US20130323227A1 - Pharmaceutical compositions of tenecteplase - Google Patents
Pharmaceutical compositions of tenecteplase Download PDFInfo
- Publication number
- US20130323227A1 US20130323227A1 US13/993,297 US201113993297A US2013323227A1 US 20130323227 A1 US20130323227 A1 US 20130323227A1 US 201113993297 A US201113993297 A US 201113993297A US 2013323227 A1 US2013323227 A1 US 2013323227A1
- Authority
- US
- United States
- Prior art keywords
- tnk
- tenecteplase
- composition
- pharmaceutically acceptable
- safe
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108010039185 Tenecteplase Proteins 0.000 title claims abstract description 12
- 229960000216 tenecteplase Drugs 0.000 title claims abstract description 12
- 239000008194 pharmaceutical composition Substances 0.000 title claims abstract description 10
- 239000000203 mixture Substances 0.000 claims abstract description 46
- 208000032382 Ischaemic stroke Diseases 0.000 claims abstract description 39
- 238000011282 treatment Methods 0.000 claims abstract description 33
- 238000009472 formulation Methods 0.000 claims description 34
- 238000000034 method Methods 0.000 claims description 23
- 230000010412 perfusion Effects 0.000 claims description 14
- 238000000855 fermentation Methods 0.000 claims description 13
- 230000004151 fermentation Effects 0.000 claims description 13
- 210000004978 chinese hamster ovary cell Anatomy 0.000 claims description 10
- NBIIXXVUZAFLBC-UHFFFAOYSA-N phosphoric acid Substances OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 claims description 9
- 239000000872 buffer Substances 0.000 claims description 7
- 208000006011 Stroke Diseases 0.000 claims description 6
- 238000002347 injection Methods 0.000 claims description 6
- 239000007924 injection Substances 0.000 claims description 6
- 229910000147 aluminium phosphate Inorganic materials 0.000 claims description 5
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 claims description 4
- 229930064664 L-arginine Natural products 0.000 claims description 4
- 235000014852 L-arginine Nutrition 0.000 claims description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 4
- 239000008215 water for injection Substances 0.000 claims description 3
- 239000000843 powder Substances 0.000 claims description 2
- 238000001990 intravenous administration Methods 0.000 claims 5
- 230000037396 body weight Effects 0.000 claims 4
- 239000003381 stabilizer Substances 0.000 claims 4
- 239000003937 drug carrier Substances 0.000 claims 2
- 239000008363 phosphate buffer Substances 0.000 claims 1
- 229950008882 polysorbate Drugs 0.000 claims 1
- 229920000136 polysorbate Polymers 0.000 claims 1
- 238000012360 testing method Methods 0.000 abstract description 25
- 230000000694 effects Effects 0.000 abstract description 3
- 108090000623 proteins and genes Proteins 0.000 description 31
- 210000004027 cell Anatomy 0.000 description 30
- 102000004169 proteins and genes Human genes 0.000 description 29
- 235000018102 proteins Nutrition 0.000 description 26
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 20
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 20
- 238000002360 preparation method Methods 0.000 description 17
- 229960000187 tissue plasminogen activator Drugs 0.000 description 13
- 230000006872 improvement Effects 0.000 description 11
- 238000004519 manufacturing process Methods 0.000 description 10
- 239000011347 resin Substances 0.000 description 10
- 229920005989 resin Polymers 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 230000014509 gene expression Effects 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 238000005516 engineering process Methods 0.000 description 8
- 239000000523 sample Substances 0.000 description 8
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 8
- 229960003318 alteplase Drugs 0.000 description 7
- 239000012909 foetal bovine serum Substances 0.000 description 7
- 238000003306 harvesting Methods 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- 238000011993 High Performance Size Exclusion Chromatography Methods 0.000 description 6
- 229920001213 Polysorbate 20 Polymers 0.000 description 6
- 150000001413 amino acids Chemical class 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 6
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 6
- 229940068977 polysorbate 20 Drugs 0.000 description 6
- 239000001488 sodium phosphate Substances 0.000 description 6
- 229910000162 sodium phosphate Inorganic materials 0.000 description 6
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 6
- 102000013566 Plasminogen Human genes 0.000 description 5
- 108010051456 Plasminogen Proteins 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 101150074155 DHFR gene Proteins 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 235000001014 amino acid Nutrition 0.000 description 4
- 238000004166 bioassay Methods 0.000 description 4
- 238000011210 chromatographic step Methods 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 239000008103 glucose Substances 0.000 description 4
- 238000004255 ion exchange chromatography Methods 0.000 description 4
- 238000011031 large-scale manufacturing process Methods 0.000 description 4
- 108090000765 processed proteins & peptides Proteins 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- UZOVYGYOLBIAJR-UHFFFAOYSA-N 4-isocyanato-4'-methyldiphenylmethane Chemical compound C1=CC(C)=CC=C1CC1=CC=C(N=C=O)C=C1 UZOVYGYOLBIAJR-UHFFFAOYSA-N 0.000 description 3
- 206010008111 Cerebral haemorrhage Diseases 0.000 description 3
- 102000009123 Fibrin Human genes 0.000 description 3
- 108010073385 Fibrin Proteins 0.000 description 3
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 3
- 102000001938 Plasminogen Activators Human genes 0.000 description 3
- 108010001014 Plasminogen Activators Proteins 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 108010022394 Threonine synthase Proteins 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 229950003499 fibrin Drugs 0.000 description 3
- 230000014759 maintenance of location Effects 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 229940127126 plasminogen activator Drugs 0.000 description 3
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 108010049003 Fibrinogen Proteins 0.000 description 2
- 102000008946 Fibrinogen Human genes 0.000 description 2
- 108010088842 Fibrinolysin Proteins 0.000 description 2
- 238000000729 Fisher's exact test Methods 0.000 description 2
- 101000801481 Homo sapiens Tissue-type plasminogen activator Proteins 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 2
- 108010023197 Streptokinase Proteins 0.000 description 2
- 108700005078 Synthetic Genes Proteins 0.000 description 2
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 2
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 229960002684 aminocaproic acid Drugs 0.000 description 2
- 238000002306 biochemical method Methods 0.000 description 2
- 230000035602 clotting Effects 0.000 description 2
- 238000002591 computed tomography Methods 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 102000004419 dihydrofolate reductase Human genes 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 239000003527 fibrinolytic agent Substances 0.000 description 2
- 238000001641 gel filtration chromatography Methods 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 230000036512 infertility Effects 0.000 description 2
- 238000005342 ion exchange Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 230000000737 periodic effect Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 238000011165 process development Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 229910052709 silver Inorganic materials 0.000 description 2
- 239000004332 silver Substances 0.000 description 2
- 229960005202 streptokinase Drugs 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 230000005030 transcription termination Effects 0.000 description 2
- 229960005356 urokinase Drugs 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 1
- 102220487491 Arylsulfatase H_N117Q_mutation Human genes 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- 101100115778 Caenorhabditis elegans dac-1 gene Proteins 0.000 description 1
- 101100205030 Caenorhabditis elegans hars-1 gene Proteins 0.000 description 1
- 102220486713 Cytochrome b-245 chaperone 1_K296A_mutation Human genes 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 206010014523 Embolism and thrombosis Diseases 0.000 description 1
- 241001646716 Escherichia coli K-12 Species 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 101000605403 Homo sapiens Plasminogen Proteins 0.000 description 1
- 125000001176 L-lysyl group Chemical class [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 102220475235 Probable C-mannosyltransferase DPY19L1_H297A_mutation Human genes 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical class [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 206010000891 acute myocardial infarction Diseases 0.000 description 1
- 238000005273 aeration Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000012801 analytical assay Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009697 arginine Nutrition 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000010876 biochemical test Methods 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 239000013622 capto Q Substances 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 150000001720 carbohydrates Chemical group 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 210000001627 cerebral artery Anatomy 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000011097 chromatography purification Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000000326 densiometry Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000011143 downstream manufacturing Methods 0.000 description 1
- 210000003989 endothelium vascular Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 230000003480 fibrinolytic effect Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 229940106780 human fibrinogen Drugs 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 235000018977 lysine Nutrition 0.000 description 1
- 238000013411 master cell bank Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229940126601 medicinal product Drugs 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000011369 optimal treatment Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229940012957 plasmin Drugs 0.000 description 1
- 230000033885 plasminogen activation Effects 0.000 description 1
- 238000005498 polishing Methods 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000012797 qualification Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000009666 routine test Methods 0.000 description 1
- 102220184511 rs746764772 Human genes 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008227 sterile water for injection Substances 0.000 description 1
- 239000012536 storage buffer Substances 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 229960003766 thrombin (human) Drugs 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
- A61K38/482—Serine endopeptidases (3.4.21)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/19—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21068—Tissue plasminogen activator (3.4.21.68), i.e. tPA
Definitions
- This invention relates to the pharmaceutical compositions of a derivative of human tissue plasminogen activator known as tenecteplase (TNK) for the treatment of blockage of the cerebral arteries that cause strokes of major or minor types such as acute ischemic stroke (AIS).
- TNK tissue plasminogen activator
- AIS acute ischemic stroke
- the invention also relates to the formulations having optimal efficacy and safety compared with the known therapy agents as identified in clinical trials of the said compositions with specific amounts of TNK as active ingredient.
- Tissue plasminogen activator (TPA) is involved in the breakdown of non-specific blood clots in the blood circulation system.
- TNK is a derivative of TPA in which seven amino acids of the native sequence are modified so that the new molecule has changed specificity to the fibrin protein and changed pharmacokinetic properties leading to changed pharmacodynamic effects.
- TNK is a 527-amino acid glycoprotein of molecular weight of 70 KDa. It has been approved for use in the medicinal products for the treatment of acute myocardial infarction and some other thrombosis and embolism related breakage of blood vessels in different organs. Recently, it has been considered for the treatment of acute ischemic stroke and several clinical trials have been performed for this indication, but these trials have not given any conclusive evidence on the safe and effective dose of TNK for AIS.
- Plasminogen activators are enzymes that activate the plasminogen to generate the serine protease plasmin that in turn degrades fibrin.
- plasminogen activators used as drugs are: a) streptokinase [a bacterial protein], b) urokinase, [an enzyme synthesized in the kidney] and c) human tissue plasminogen activator [an enzyme produced by the vascular endothelium].
- streptokinase [a bacterial protein]
- urokinase [an enzyme synthesized in the kidney]
- human tissue plasminogen activator an enzyme produced by the vascular endothelium.
- fibrinolytic drugs There are also other enzymes in development that are potential candidates as fibrinolytic drugs.
- TPA forms a ternary complex with fibrin and plasminogen leading to plasminogen activation and clot dissolution in situ.
- Natural human TPA has a plasma half-life typically of 8-10 minutes. However, it was desired to have increased half-life so that the fibrinolytic therapy may be administrated effectively in a short period of time, with more beneficial efficacy outcomes. Therefore, several amino acid and deletion mutants of the protein were created and tested for the improved characters over TPA.
- TNK has six mutations that doubled half-life [to 20-24 min.] compared to tPA and improved characters such as higher fibrin clot specificity with concurrent less affinity for plasminogen activator inhibitor-I.
- TNK was first disclosed in U.S. Pat. No. 5,385,732 wherein it was produced by recombinant DNA technology using an established mammalian cell line.
- Several other patents cover different aspects of the production and use of TNK, viz., U.S. Pat. No. 5,728,567, U.S. Pat. No. 5,714,145, U.S. Pat. No. 5,366,886, U.S. Pat. No. 5,094,953, U.S. Pat. No. 5,407,819 and U.S. Pat. No. 6,506,598.
- U.S. Pat. No. 5,407,819 discloses a method of the preparation of a TPA variant by displacement of a particular amino acid in the amino acid sequence.
- Pat. No. 5,612,029 discloses a variant of TPA, which is glycosylated at any positions on 103-105 and devoid of functional carbohydrate structure at position 117 of wild type human TPA sequence.
- U.S. Pat. No. 5,520,911 discloses the preparation of DNA sequences to encode the TPA variant.
- U.S. Pat. No. 5,424,198 discloses a method for the production of TPA by transforming the cells with mutant or wild-type DHFR genes in combination with tPA genes.
- this application does not disclose any method of identifying a safe and effective dose of TNK for the treatment of AIS in human subjects. Instead it predicts the use of safe dose based on theoretical models of existing data matrices without giving any specific method of testing and qualifying the identified effective doses. Therefore, current prior art fails to address the unmet need for identification of safe and effective doses of TNK for the treatment of AIS and effective pharmaceutical compositions (formulations) for the treatment of AIS.
- the present invention addresses the above mentioned need and provides improved and more effective formulations of TNK for the treatment of AIS in human subjects, which is safe as well as easy to administer in a short period of time.
- TNK for the treatment of AIS
- TNK for the treatment of AIS
- TNK for the treatment of the AIS.
- some formulations of TNK are disclosed herein that have desired properties required of a safe and effective drug for the treatment of AIS.
- Some aspects of the method used in the present disclosure for the preparation of the TNK of high purity are known in the prior art.
- several new elements are used here that are not known in the art for the production, preparation, selection, testing and especially clinical qualification of the formulations of TNK for the treatment of AIS.
- the principal object of the invention is to identify the effective and safe amount of the TNK for the treatment of AIS in human subjects.
- Another object of the invention is to develop the formulations of TNK that are safe and effective in treatment of AIS in human subjects.
- Yet another object of the invention is to perform clinical trials to identify the amount of TNK that is safe and effective for the treatment of AIS.
- a further object of the invention is to use perfusion-based fermentation technology for the recombinant production of TNK used to achieve the above objects.
- TNK The production of TNK was done by recombinant DNA technology in Chinese Hamster Ovary (CHO) cells in a perfusion-based continuous fermentation system. This method affords a large-scale production of the protein with higher quality and quantity, besides being scalable for industrial applications.
- the recombinant cell line producing TNK as a secreted protein was prepared and selected for the desired nature of TNK, and used for the formulations of TNK for treatment of AIS in human subjects. These formulations having different amounts of TNK were tested in a clinical setting to identify the safe and effective amount of TNK required for optimal treatment of AIS in human subjects.
- the clinical trial data that provided the amount of TNK which is safe and efficacious for the treatment of AIS is disclosed in the intervention.
- the TNK is prepared using perfusion-based continuous fermentation system.
- mammalian cell lines CHO
- CHO mammalian cell lines
- these cell lines were then screened for expression level of secreted TNK and a highly TNK expressing cell line was isolated for further process development for the pharmaceutical grade TNK production.
- the TNK producing cells were grown in a perfusion-based continuous fermentation system for large-scale production of TNK and collected spent media stored for further processing.
- the harvest was subject to the chromatographic steps to obtain highly pure and potent TNK bulk as active ingredient for the further preparation of the formulations for clinical applications.
- a set of formulations of the TNK were prepared and studied for various parameters like stability, potency and other pharmacologic properties in bioassays.
- the formulations of TNK prepared were examined in clinical testing to identify the safe and effective amount of TNK required for the treatment of AIS in affected subjects under certain conditions.
- the principal object of this invention is to develop an improved preparation of TNK for use as pharmaceutical compositions for the treatment of acute ischemic stroke in human subjects that is safe and efficacious over known formulations.
- Another object of this invention relates to the use of clinical tests using specific amounts of TNK to determine the safe and effective amount of TNK in the treatment of AIS.
- the objective of this invention is to develop safe and effective pharmaceutical compositions/formulations for the treatment of acute ischemic stroke in human, wherein TNK is produced from a CHO cell line developed de novo and used in a perfusion-based continuous fermentation system for the large-scale production of TNK.
- the CHO cell line expressing TNK as a secreted protein at a higher level was prepared. Molecular biology, biochemistry and analytical techniques used are standard in the art and have been routinely used.
- the mammalian expression plasmid used for the creation of the expression cell line contained a CMV promoter/enhancer element before an artificial gene of TNK followed by a SV40 poly-A tail for transcription termination.
- the same plasmid also contained a DHFR gene under the control of SV40 promoter, ending with a SV40 poly-A tail.
- This plasmid was transfected to CHO cells negative for the native DHFR gene (CHO-DHFR-cell line).
- One cell line with higher levels of TNK expression was isolated and further used [Example 1 and 2].
- the TNK-expressing CHO cells were used for the large-scale preparation of TNK in perfusion-based continuous fermentation system.
- About 6-12 ⁇ 10 9 cells were immobilised in the reactor core of the perfusion bioreactor. These cells were allowed to grow in IMDM medium with FBS for about for a few days till the required cell mass developed under constant glucose concentration of about 1-2 gm/L in chemostatic mode.
- the medium was changed to CHO-S-SFM II without FBS, and fermentation continued for several months under glucose fed conditions while a certain concentration of crude TNK product was produced in the harvested medium for further downstream processing.
- the harvest media was collected in sterile containers and stored at 4° C. till further use in subsequent purification steps [Examples 3, 5 and 7].
- the harvested medium containing crude TNK were subjected to a set of the chromatographic steps in a series. This included a dye-affinity capture step, followed by lysine-affinity purification step and a final ion exchange polishing step.
- Table A depicts different steps of the chromatographic purification leading to several fold increase in the amount of the purified protein as determined by SDS-PAGE densitometry/HPSEC.
- the harvested broth Before subjecting the harvested broth to the purification process it contained about 80% TNK protein.
- the purity of the protein was at least 95%.
- the types of the resins used for the affinity, ion exchange and gel filtration steps used in the method described here can be replaced with other resins of similar characters.
- the purification methods described here are depiction of examples of the purification strategy used for the preparation of TNK for the treatment of AIS, and are not limited by the use of types of chromatographic resins disclosed as other similar separation media may be used equally effectively.
- the bulk TNK was stored at a concentration of about 5 mg/mL at ⁇ 80° C. [Examples 4, 5 and 7].
- various formulations of the bulk TNK solution were prepared in the range from 0.10 to 0.24 mg/mL per 10-mL vial in lyophilised form.
- the ratio of the components was 1 part of TNK, 11 parts of L-arginine, 3.4 parts of phosphoric acid and 0.086 parts of polysorbate-20 as lyophilised powder.
- FIG. 1 Silver stained reduced SDS-PAGE gram of TNK content in purified fractions—1) molecular weight marker (from bottom: 21, 31, 45, 66, and 96 kDa); 2) harvested broth; 3) E-1 after DAC; 4) E-2 after LAC; 5) E-3 after IEC and 6) standard sample.
- FIG. 2 Silver stained non-reduced SDS-PAGE gram of TNK content in purified fractions—1) molecular weight marker (from bottom: 21, 31, 45, 66, and 96 kDa); 2) harvested broth; 3) E-1 after DAC; 4) E-2 after LAC; 5) E-3 after IEC and 6) standard sample.
- FIG. 3 An illustrative HPSEC graph of non-reduced TNK after chromatographic final step: TNK peptide (retention time: 26.653 min.) is more than 99% pure.
- FIG. 4 An illustrative HPSEC graph of reduced TNK after chromatographic final step: TNK peptide, single chain (retention time: 25.093 min.) and TNK peptide, double chain (retention time: 29.247 min.).
- FIG. 5 An illustrative standard curve for the TNK bioactivity measurements.
- the general molecular biology, biochemistry and analytical methods used during the procedures are known in the art. Routine techniques can be anticipated and are not described as they are available in public literature.
- the strains used as the bacterial host cells were derived from E. coli K-12 and the plasmids and DNA elements used for the preparation of expression vectors were retrieved from commonly available plasmids or designed and synthesised in-house and integrated to create required elements.
- the peptide sequence used for the preparation of artificial TNK gene is the native human tPA sequence having the amino acid changes as: Thr103Asn, Asn117Gln, Lys296Ala, His297Ala, Age298Ala and Age299Ala [ MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGAR SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCW CNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTA ESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNS DCYFGNGSAYRGTHSLTESGASCLPWNSMILIGNVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKN RRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASH
- TNK DNA sequence of human tPA gene with the above six mutations was artificially synthesised.
- This sequence was cloned in a plasmid vector having the elements for the efficient overexpression of the protein in Chinese Hamster Ovary (CHO) cells as a secreted protein in the medium.
- the CMV enhancer/promoter element was followed by the TNK artificial gene followed by an SV40 polyA transcription termination element.
- the same plasmid also expressed the DHFR gene controlled by SV40 early promoter and SV40 polyA terminator as a separate cistron.
- the DHFR gene was also used as the expression marker in the recombined CHO cells for detection of TNK positive cells.
- the vector was transfected into the dihydrofolate reductase (DHFR) negative CHO cell line (DUKxB11) and genomically integrated stable clones with robust expression of secreted TNK were isolated.
- the expression levels of the TNK in various selected clones was tested with Western blot and SDS-PAGE analyses, followed by quantitative RT-PCR methods to establish the cell lines with stable and robust expression of the protein.
- One cell line with a good productivity of TNK was used to create the master cell bank, from which working cell bank was prepared and was used in the large-scale perfusion fermentation upstream processes.
- the TNK secreted by each clone was tested for the integrity and quality of the protein; also tests were performed to determine the enzymatic activities associated with this protein as per pharmacopoeia standards for medicinal applications.
- the TNK amino acid sequence was expressed under the control of CMV promoter/enhancer constitutive expression system in CHO cells.
- a new continuous fermentation technology called perfusion bioreactor was employed for the large-scale production of the protein.
- the TNK producing CHO cells were grown in the IMDM medium [INVITROGEN] with foetal bovine serum (FBS). From a culture of about 1 ⁇ 10 6 recombinant cells, final amount of about 6-12 ⁇ 10 9 cells were achieved with serial amplification of the cells in tissue culture flasks and roller bottles over a period of several days. The culturing conditions maintained at all steps during cell mass generation were: temperature: 36.5° C., CO 2 : 5% and FBS: 10%.
- the confluence of the cell was maintained at >90% of the growing surface area in the flasks and bottles at all steps before harvesting of the cells for the next step.
- Periodic microscopy and biochemical tests were performed to detect the health and integrity of the growing cells. Then they were removed with mild trypsin treatment for transfer to the bioreactor, which was equipped with pH and DO probes and the cell supporting media in the core of the reactor to hold the cell in the reactor.
- the sterilised 5-L reactor was then inoculated with 6-12 ⁇ 10 9 cells and allowed to run for 3-4 day at glucose concentration of about 1-2 gm/L. This process led to the settling of the cells in the reactor in healthy conditions.
- Reactor parameters were: temperature: 36.6° C., aeration: 1.0 L/min, pH: between 7.2-7.4 [maintained using CO 2 and saturated sodium bicarbonate solution], agitation: 100 rpm, dissolved oxygen: 30%.
- the medium was changed from IMDM with FBS to CHO-S-SFM II [INVITROGEN] without FBS. This medium was used throughout the product stage.
- reactor temperature was kept at 33.5° C. during the production phase and about 100 L of the harvest collected every day while maintaining the reactor glucose level between 0.3-1.5 gm/L.
- the perfusion bioreactor can be run to collect up to 10,000 L of the harvest over a period of 3-4 months.
- the batches of harvested broth were filtered through 0.45 ⁇ m filters, collected in sterile containers and stored at 2-8° C. till further processed.
- the pools of harvested broth were periodically tested for the TNK content and sterility with established methods [ FIGS. 1 and 2 ].
- the batches of harvested broth were tested for the TNK content, its integrity and sterility [ FIGS. 1 and 2 ].
- a series of chromatography steps was used.
- a batch of about 1000 L harvested broth with TNK content of about 10 mg/L was loaded on to a fast liquid chromatography (FLC) system column (300 mm ⁇ 500 mm) with 11 L of activated dye affinity resin (Blue Sepharose 6 FF resin; GE Healthcare).
- FLC fast liquid chromatography
- the column was equilibrated with equilibrium buffer-1 (EB-1, sodium phosphate: 20 mM, NaCl: 0.15 M, pH 7.2) by passing 2 column volumes (CVs) at a flow rate of about 100-150 cm/h.
- equilibrium buffer-1 EB-1, sodium phosphate: 20 mM, NaCl: 0.15 M, pH 7.2
- the harvest was loaded onto the column with a linear flow rate of about 100-150 cm/h, followed by passing EB-1 of 2 CVs at a flow rate of about 100 cm/h. This was followed by 2-3 CVs of the wash buffer (WB-1, sodium phosphate: 20 mM, NaCl: 2 M, pH 7.2) at a flow rate of 100-150 cm/h.
- the bound target protein was eluted by passing about 4 CVs of elution buffer-1, (EUB-1, sodium phosphate: 20 mM, NaCl: 1M, urea: 3 M, pH 7.2) and collected based on the absorbance at 280 nm.
- the eluate (E-1) was analysed for protein quantity and purity by SDS-PAGE electrophoresis. At this step, the TNK content in the total protein is about 90%.
- buffer was exchanged using gel filtration chromatography. E-1 was loaded on to a column (300 mm ⁇ 750 mm) with 25 L of gel filtration resin (Sephadex G-25). The column was then washed with 2 CVs of the exchange buffer (sodium phosphate: 20 mM, pH 7.2) with a linear flow rate of about 100-150 cm/h, and the eluate (E-2) was collected in a sterile container.
- the exchange buffer sodium phosphate: 20 mM, pH 7.2
- E-2 was loaded onto a column (200 mm ⁇ 500 mm) with 4.5 L of activated L-lysine affinity resin (Lysine HyperD resin; Pall Corp.).
- the column was then equilibrated with equilibrium buffer-2 (EB-2, sodium phosphate: 20 mM, polysorbate-20: 0.043%, pH 7.2) by passing 2 column volumes (CVs) at a flow rate of about 100-150 cm/h, followed by passing 2 CVs of WB-2 (sodium phosphate: 20 mM, NaCl: 1 M, polysorbate-20: 0.043%, pH 7.2) at a flow rate of about 100 cm/h.
- equilibrium buffer-2 EB-2, sodium phosphate: 20 mM, polysorbate-20: 0.043%, pH 7.2
- WB-2 sodium phosphate: 20 mM, NaCl: 1 M
- polysorbate-20 0.043%, pH 7.2
- the bound target protein was eluted bypassing 2 CVs of elution buffer-2 (EUB-2, arginine: 0.5 M, EACA (epsilon-aminocaproic acid): 0.2 M, polysorbate-20: 0.043%, pH 7.8 adjusted by phosphoric acid) and collected based on the absorbance at 280 nm.
- the eluate (E-3) was analysed for protein quantity and purity by SDS-PAGE electrophoresis [ FIGS. 1 and 2 ]. At this step the TNK content of the total proteins is more than 95%.
- TNK buffer exchange by GFC to bulk storage buffer (L-arginine: 55 g/L, phosphoric acid: 17 g/L, polysorbate ⁇ 20: 430 mg/L, pH 7.6 ⁇ 0.2).
- the final concentration of TNK in the solution was about 2 mg/mL, and the solution stored frozen till further use.
- This TNK solution was further concentrated using an anion exchanger resin (Capto Q resin, GE Healthcare) to 5 mg/mL before the formulations preparation.
- the in-process content of TNK in samples was determined by standard reducing and non-reducing SDS-PAGE methods [ FIGS. 1 and 2 ].
- 10% SDS-PAGE gels were prepared and 50 ⁇ g of the protein sample loaded to each well.
- reducing and non-reducing HPSEC high performance size exclusion chromatography
- the columns used for the HPSEC methods were silica-based size exclusion chromatography column for 10-500 KDa molecule separation range [ FIGS. 4 and 5 ].
- Standard and test samples were run in identical analysis conditions. Periodic in-process bioactivity assay were also performed to monitor the quality and integrity of the protein.
- TNK TNK-containing tyrene-containing tyrene-containing tyrene-maleic anhydride copolymer
- the various formulations of TNK were prepared to test the safety and efficacy of the TNK in the treatment of AIS.
- the formulations were based of the ratios as 1 part of TNK, 11 parts of L-arginine, 3.4 parts of phosphoric acid and 0.086 parts of polysorbate-20 as lyophilised products.
- the concentration of the bulk TNK solution used for this preparation was 5 mg/mL of TNK. After mixing the components without any precipitating TNK in the solution, the formulations were freeze-dried to stable powdery forms.
- a set of lyophilised formulations with TNK strength ranging from 0.10, 0.14, 0.18, 0.20, and 0.24 TNK per ml per 10-mL vial when reconstituted with 10 mL water for injection were prepared, and stored at about 4° C. till further used. These test formulations were subjected to different tests and stability studies, and found to be comparable in content and its stability for over a period of one year. The lyophilized formulations when reconstituted with 10 mL sterile water for injection to gave the above mentioned amount of TNK per mL in clear solutions for testing in clinical tests.
- the biological potency of the bulk and formulated TNK was determined by a rapid tubidimetric clot-lysis assay developed from the protocol of European pharmacopoeia monograph for alteplase.
- a rapid tubidimetric clot-lysis assay developed from the protocol of European pharmacopoeia monograph for alteplase.
- human plasminogen (1 mg/mL) and 1 mL of human fibrinogen (2 mg/mL) solutions were taken, mixed and kept at 0° C.
- 0.5 mL of human thrombin (33 IU/mL) and 0.5 mL of test or reference TNK (1 mg/mL total proteins) solutions were prepared, mixed and brought to 37° C. All the dilutions were prepared with the solvent buffer as disclosed.
- FIG. 5 shows an illustrative standard curve for measurements of the TNK bioactivity.
- the bioactivity of the batch used here was 203 IU/mg.
- Tables B and C depict the numbers for the reference samples and test samples of TNK obtained in the clot-lysis bioactivity assay.
- TNK bioassay test samples Calculated amount Test Protein Conc. Time (sec.) to clot- of TNK in Sample Sample (ng/mL) of lysis for Sample (ng/mL) using No. TEST Sample [avg. of 2] STD. curve 1 100 3930.16 96.4 2 200 2970.70 199.5 3 400 2135.70 399.4 4 800 1538.90 804.7 5 1600 1091.50 1607.2
- the clinical testing of the TNK formulations for AIS was performed using established methods used in clinical medicine.
- two doses of TNK were used ⁇ 0.1 mg/kg IV (intravenous injection) bolus and 0.2 mg/kg IV bolus in a randomized schedule.
- the TNK was injected as a bolus IV injection after confirmation of no intra-cerebral haemorrhage by CT scans over the period of 5-10 seconds.
- the dose of 0.1 mg/kg IV was received by 14 subjects and the dose of 0.2 mg/kg IV was received by 21 subjects.
- the NIH-SS National Institute of Health Stroke Scale
- the NIH-SS score improvement of ⁇ 4 was considered as clinically significant improvement (Table 2).
- the 0.2 mg/kg group showed higher incidence of efficacy at this parameter at 24 hours (80.95%) which increased to 95.24% on Day 7. Although there was no statistically significant difference between the two dosage groups, this data suggested that the 0.2 mg/kg dose was preferable.
- TNK showed efficacy in 28.57% subjects which was numerically higher than the TNK 0.2 mg/kg data (24%) of Haley 2005 [Stroke 2005; 36: 607-612] and statistically non-significant compared to Haley 2010 [Stroke 2010; 41: 707-11] data (35.5%) with TNK 0.25 mg/kg.
- Asymptomatic ICH was detected by CT scan at 48 hours in one subject in the 0.1 mg/kg group and in 2 subjects in the 0.2 mg/kg group.
- N 21 p value # At 24 hrs 1 (7.14) 6 (28.57) 0.202 n (%) At 48 hrs 2 (14.29) 9 (42.86) 0.136 n (%) At day 7 2 (14.29) 12 (57.14) 0.015 n (%) p value @ 1 0.118 NA # p value, when compared between the groups @ p value, when compared data at 24 hrs and at day 7 value within the group P ⁇ 0.005—statistically significant; NA—Not applicable.
- N Number of patients Fisher's Exact Test was applied for proportions. n—proportions of patients.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Dermatology (AREA)
- General Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Heart & Thoracic Surgery (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cardiology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Molecular Biology (AREA)
- Inorganic Chemistry (AREA)
- Urology & Nephrology (AREA)
- Vascular Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Enzymes And Modification Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IN3516MU2010 | 2010-12-23 | ||
| IN3516/MUM/2010 | 2010-12-23 | ||
| PCT/IN2011/000863 WO2012085933A1 (en) | 2010-12-23 | 2011-12-16 | Pharmaceutical compositions of tenecteplase |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IN2011/000863 A-371-Of-International WO2012085933A1 (en) | 2010-12-23 | 2011-12-16 | Pharmaceutical compositions of tenecteplase |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/136,614 Division US9943575B2 (en) | 2010-12-23 | 2016-04-22 | Pharmaceutical compositions of tenecteplase |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20130323227A1 true US20130323227A1 (en) | 2013-12-05 |
Family
ID=46313261
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/993,297 Abandoned US20130323227A1 (en) | 2010-12-23 | 2011-12-16 | Pharmaceutical compositions of tenecteplase |
| US15/136,614 Active US9943575B2 (en) | 2010-12-23 | 2016-04-22 | Pharmaceutical compositions of tenecteplase |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/136,614 Active US9943575B2 (en) | 2010-12-23 | 2016-04-22 | Pharmaceutical compositions of tenecteplase |
Country Status (17)
| Country | Link |
|---|---|
| US (2) | US20130323227A1 (enExample) |
| EP (1) | EP2654770B1 (enExample) |
| JP (1) | JP6375112B2 (enExample) |
| CN (1) | CN103391785A (enExample) |
| AU (1) | AU2011346515B2 (enExample) |
| BR (1) | BR112013015914B1 (enExample) |
| CO (1) | CO6721059A2 (enExample) |
| DK (1) | DK2654770T3 (enExample) |
| EA (1) | EA026017B1 (enExample) |
| ES (1) | ES2687850T3 (enExample) |
| LT (1) | LT2654770T (enExample) |
| MX (1) | MX356199B (enExample) |
| MY (1) | MY171723A (enExample) |
| NZ (1) | NZ611706A (enExample) |
| PL (1) | PL2654770T3 (enExample) |
| PT (1) | PT2654770T (enExample) |
| WO (1) | WO2012085933A1 (enExample) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20180223270A1 (en) * | 2014-10-21 | 2018-08-09 | Gennova Biopharmaceuticals Limited | A novel purification process for isolation and commercial production of recombinant tnk-tpa tenecteplase |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018210860A1 (en) * | 2017-05-16 | 2018-11-22 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods and pharmaceutical compositions for the treatment of acute ischemic stroke |
| EP3802780A4 (en) * | 2018-06-01 | 2022-03-23 | Gennova Biopharmaceuticals Limited | PROCEDURE FOR THE PRODUCTION OF RECOMBINANT TNK-TPA BY A PACKED BED PERFUSION SYSTEM |
| CN114984197A (zh) * | 2022-07-01 | 2022-09-02 | 江苏丰华生物制药有限公司 | 替奈普酶在制备用于治疗急性缺血性卒中的药物组合物中的应用 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008152075A1 (en) * | 2007-06-13 | 2008-12-18 | Cmc Biologics A/S | A method for producing a biopolymer (e.g. polypeptide) in a continuous fermentation process |
| US20100330083A1 (en) * | 2002-11-14 | 2010-12-30 | Genentech, Inc. | Plasminogen activator variant formulations |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE10230752A1 (de) * | 2002-07-09 | 2004-01-22 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Neue Arzneimittelkompositionen auf der Basis von Magnesiumsalzen und Fibrinolytika |
| US20070166299A1 (en) * | 2005-03-02 | 2007-07-19 | The Regents Of The University Of California | Treatment for embolic stroke |
| WO2006094120A2 (en) * | 2005-03-02 | 2006-09-08 | The Regents Of The University Of California | Treatment for embolic stroke |
| CN101505785A (zh) * | 2006-08-29 | 2009-08-12 | 健泰科生物技术公司 | 替奈普酶用于治疗急性缺血性中风的用途 |
| JP5871449B2 (ja) * | 2006-11-07 | 2016-03-01 | ジェネンテック, インコーポレイテッド | 組織プラスミノゲン活性化因子バリアントの使用 |
-
2011
- 2011-12-16 AU AU2011346515A patent/AU2011346515B2/en active Active
- 2011-12-16 ES ES11851346.4T patent/ES2687850T3/es active Active
- 2011-12-16 NZ NZ611706A patent/NZ611706A/en unknown
- 2011-12-16 US US13/993,297 patent/US20130323227A1/en not_active Abandoned
- 2011-12-16 EA EA201300746A patent/EA026017B1/ru unknown
- 2011-12-16 LT LTEP11851346.4T patent/LT2654770T/lt unknown
- 2011-12-16 BR BR112013015914-6A patent/BR112013015914B1/pt active IP Right Grant
- 2011-12-16 MX MX2013007381A patent/MX356199B/es active IP Right Grant
- 2011-12-16 PL PL11851346T patent/PL2654770T3/pl unknown
- 2011-12-16 PT PT11851346T patent/PT2654770T/pt unknown
- 2011-12-16 DK DK11851346.4T patent/DK2654770T3/en active
- 2011-12-16 CN CN2011800675266A patent/CN103391785A/zh active Pending
- 2011-12-16 EP EP11851346.4A patent/EP2654770B1/en active Active
- 2011-12-16 WO PCT/IN2011/000863 patent/WO2012085933A1/en not_active Ceased
- 2011-12-16 JP JP2013545634A patent/JP6375112B2/ja active Active
- 2011-12-16 MY MYPI2013002136A patent/MY171723A/en unknown
-
2013
- 2013-07-05 CO CO13159374A patent/CO6721059A2/es unknown
-
2016
- 2016-04-22 US US15/136,614 patent/US9943575B2/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100330083A1 (en) * | 2002-11-14 | 2010-12-30 | Genentech, Inc. | Plasminogen activator variant formulations |
| WO2008152075A1 (en) * | 2007-06-13 | 2008-12-18 | Cmc Biologics A/S | A method for producing a biopolymer (e.g. polypeptide) in a continuous fermentation process |
| US20100184149A1 (en) * | 2007-06-13 | 2010-07-22 | Cmc Biologics A/S | Method For Producing a Biopolymer (e.g. polypeptide) In A Continuous Fermentation Process |
Non-Patent Citations (1)
| Title |
|---|
| Jiang et al., "Characterization of the Glycosylation Occupancy and the Active Site in the Follow-on Protein Therapeutic: TNK-Tissue Plasminogen Activator", Analytical Chemistry (July 2010), Vol. 82, pages 6154-6162. * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20180223270A1 (en) * | 2014-10-21 | 2018-08-09 | Gennova Biopharmaceuticals Limited | A novel purification process for isolation and commercial production of recombinant tnk-tpa tenecteplase |
| US10544408B2 (en) * | 2014-10-21 | 2020-01-28 | Gennova Biopharmaceuticals Limited | Purification process for isolation and commercial production of recombinant TNK-tPA tenecteplase |
Also Published As
| Publication number | Publication date |
|---|---|
| PT2654770T (pt) | 2018-10-19 |
| MY171723A (en) | 2019-10-24 |
| LT2654770T (lt) | 2018-09-10 |
| AU2011346515B2 (en) | 2017-01-19 |
| JP6375112B2 (ja) | 2018-08-15 |
| CN103391785A (zh) | 2013-11-13 |
| MX356199B (es) | 2018-05-18 |
| EA026017B1 (ru) | 2017-02-28 |
| NZ611706A (en) | 2015-04-24 |
| WO2012085933A1 (en) | 2012-06-28 |
| CO6721059A2 (es) | 2013-07-31 |
| DK2654770T3 (en) | 2018-10-29 |
| AU2011346515A1 (en) | 2013-07-04 |
| BR112013015914A2 (pt) | 2016-10-11 |
| EP2654770A1 (en) | 2013-10-30 |
| BR112013015914B1 (pt) | 2021-06-08 |
| ES2687850T3 (es) | 2018-10-29 |
| EP2654770A4 (en) | 2014-05-21 |
| EP2654770B1 (en) | 2018-07-11 |
| EA201300746A1 (ru) | 2013-11-29 |
| US20160310580A1 (en) | 2016-10-27 |
| MX2013007381A (es) | 2013-08-29 |
| JP2014502608A (ja) | 2014-02-03 |
| US9943575B2 (en) | 2018-04-17 |
| PL2654770T3 (pl) | 2018-12-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP4483952A2 (en) | Compositions suitable for treating collagen-mediated diseases | |
| EP0217379B1 (en) | Thrombolytic composition and a process for production thereof | |
| DE3316297A1 (de) | Humangewebe-plasminogen-aktivator | |
| US9943575B2 (en) | Pharmaceutical compositions of tenecteplase | |
| US4898826A (en) | Method to solubilize tissue plasminogen activator | |
| AU611932B2 (en) | Novel complex | |
| KR100508043B1 (ko) | rDSPAα1의 제조방법 | |
| US5342616A (en) | Method of administering tissue plasminogen activator | |
| CN108559740B (zh) | 重组安克洛酶及工业规模制备方法和治疗急性脑梗的应用 | |
| WO1990001333A1 (en) | METHOD FOR PREPARING tPA COMPOSITIONS | |
| CA1338551C (en) | Medicament for thrombotic disorder containing t-pa | |
| CN110016471B (zh) | 重组安克洛酶及工业规模制备和纯化方法及其组合物 | |
| JPS6338327B2 (enExample) | ||
| CA2245554C (en) | Method for the production of rdspa .alpha.1 | |
| DE4443273A1 (de) | Verwendung der Proteasedomäne von humanem Plasminogenaktivator zur Behandlung von thromboembolischen Erkrankungen |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: GENNOVA BIOPHARMACEUTICALS LIMITED, INDIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MISHRA, MAHESHWARI K;SINGH, SANJAY;BHANDARI, PRITIRANJAN;REEL/FRAME:030885/0301 Effective date: 20130614 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |