en) | 2011-07-27 | 2013-01-31 | Philogen S.P.A. | Il-12 immunoconjugate |
| WO2013052484A1 (en) | 2011-10-03 | 2013-04-11 | Immunomedics, Inc. | Dye conjugated peptides for fluorescent imaging |
| WO2013059885A2 (en) * | 2011-10-28 | 2013-05-02 | Cephalon Australia Pty Ltd | Polypeptide constructs and uses thereof |
| WO2013082254A1 (en) | 2011-12-02 | 2013-06-06 | Ibc Pharmaceuticals, Inc. | Multivalent antibody complexes targeting igf-1r show potent toxicity against solid tumors |
| CA2866126A1 (en) | 2012-03-03 | 2013-09-12 | Immungene, Inc. | Engineered antibody-interferon mutant fusion molecules |
| EP3878964A1 (en) | 2012-11-27 | 2021-09-15 | Ajou University Industry-Academic Cooperation Foundation | Ch3 domain variant pair inducing formation of heterodimer of heavy chain constant region of antibody at high efficiency, method for preparing same, and use thereof |
| EP2970486B1 (en) | 2013-03-15 | 2018-05-16 | Xencor, Inc. | Modulation of t cells with bispecific antibodies and fc fusions |
| WO2014174105A1 (en) | 2013-04-25 | 2014-10-30 | Philochem Ag | Antibody-drug conjugates |
| RU2655439C2 (ru) | 2013-05-31 | 2018-05-28 | Займворкс Инк. | Гетеромультимеры с уменьшенной или подавленной эффекторной функцией |
| CA2953287A1 (en) | 2013-06-19 | 2014-12-24 | Massachusetts Institute Of Technology | In vivo targeting of cells with ligand-conjugated particles |
| US20160145355A1 (en) | 2013-06-24 | 2016-05-26 | Biomed Valley Discoveries, Inc. | Bispecific antibodies |
| AR096891A1 (es) | 2013-07-12 | 2016-02-03 | Hanmi Pharm Ind Co Ltd | Conjugado de monómero polipéptido biológicamente activo y conjugado de fragmento fc de inmunoglobulina, que muestra aclaramiento mediado por receptor reducido, y el método para la preparación del mismo |
| CA2925304C (en) | 2013-09-27 | 2023-04-18 | Massachusetts Institute Of Technology | Carrier-free biologically-active protein nanostructures |
| CA2951604A1 (en) | 2014-08-29 | 2016-03-03 | Pablo Umana | Combination therapy of tumor-targeted il-2 variant immunocytokines and antibodies against human pd-l1 |
| WO2016048903A1 (en) | 2014-09-22 | 2016-03-31 | Intrexon Corporation | Improved therapeutic control of heterodimeric and single chain forms of interleukin-12 |
| WO2016086186A2 (en) | 2014-11-26 | 2016-06-02 | Xencor, Inc. | Heterodimeric antibodies including binding to cd8 |
| WO2016105450A2 (en) | 2014-12-22 | 2016-06-30 | Xencor, Inc. | Trispecific antibodies |
| WO2016112983A1 (en) * | 2015-01-15 | 2016-07-21 | Biontech Ag | Cytokine fusion proteins |
| US10227411B2 (en) * | 2015-03-05 | 2019-03-12 | Xencor, Inc. | Modulation of T cells with bispecific antibodies and FC fusions |
| US11022615B2 (en) * | 2015-05-04 | 2021-06-01 | University Of Florida Research Foundation, Inc. | Regulatory T-cells, method for their isolation and uses |
| WO2016187514A1 (en) * | 2015-05-21 | 2016-11-24 | Actinium Pharmaceueuticals, Inc. | Infusion administration of conjugated monoclonal antibodies |
| TW202444897A (zh) * | 2015-06-25 | 2024-11-16 | 美商生物細胞基因治療有限公司 | 嵌合抗原受體(car)、組合物及其使用方法 |
| US11173179B2 (en) | 2015-06-25 | 2021-11-16 | Icell Gene Therapeutics Llc | Chimeric antigen receptor (CAR) targeting multiple antigens, compositions and methods of use thereof |
| AU2016305087B2 (en) | 2015-08-12 | 2022-01-20 | Massachusetts Institute Of Technology | Cell surface coupling of nanoparticles |
| AU2016334401A1 (en) | 2015-10-10 | 2018-04-26 | Intrexon Corporation | Improved therapeutic control of proteolytically sensitive, destabilized forms of interleukin-12 |
| GB201521383D0 (en) | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl And Ucb Celltech | Method |
| WO2017102010A1 (en) * | 2015-12-17 | 2017-06-22 | Biontech Rna Pharmaceuticals Gmbh | Novel cytokine fusion proteins |
| US20190000989A1 (en) | 2016-01-11 | 2019-01-03 | STC Biologics Inc. | Bispecific targeting agents and methods for their preparation |
| CN116769054A (zh) | 2016-02-05 | 2023-09-19 | 奥里尼斯生物科学私人有限公司 | 双特异性信号传导剂及其用途 |
| JP7114490B2 (ja) | 2016-06-24 | 2022-08-08 | アイセル・ジーン・セラピューティクス・エルエルシー | キメラ抗体受容体(CARs)の構成およびその使用方法 |
| CA3031955A1 (en) | 2016-07-29 | 2018-02-01 | Juno Therapeutics, Inc. | Immunomodulatory polypeptides and related compositions and methods |
| KR102050463B1 (ko) | 2016-08-10 | 2019-11-29 | 아주대학교산학협력단 | 항체 중쇄불변부위 이종이중체 (heterodimeric Fc)에 융합된 사이토카인 (heterodimeric Fc-fused cytokine) 및 이를 포함하는 약제학적 조성물 |
| WO2018030806A1 (ko) | 2016-08-10 | 2018-02-15 | 아주대학교산학협력단 | 항체 중쇄불변부위 이종이중체에 융합된 사이토카인 및 이를 포함하는 약제학적 조성물 |
| CN110267978A (zh) | 2016-10-07 | 2019-09-20 | 得克萨斯大学体系董事会 | 用于治疗癌症的表达膜锚定的il-12的t细胞 |
| KR20180071193A (ko) | 2016-12-19 | 2018-06-27 | 한미약품 주식회사 | 뇌 표적 지속성 단백질 결합체 |
| AU2018215840A1 (en) | 2017-02-03 | 2019-08-01 | Hanmi Pharm. Co., Ltd. | Long-Acting Conjugate Of A Physiologically Active Material And Use Thereof |
| KR20190126182A (ko) | 2017-03-27 | 2019-11-08 | 난트셀, 인크. | aNK 및 IL-12 조성물 및 방법 (ANK AND IL-12 COMPOSITIONS AND METHODS) |
| US11421011B2 (en) | 2017-05-18 | 2022-08-23 | Modernatx, Inc. | Polynucleotides encoding tethered interleukin-12 (IL12) polypeptides and uses thereof |
| WO2018222901A1 (en) | 2017-05-31 | 2018-12-06 | Elstar Therapeutics, Inc. | Multispecific molecules that bind to myeloproliferative leukemia (mpl) protein and uses thereof |
| JP2020524512A (ja) | 2017-06-21 | 2020-08-20 | アイセル・ジーン・セラピューティクス・エルエルシー | キメラ抗体受容体(CARs)の組成物およびその使用方法 |
| AU2018291497A1 (en) | 2017-06-30 | 2020-01-16 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15/IL-15Ra and antigen binding domains |
| CN111094330A (zh) | 2017-07-03 | 2020-05-01 | 转矩医疗股份有限公司 | 编码免疫刺激融合分子的多核苷酸及其用途 |
| WO2019129053A1 (zh) | 2017-12-26 | 2019-07-04 | 南京金斯瑞生物科技有限公司 | 以抗体Fc区为骨架的融合蛋白二聚体及其应用 |
| WO2019166946A1 (en) | 2018-02-28 | 2019-09-06 | Pfizer Inc. | Il-15 variants and uses thereof |
| CN110396133B (zh) | 2018-04-25 | 2021-07-23 | 免疫靶向有限公司 | 一种以白介素12为活性成分的融合蛋白型药物前体 |
| WO2019222294A1 (en) | 2018-05-14 | 2019-11-21 | Werewolf Therapeutics, Inc. | Activatable cytokine polypeptides and methods of use thereof |
| EP3831945A4 (en) | 2018-07-30 | 2022-05-04 | Jinyu Zhang | PROTEIN HETERODIMER AND ITS USE |
| AU2019328575B2 (en) | 2018-08-30 | 2024-07-11 | Immunitybio, Inc. | Single-chain and multi-chain chimeric polypeptides and uses thereof |
| EP3856229A1 (en) | 2018-09-28 | 2021-08-04 | Pierre Fabre Medicament | New immunocytokines for the treatment of cancer |
| WO2020088631A1 (en) | 2018-11-01 | 2020-05-07 | Gracell Biotechnologies (Shanghai) Co., Ltd. | Compositions and methods for t cell engineering |
| JP2022513600A (ja) | 2018-11-15 | 2022-02-09 | トルク セラピューティクス, インコーポレイテッド | がん免疫療法のための方法および組成物 |
| MX2021006922A (es) | 2018-12-11 | 2021-09-30 | Oncosec Medical Inc | Constructo multigenico para la expresión de proteínas inmunoduladoras y métodos de uso. |
| EP3897851A2 (en) | 2018-12-17 | 2021-10-27 | Revitope Limited | Twin immune cell engager |
| BR112021019471A2 (pt) | 2019-03-29 | 2022-04-26 | Torque Therapeutics Inc | Composições imunoterapêuticas e uso das mesmas |
| CN111848810B (zh) | 2019-04-28 | 2024-08-23 | 张晋宇 | 一种蛋白质分子及其用途 |
| CA3142738A1 (en) | 2019-06-05 | 2020-12-10 | Asher Biotherapeutics, Inc. | Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function |
| MA56520A (fr) | 2019-06-18 | 2022-04-27 | Janssen Sciences Ireland Unlimited Co | Construction de l'interleukine 12 recombinante et ses utilisations |
| CN114008082A (zh) | 2019-06-24 | 2022-02-01 | 南京金斯瑞生物科技有限公司 | 单克隆抗体-细胞因子融合蛋白二聚体及其应用 |
| TW202115115A (zh) | 2019-07-02 | 2021-04-16 | 瑞士商赫孚孟拉羅股份公司 | 免疫結合物 |
| WO2021041715A2 (en) | 2019-08-30 | 2021-03-04 | University Of Kansas | Compositions including igg fc mutations and uses thereof |
| JP7483896B2 (ja) | 2020-01-17 | 2024-05-15 | エショー バイオセラピー, インク. | オフターゲット毒性を低下させるプロ抗体 |
| EP3889183A1 (en) | 2020-04-01 | 2021-10-06 | Pierre Fabre Medicament | A protein complex comprising an immunocytokine |
-
2018
- 2018-07-03 CN CN201880056938.1A patent/CN111094330A/zh active Pending
- 2018-07-03 WO PCT/US2018/040786 patent/WO2019010224A1/en not_active Ceased
- 2018-07-03 JP JP2020500113A patent/JP2020530440A/ja active Pending
- 2018-07-03 CA CA3069105A patent/CA3069105A1/en active Pending
- 2018-07-03 EP EP18828706.4A patent/EP3675892A4/en not_active Withdrawn
- 2018-07-03 CN CN201880056956.XA patent/CN111093689A/zh active Pending
- 2018-07-03 AU AU2018297248A patent/AU2018297248A1/en not_active Abandoned
- 2018-07-03 EP EP18827456.7A patent/EP3648786A4/en not_active Withdrawn
- 2018-07-03 KR KR1020207003059A patent/KR20200037781A/ko not_active Abandoned
- 2018-07-03 GB GB2001438.7A patent/GB2580228B/en not_active Expired - Fee Related
- 2018-07-03 JP JP2020500048A patent/JP2020530280A/ja active Pending
- 2018-07-03 AU AU2018298060A patent/AU2018298060B2/en not_active Ceased
- 2018-07-03 CA CA3069017A patent/CA3069017A1/en active Pending
- 2018-07-03 WO PCT/US2018/040783 patent/WO2019010222A2/en not_active Ceased
- 2018-07-03 WO PCT/US2018/040777 patent/WO2019010219A1/en not_active Ceased
- 2018-07-03 US US16/628,363 patent/US20200306301A1/en not_active Abandoned
- 2018-07-03 AU AU2018298063A patent/AU2018298063A1/en not_active Abandoned
- 2018-07-03 US US16/628,374 patent/US20210017247A1/en not_active Abandoned
- 2018-07-03 CA CA3068841A patent/CA3068841A1/en active Pending
- 2018-07-03 EP EP18827557.2A patent/EP3649147A4/en not_active Withdrawn
- 2018-07-03 US US16/628,342 patent/US11471490B2/en active Active
-
2021
- 2021-05-17 AU AU2021203162A patent/AU2021203162A1/en not_active Abandoned
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11471490B2 (en) | 2017-07-03 | 2022-10-18 | Torque Therapeutics, Inc. | T cells surface-loaded with immunostimulatory fusion molecules and uses thereof |
| US12343379B2 (en) | 2017-09-06 | 2025-07-01 | Yale University | Interleukin-18 variants and methods of use |
| US12403180B2 (en) | 2017-09-06 | 2025-09-02 | Yale University | Interleukin-18 variants and methods of use |
| US12594325B2 (en) | 2017-09-06 | 2026-04-07 | Yale University | Interleukin-18 variants and methods of use |
| US12247060B2 (en) | 2018-01-09 | 2025-03-11 | Marengo Therapeutics, Inc. | Calreticulin binding constructs and engineered T cells for the treatment of diseases |
| US12152073B2 (en) | 2018-03-14 | 2024-11-26 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| US11845797B2 (en) | 2018-07-03 | 2023-12-19 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US12286477B2 (en) | 2018-07-03 | 2025-04-29 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US11965025B2 (en) | 2018-07-03 | 2024-04-23 | Marengo Therapeutics, Inc. | Method of treating solid cancers with bispecific interleukin-anti-TCRß molecules |
| US12351632B2 (en) | 2018-07-03 | 2025-07-08 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US12384842B2 (en) | 2019-02-21 | 2025-08-12 | Marengo Therapeutics, Inc. | Antibody molecules that bind to NKP30 and uses thereof |
| US12358982B2 (en) | 2019-02-21 | 2025-07-15 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to T cell related cancer cells and uses thereof |
| US12486326B2 (en) | 2020-01-03 | 2025-12-02 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| WO2022179613A1 (en) * | 2021-02-26 | 2022-09-01 | Nanjing Legend Biotech Co., Ltd. | Engineered immune effector cells expressing exogenously introduced cytokines |
| WO2023091954A3 (en) * | 2021-11-19 | 2023-08-03 | The Trustees Of The University Of Pennsylvania | Engineered pan-leukocyte antigen cd45 to facilitate car t cell therapy |
| WO2023137466A3 (en) * | 2022-01-14 | 2023-09-21 | Qilu Puget Sound Biotherapeutics Corporation | Anti-ccr8 antibodies |
| US11981741B2 (en) | 2022-03-24 | 2024-05-14 | Actinium Pharmaceuticals, Inc. | Humanized anti-CD45 antibodies |
| WO2023183927A3 (en) * | 2022-03-24 | 2023-11-09 | Actinium Pharmaceuticals, Inc. | Humanized anti-cd45 antibodies |
| WO2023201008A1 (en) * | 2022-04-13 | 2023-10-19 | President And Fellows Of Harvard College | Compositions and methods for localized delivery of cytokines for adoptive cell therapy |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3675892A4 (en) | 2021-10-06 |
| US20210017247A1 (en) | 2021-01-21 |
| EP3649147A2 (en) | 2020-05-13 |
| EP3675892A1 (en) | 2020-07-08 |
| EP3648786A4 (en) | 2021-12-15 |
| JP2020530280A (ja) | 2020-10-22 |
| GB2580228B (en) | 2022-11-02 |
| AU2018297248A1 (en) | 2020-02-20 |
| AU2018298060B2 (en) | 2021-02-25 |
| CA3068841A1 (en) | 2019-01-10 |
| AU2018298060A1 (en) | 2020-02-20 |
| WO2019010219A1 (en) | 2019-01-10 |
| EP3648786A1 (en) | 2020-05-13 |
| AU2018298063A1 (en) | 2020-02-20 |
| WO2019010222A3 (en) | 2019-03-07 |
| KR20200037781A (ko) | 2020-04-09 |
| WO2019010224A1 (en) | 2019-01-10 |
| CN111093689A (zh) | 2020-05-01 |
| AU2021203162A1 (en) | 2021-06-10 |
| US20200330514A1 (en) | 2020-10-22 |
| EP3649147A4 (en) | 2021-04-14 |
| CN111094330A (zh) | 2020-05-01 |
| JP2020530440A (ja) | 2020-10-22 |
| CA3069105A1 (en) | 2019-01-10 |
| CA3069017A1 (en) | 2019-01-10 |
| GB202001438D0 (en) | 2020-03-18 |
| WO2019010222A2 (en) | 2019-01-10 |
| US11471490B2 (en) | 2022-10-18 |
| GB2580228A (en) | 2020-07-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11471490B2 (en) | T cells surface-loaded with immunostimulatory fusion molecules and uses thereof | |
| US20220195071A1 (en) | Immunotherapeutic compositions and use thereof | |
| US20250346679A1 (en) | Antibody molecules that bind pd-l1 and cd137 | |
| CN107849130B (zh) | 针对程序性死亡配体(pd-l1)的单域抗体及其衍生蛋白 | |
| CA2811734C (en) | Multimeric il-15 soluble fusion molecules and methods of making and using same | |
| WO2022089353A1 (zh) | 靶向bcma的单域抗体及其用途 | |
| JP2022501072A (ja) | Csf1r/ccr2多特異性抗体 | |
| EP4314073A1 (en) | Upar antibodies and fusion proteins with the same | |
| HK40122804A (en) | Antibody molecules that bind pd-l1 and cd137 | |
| WO2022121880A1 (zh) | 靶向cd19的人源化抗体及其用途 | |
| HK40050345A (en) | Antibody molecules that bind pd-l1 and cd137 | |
| HK40050345B (en) | Antibody molecules that bind pd-l1 and cd137 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED |
|
| AS | Assignment |
Owner name: TORQUE THERAPEUTICS, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ANDRESEN, THOMAS LARS;REEL/FRAME:056994/0231 Effective date: 20200214 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| AS | Assignment |
Owner name: TORQUE THERAPEUTICS, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:JONES, DOUGLAS SCOTT;REEL/FRAME:058142/0457 Effective date: 20201230 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |