EP3122890A1 - Nouveaux flavonoïdes o-alpha-glucosylés sur le cycle b, procédé d'obtention et utilisations - Google Patents

Nouveaux flavonoïdes o-alpha-glucosylés sur le cycle b, procédé d'obtention et utilisations

Info

Publication number
EP3122890A1
EP3122890A1 EP15714775.2A EP15714775A EP3122890A1 EP 3122890 A1 EP3122890 A1 EP 3122890A1 EP 15714775 A EP15714775 A EP 15714775A EP 3122890 A1 EP3122890 A1 EP 3122890A1
Authority
EP
European Patent Office
Prior art keywords
group
sequence
amino acid
representing
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP15714775.2A
Other languages
German (de)
English (en)
Inventor
Sandrine Morel
Isabelle Andre
Yoan BRISON
Emmanuelle CAMBON
Yannick MALBERT
Denis Pompon
Magali Remaud-Simeon
Philippe Urban
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Institut National des Sciences Appliquees de Toulouse INSA
Institut National de Recherche pour lAgriculture lAlimentation et lEnvironnement
Original Assignee
Centre National de la Recherche Scientifique CNRS
Institut National des Sciences Appliquees de Toulouse INSA
Institut National de la Recherche Agronomique INRA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centre National de la Recherche Scientifique CNRS, Institut National des Sciences Appliquees de Toulouse INSA, Institut National de la Recherche Agronomique INRA filed Critical Centre National de la Recherche Scientifique CNRS
Publication of EP3122890A1 publication Critical patent/EP3122890A1/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H15/00Compounds containing hydrocarbon or substituted hydrocarbon radicals directly attached to hetero atoms of saccharide radicals
    • C07H15/20Carbocyclic rings
    • C07H15/203Monocyclic carbocyclic rings other than cyclohexane rings; Bicyclic carbocyclic ring systems
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N43/00Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds
    • A01N43/02Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having rings with one or more oxygen or sulfur atoms as the only ring hetero atoms
    • A01N43/04Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having rings with one or more oxygen or sulfur atoms as the only ring hetero atoms with one hetero atom
    • A01N43/14Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having rings with one or more oxygen or sulfur atoms as the only ring hetero atoms with one hetero atom six-membered rings
    • A01N43/16Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having rings with one or more oxygen or sulfur atoms as the only ring hetero atoms with one hetero atom six-membered rings with oxygen as the ring hetero atom
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7048Compounds having saccharide radicals and heterocyclic rings having oxygen as a ring hetero atom, e.g. leucoglucosan, hesperidin, erythromycin, nystatin, digitoxin or digoxin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/60Sugars; Derivatives thereof
    • A61K8/602Glycosides, e.g. rutin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • A61P15/12Drugs for genital or sexual disorders; Contraceptives for climacteric disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/14Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00Preparations for care of the skin
    • A61Q19/02Preparations for care of the skin for chemically bleaching or whitening the skin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D311/00Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings
    • C07D311/02Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings ortho- or peri-condensed with carbocyclic rings or ring systems
    • C07D311/04Benzo[b]pyrans, not hydrogenated in the carbocyclic ring
    • C07D311/22Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4
    • C07D311/26Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4 with aromatic rings attached in position 2 or 3
    • C07D311/28Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4 with aromatic rings attached in position 2 or 3 with aromatic rings attached in position 2 only
    • C07D311/30Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4 with aromatic rings attached in position 2 or 3 with aromatic rings attached in position 2 only not hydrogenated in the hetero ring, e.g. flavones
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D311/00Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings
    • C07D311/02Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings ortho- or peri-condensed with carbocyclic rings or ring systems
    • C07D311/04Benzo[b]pyrans, not hydrogenated in the carbocyclic ring
    • C07D311/22Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4
    • C07D311/26Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4 with aromatic rings attached in position 2 or 3
    • C07D311/28Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4 with aromatic rings attached in position 2 or 3 with aromatic rings attached in position 2 only
    • C07D311/322,3-Dihydro derivatives, e.g. flavanones
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H1/00Processes for the preparation of sugar derivatives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H17/00Compounds containing heterocyclic radicals directly attached to hetero atoms of saccharide radicals
    • C07H17/04Heterocyclic radicals containing only oxygen as ring hetero atoms
    • C07H17/06Benzopyran radicals
    • C07H17/065Benzo[b]pyrans
    • C07H17/07Benzo[b]pyran-4-ones
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/44Preparation of O-glycosides, e.g. glucosides
    • C12P19/46Preparation of O-glycosides, e.g. glucosides having an oxygen atom of the saccharide radical bound to a cyclohexyl radical, e.g. kasugamycin
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/44Preparation of O-glycosides, e.g. glucosides
    • C12P19/60Preparation of O-glycosides, e.g. glucosides having an oxygen of the saccharide radical directly bound to a non-saccharide heterocyclic ring or a condensed ring system containing a non-saccharide heterocyclic ring, e.g. coumermycin, novobiocin
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/01Hexosyltransferases (2.4.1)
    • C12Y204/01004Amylosucrase (2.4.1.4)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/01Hexosyltransferases (2.4.1)
    • C12Y204/01005Dextransucrase (2.4.1.5)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/01Hexosyltransferases (2.4.1)
    • C12Y204/0114Alternansucrase (2.4.1.140)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2800/00Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
    • A61K2800/40Chemical, physico-chemical or functional or structural properties of particular ingredients
    • A61K2800/52Stabilizers
    • A61K2800/522Antioxidants; Radical scavengers

Definitions

  • New ⁇ - ⁇ -glucosyl flavonoids on cycle B process of obtaining and uses.
  • the present invention relates to the field of the glucosylation of flavonoids and more particularly of the ⁇ -glucosylation of certain flavonoids, in order to obtain on- ⁇ -glucosyl flavonoid derivatives, in particular on their aromatic ring B, at the level of non-hydroxyl functions. vicinal.
  • the present invention also relates to the O- ⁇ -glucosyl compounds obtained from a glucosylation process of the invention and the use of these compounds for various purposes, in particular cosmetic or therapeutic purposes.
  • Flavonoids are compounds having a C 6 -C 3 -C 6 carbonaceous structure, the backbone of which is a cyclic system of type 1-benzopyran, in which the aromatic ring is defined as ring A and the pyranic ring is defined as as ring C, which also comprises a phenyl substituent, on the pyranic ring, as ring B.
  • the flavonoids can be hydroxylated in many positions, and these hydroxyl groups are frequently methylated, acetylated, prenylated or sulfated. In plants, they are most often present in the form of soluble C- or O-glycosylated glycosides.
  • glucosylation is based on the use of Leloir type glucosyltransferases, capable of transferring the glucosyl residue of a sugar nucleotide (UDP-glucose) to the flavonoid skeleton.
  • UDP-glucose sugar nucleotide
  • UDP glycosyl transferases have been isolated and cloned into different microorganisms. The natural or recombinant forms of these enzymes can thus be implemented in vitro for the production of glucosylated flavonoids.
  • UDP glycosyl transferase from Bacillus cereus has been expressed in Escherichia coli (E. coli).
  • This glucosyl enzyme Papigenin, genistein, kaempferol, luteolin, naringenin and quercetin.
  • Position 3 is the preferentially glucosylated position, but in the absence of hydroxyl function at this position, glucosylation takes place at position 7.
  • the products obtained by the recombinant enzyme are identical to those produced by the wild-type enzyme (Ko JH et al., FEMS Microbiol Lett, 2006, 258: 263-268).
  • Bacillus licheniformis DSM 13 UDP-glucosyltransferase YjiC was used for glucosylating Papigenine. Two ⁇ -mono-glucosylated forms, in position 4 'or in position 7, were obtained. A ⁇ -diglucosylated form at positions 4 'and 7 was also structurally characterized (Gurung, R.B. et al., Mol.cells 2013, 36 (4): 355-361).
  • Oleandomycin glycosyl transferase (OleD GT) from Streptomyces antibioticus was expressed in E. coli BL 21.
  • the purified enzyme catalyzes the glucosylation of several flavonoids: apigenin, chrysin, daidzein, genistein, kaempferol, luteolin, naringenin and quercetin, from UDP-glucose. The best conversion (90%) was obtained with naringenin at 20 ⁇ in 5 h. No indication of the position of glucosylation is specified in the publication. (Choi SH et al., Biotechnol Lett 2012, 34: 499-505).
  • RhGT1 The UDP-glycosyltransferase RhGT1 from Rosa hybrida was tested on a collection of 24 flavonoids. It shows results comparable to those obtained with oleandomycin glycosyl transferase in terms of acceptor recognition (Wang L et al., Carbohydr Res 2013, 368: 73-77).
  • glycosylation of flavonoids in vitro can be carried out by the use of glycoside-hydrolase type enzymes, cyclodextrin-glucanotransferase transglycosylase or glycoside phosphorylase.
  • the enzymatic glycosylation of flavonoids in vitro can be achieved via the implementation of glucan saccharases.
  • a synthetic route leads to the production of ⁇ -glucosylated flavonoids, and is based on the use of glucan-saccharases belonging to the 13 or 70 families of glycoside hydrolases (GH 13 and GH 70) (CAZy classification - Henrissat B, Davies GJ, Curr Op Op Struct Biol., 97, 7: 637-64).
  • Glucansucrases are transglucosylases which catalyze from sucrose the synthesis of homopolymers, consisting of ⁇ -D-glucosyl units, called glucan. These glucans are generally of very high molar mass (10 8 Da), and have various structures due to the presence of different types of osidic bonds ( ⁇ -1, 2, ⁇ -1, 3, ⁇ -1, 4, and or ⁇ -1, 6) as well as their location in the polymer. Isomers of sucrose and glucose are also produced from sucrose but in very small amounts compared to the polymer.
  • these enzymes are capable of glucosylating hydroxylated molecules called "acceptors", introduced into the reaction medium in addition to sucrose, such as flavonoids.
  • acceptors hydroxylated molecules
  • the degree of glucosylation of the acceptor depends on its structure as well as that of the enzyme.
  • an efficient acceptor, or a good acceptor will be able to divert polymer synthesis almost completely to the benefit of its own glycosylation.
  • an ineffective acceptor, or bad acceptor can only very slightly divert the synthesis of polymers and therefore will be very little, if any, glucosylated.
  • Streptococcus sobrinus 6715 was performed in 100 mM phosphate buffer (pH 6) in the presence of 1 g of catechin and 2% of sucrose (Nakahara et al., Appl., Environ Microbiol., 1995, 61: 2768-2770).
  • the monoglucosylated product obtained with a yield of 13.7% is 4'-O- ⁇ -D-glucopyranosyl - (+) - catechin.
  • Epigallocatechin gallate was also glucosylated in the presence of sucrose and glucansucrase of Leuconostoc mesenteroides B-1299CB (Moon et al., Journal of Molecular Catalysis B: Enzymatic, 2006, 40: 1-7). A mixture of three products was obtained:
  • Glucosylation of quercetin was performed in 2007 in the presence of sucrose and glucansucrase of Leuconostoc mesenteroides B-1299CB (Moon YH et al., Enzyme Microb Technol 2007, 40: 124-1129). A mixture of two products monoglucosylates is obtained: 4'-O- ⁇ -D-glucopyranosylquercetin and 3'-O- ⁇ -D-glucopyranosylquercetin.
  • Auriol et al. have described the preparation of phenolic derivatives obtained by enzymatic condensation between phenolic compounds selected from pyrocatechols or their derivatives, and the glucosyl residue from sucrose.
  • the production of these phenol compounds derivatives is carried out with a glucosyltransferase (EC 2.4.1.5).
  • the O- ⁇ -D-glucosides of synthesized phenolic compounds have a solubility in water greater than that of their parent polyphenol.
  • antioxidant antiviral, antibacterial, immunostimulant, antiallergic, antihypertensive, anti-ischemic, antiarrhythmic, antithrombic, hypocholesterolemic, antilipoperoxidant, hepatoprotective, anti-inflammatory, anticarcinogenic, antimutagenic, antineoplastic and vasodilators.
  • the glucosylation of ampelopsin was furthermore carried out in the presence of sucrose and glucansucrase of Leuconostoc mesenteroides B-1299CB4.
  • Five glucosylation products were isolated and the monoglucosylation product characterized: it is 4'-O- ⁇ -D-glucopyranosylampelopsin (Woo HJ et al., Enzyme Microb Technol., 2012 51: 311-318).
  • the present invention provides a process for producing O- ⁇ -glucosylated flavonoid derivatives comprising at least one step of incubating a glucanucrase with a flavonoid and at least one sucrose, wherein:
  • ring C represents a ring selected from the group consisting of the following rings of formulas (II), (III), (IV) or (V):
  • one of the groups R1, R2 or R3 represents a ring B of formula (VI)
  • R 8 and only one of the groups selected from R 10 , R 11 and R 12 represent a hydroxyl group
  • R 9 and the other groups of R 10 , R 11 and R 12 being chosen from the group comprising a hydrogen atom; a linear or branched, saturated or unsaturated C 1 -C 10 hydrocarbon group optionally interrupted by at least one heteroatom selected from O, N or S; a halogen atom; a C 5 -C 9 aryl; a C 4 -C 9 heterocycle; a (C 1 -C 3 ) alkoxy group; a C 2 -C acyl; a C 1 -C 3 alcohol; a -COOH group; -NH 2 ; -CONH 2 ; -CHO; -SH; -C (O) O (C 2 -C 3 ); an amino C 1 -C 3 alkyl; a C 1 -C 3 imine; a nitrile group; a C 1 -C 3 haloalkyl; a C 1 -C 3 thioalkyl; a group -C (
  • R 9 and only one of the groups selected from R 11 and R 12 represent a hydroxyl group
  • R 8 , R 10 , and the other group of R 11 and R 12 which are identical or different, being chosen from the group comprising a hydrogen atom; a linear or branched, saturated or unsaturated C 1 -C 10 hydrocarbon group optionally interrupted by at least one heteroatom selected from O, N or S; a halogen atom; a C 5 -C 9 aryl; a C 4 -C 9 heterocycle; a (C 1 -C 3 ) alkoxy group; a C 2 -C 3 acyl; a C 1 -C 3 alcohol; a -COOH group; -NH 2 ; -CONH 2 ; -CHO; -SH; -C (O) O (C 2 -C 3 ); a C 1 -C 3 amine; a C 1 -C 3 imine; a nitrile group; a C 1 -C 3 haloalkyl; a C 1 -C 3 thioalkyl;
  • R 10 and R 12 represent a hydroxy group
  • the groups R 8 , R 9 and R 11 being chosen from the group comprising a hydrogen atom; a linear or branched, saturated or unsaturated C 1 -C 10 hydrocarbon group optionally interrupted by at least one heteroatom selected from O, N or S; a halogen atom; a C 5 -C 9 aryl; a C 4 -C 9 heterocycle; a (C 1 -C 3 ) alkoxy group; a C 2 -C 3 acyl; a C 1 -C 3 alcohol; a -COOH group; -NH 2 ; -CONH 2 ; -CHO; -SH; -C (O) O (C : -C 3 ); a C 1 -C 3 amine; a C 1 -C 3 imine; a nitrile group; a C 1 -C 3 haloalkyl; a C 1 -C 3 thioalkyl; a group -C (W); and
  • R 8 , R 10 and R 12 represent a hydroxy group
  • the groups R 9 and R 11 identical or different, being chosen from the group comprising a hydrogen atom; a linear or branched, saturated or unsaturated C 1 -C 10 hydrocarbon group optionally interrupted by at least one heteroatom selected from O, N or S; a halogen atom; a C5-G aryl); a C 4 -C 9 heterocycle; a (C 1 -C 3 ) alkoxy group; acyl, C 2 -C 3; a C 1 -C 3 alcohol; a -COOH group; -NH 2 ; -CONH 2 ; -CHO; -SH; -C (O) O (C 2 -C 3 ); a C 1 -C 3 amine; a C 1 -C 3 imine; a nitrile group; a C 1 -C 3 haloalkyl; a C 1 -C 3 thioalkyl; a group
  • W represents a chain consisting of 1 to 6 glycoside (s);
  • R 1, R 2 'and R 3, which are identical or different, being chosen from the group comprising a hydrogen atom; a linear or branched, saturated or unsaturated C 1 -C 10 hydrocarbon group optionally interrupted by at least one heteroatom selected from O, N or S; a halogen atom; a C 5 -C 9 aryl; a heterocyclic C 4 -C 9; a group
  • R 1 and R 2 when R 1 does not represent a ring B of formula (VI), or R 2 and R 2 'when R 2 does not represent a ring B of formula (VI), or R 3 and R' when R 3 does not represent a ring B of formula (VI), together form a group 0;
  • glucan-sucrase being selected from the group consisting of:
  • sequence having at least 80% identity with SEQ ID NO: 2 said sequence having an amino acid X 2 representing an amino acid selected from the group consisting of A. C, D, F, G, H, K L, M, N, P, S, V and Y;
  • SEQ ID NO: 4 said X 4 amino acid sequence being an amino acid selected from the group consisting of C, I, N, P, V and W;
  • X 9 represents, independently of X 10 , X 11 , X 12 and X 13 , an amino acid selected from the group consisting of G, S, V, C, F, N, I, L and W;
  • X 10 is independently XQ, X 11, X 12 and X 13, an amino acid selected from the group consisting of L, I, M, Y and F;
  • X 11 representing, independently of X 9 , X 10 , X 11 and X 13 , an amino acid selected from the group consisting of E and A;
  • X 12 represents, independently of X 9 , X 10 , X 11 and X 13 , an amino acid selected from the group consisting of L and F and
  • X 12 represents, independently of X ⁇ >, ⁇ ) 0 , X 11 and X 13 , an amino acid selected from the list consisting of A, R, D, N, C, E, Q, G, H, I, L ,, M, P, S, T, W, Y and V, preferably I; and
  • X 13 represents, independently of X 9 , X 1 () , X 11 and X 12 , an amino acid selected from the list consisting of A, R, D, N, C, E, Q, G, H, I, K , M, F, P, S, T, W, Y and V, preferably I.
  • glucan-saccharase used in a method of the invention is chosen from the group comprising:
  • sequence having at least 80% identity with SEQ ID NO: 2 said sequence having an amino acid X 2 representing an amino acid selected from the group consisting of A, C, F, L, M, S or V ;
  • X 9 represents an amino acid selected from the group consisting of G, V, C and
  • X 10 representing F
  • X 11 representing A
  • X 12 representing F
  • X 13 representing L
  • X 9 represents, independently of X 9 , X 10 , X 11 and X 13 , an amino acid selected from the group consisting of S, N, L and I;
  • X 10 representing, independently of X 9, X 11, X 12 and X 13, an amino acid selected from the group consisting of L, I, M and Y;
  • sequence having at least 80% identity with SEQ ID NO: 12 is the sequence SEQ ID NO: 13.
  • the subject of the invention is also an O- ⁇ -glycosylated flavonoid derivative obtained by the process of the invention, and in particular of formula (I) as defined above in which ring C represents the cycle of formula (IV ) in which the group R 1 represents a ring B of formula (VI); and at least ring B is O- ⁇ -glycosylated.
  • the present invention advantageously makes it possible to obtain flavonoid derivatives according to the invention which are at least O- ⁇ -glycosylated, in particular O- ⁇ -glucosylated, on the B-ring.
  • the invention further relates to a compound of formula (X) below:
  • X 1 and X 16 which are identical or different, are chosen from the group comprising a hydrogen atom; a linear or branched C 1 -C 6 alkyl; a -C (O) O (C 2 -C 3 ) group; and a chain consisting of 1 to 600,000 ⁇ -glucoside moieties.
  • a chain consisting of 1 to 600,000 ⁇ -glucoside groups according to the invention may more particularly consist of 1 to 500,000 ⁇ -glucoside groups, from 1 to 400,000 ⁇ -glucoside groups, from 1 to 300,000 ⁇ -glucoside groups, from 1 to 200,000 ⁇ -glucoside groups, from 2 to 100,000 ⁇ -glucoside groups, from 5 to 50,000 ⁇ -glucoside groups, from 10 to 25,000 ⁇ -glucoside groups or from 10 to 10,000 ⁇ -glucoside groups.
  • the invention also relates to a compound of formula (XI) below:
  • X 17 represents a chain consisting of 1 to 600,000 ⁇ -glucoside moieties
  • X 18 and X 19 which are identical or different, are chosen from the group comprising a hydrogen atom; a linear or branched C 1 -C 6 alkyl; a group -C (O) O (C 2 -C); and a chain consisting of 1 to 600,000 ⁇ -glucoside moieties.
  • the present invention also relates to the cosmetic use, as antioxidant agent, of at least one de- ⁇ -glycosylated flavonoid derivative according to the invention.
  • the present invention further provides an O- ⁇ -glycosylated flavonoid derivative according to the invention for its pharmaceutical use in the treatment and / or prevention of hepatotoxicity, allergies, inflammation, ulcers, tumors, menopausal disorders, or neurodegenerative diseases.
  • Another aspect of the invention relates to an O- ⁇ -glycosylated flavonoid derivative according to the invention for its pharmaceutical use as a veinotonic.
  • the present invention relates to the use of a flavonoid derivative
  • ⁇ - ⁇ -glycosylated according to the invention as a photovoltaic agent, insect repellent agent, bleaching agent, pesticidal agent, fungicidal agent and / or bactericidal agent.
  • the following terms mean:
  • linear or branched, saturated or unsaturated C 1 -C 10 hydrocarbon-based group optionally interrupted by at least one heteroatom selected from O, N or S: an alkyl or an alkylene;
  • alkyl a saturated, linear or branched, saturated hydrocarbon aliphatic group comprising from 1 to 10, preferably from 1 to 6 carbon atoms;
  • cycloalkyl a cyclic alkyl group comprising from 3 to 10 ring members, preferably from 3 to 8 ring members.
  • the cycloalkyl group is optionally substituted with one or more halogen atoms and / or alkyl groups;
  • heterocycle a cyclic alkyl group comprising from 4 to 9 ring members, preferably from 3 to 8 ring members, and consisting of 1 to 3 rings, comprising between 3 and 6 carbon atoms and 1 or more heteroatoms, for example 1, 2 or 3 heteroatoms, preferably 1 or 2, selected from nitrogen, oxygen and sulfur.
  • the heterocycle group is optionally substituted with one or more halogen atoms and / or alkyl groups;
  • partially cyclic alkyl group means an alkyl group of which only one part forms a ring
  • alkylene a linear or branched divalent alkylene group comprising from 1 to 10, preferably from 1 to 6, carbon atoms;
  • aryl a cyclic aromatic group comprising between 5 and 9 carbon atoms, for example a phenyl group;
  • heteroaryl a cyclic aromatic group comprising between 3 and 10 atoms, including 1 or more heteroatoms, for example between 1 and 4 heteroatoms, such as nitrogen, oxygen or sulfur, this group comprising one or more rings, preferably 1 or 2 cycles.
  • the heterocycles may comprise several fused rings.
  • the heteroaryls are optionally substituted by one or more alkyl groups or an oxygen atom.
  • - halogen an atom of chlorine, fluorine, bromine or iodine
  • - C 1 -C 3 alcohol an alcohol selected from methanol, ethanol, propanol and isopropanol;
  • a (C 1 -C 3 ) alkoxy a group chosen from a methoxyl, an ethoxyl, a propyloxyl and an isopropyloxyl;
  • C 2 -C 3 acyl a group chosen from an acetyl, a propylacetyl and an isopropylacetyl;
  • C 1 -C 3 amine a group chosen from a methylamine, an ethylamine and a propylamine;
  • C 1 -C 3 imine a group chosen from a methylimine, an ethylimine and a propylimine;
  • glycoside is used to designate a glycoside moiety.
  • glycoside units are known to those skilled in the art.
  • glycosides As examples of monosaccharide glycosides, the following glycosides may be mentioned: glucose, fructose, sorbose, mannose, galactose, talose, allose, gulose, idose, glucosamine, N-acetylglucosamine, mannoamine, galactosamine, glucuronic acid, rhamnose, arabinose , galacturonic acid, fucose, xylose, lyxose and ribose.
  • glycosides As examples of di- or oligosaccharide glycosides, the following glycosides may be mentioned:
  • maltose maltose, gentiobiose, lactose, cellobiose, isomaltose, melibiose, laminaribiose, chitobiose, xylobiose, mannobiose, sophorose, nigerose, kojibiose, rutinose, robinose,
  • oligo-sacchacaride panose, galactotriose, ⁇ -glucotriose, ⁇ -glucotetraose, galactotetraose, especially maltodextrins, maltotriose, isomaltotriose, maltotetraose, maltopentaose, maltoheptaose.
  • glycosides can also be cited:
  • starch drifts especially maltose, maltodextrins,
  • galactomannans and their derivatives.
  • the term "a chain consisting of 1 to 6 glycoside (s)" a sequence of 1 to 6 glycosides mentioned above.
  • a chain consisting of 1 to 600,000 o-glucoside groups a sequence of one to 600,000 glucosyl units linked to each other by a bonds.
  • Figure 1 illustrates the glucosylation efficiencies of apigenin (histogram - left-hand ordinate -%), the levels of relative activity on sucrose alone ( ⁇ blackheads - right-hand ordinate - AU) and the mass concentrations of glucosylated apigenin ( values above the histogram - mg / L), ASNp WT, DSR-S vardelA4N WT enzymes and their mutants ASNp I228F, ASNp I228L, ASNp I228M, ASNp F229A, ASNp F229N, ASNp A289W, ASNp F290C, ASNp F290K and DSR-S vardelA4N S512C.
  • Figure 2 illustrates the superposition of UV chromatograms ( ⁇ 340 nm) for the six representative mutants of the six categories of apigenin glucosylation product profiles.
  • the names of the enzymes corresponding to these reactions are indicated next to each chromatogram: ASNp A289W, DSR-S vardelA4N S512C, ASNp F290, ASNp F290C, ASNp F229N and ASNp 1228F.
  • On the abscissa Retention time in minutes; On the ordinate: Absorbance in mAU (Milliabsorbance Units).
  • Figure 3 illustrates the superposition of UV chromatograms ( ⁇ 340 nm) for the seven mutants representative of the six categories of naringenin glucosylation product profiles.
  • the names of the enzymes corresponding to these reactions are indicated next to each chromatogram: ASNp F290V, ASNp R226N, ASR C-APY del, "-1, 2 BrS, ASNp A289C, ASNp A289P / F290C and ASNp I228A.
  • On the abscissa Retention time in minutes; On the ordinate: Absorbance in mAU (Milliabsorbance Units).
  • FIG. 4 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the wild-type ASNp enzyme (ASNp WT), in comparison with the apigenin standard.
  • ASNp WT wild-type ASNp enzyme
  • Figure 5 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant ASNp I228F enzyme.
  • Figure 6 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant ASNp I228L enzyme.
  • abscissa Retention time in minutes;
  • Absorbance in mAU Absorbance Units.
  • Figure 7 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant ASNp I228M enzyme.
  • abscissa Retention time in minutes;
  • FIG. 8 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant ASNp F229A enzyme.
  • Figure 9 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant ASNp F229N enzyme.
  • abscissa Retention time in minutes;
  • Figure 10 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant ASNp A289W enzyme.
  • Figure 11 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant ASNp F290C enzyme.
  • Figure 12 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant ASNp F290K enzyme.
  • abscissa Retention time in minutes;
  • Figure 13 illustrates the UV chromatography profile obtained after glucosylation of apigenin, for the mutant enzyme DSR-S vardelA4N S512C.
  • abscissa Retention time in minutes; On the ordinate: Absorbance in mAU (Milliabsorbance Units). The nature of the different peaks is indicated directly on the profile.
  • Figure 14 illustrates the high resolution electrospray-positive mass spectrum for the mono-glucosylated form of apigenin obtained with the mutant DSR-S vardel A4N S512C enzyme. On the abscissa: ratio m / z; On the ordinate: relative abundance.
  • Figure 15 illustrates the high resolution MS MS spectrum in electrospray negative mode for the mono-glucosylated form of apigenin (at m / z 431, 11) obtained with the mutant enzyme DSR-S vardelA4N S512C. On the abscissa: ratio m / z; On the ordinate: relative abundance.
  • Figure 16 illustrates the high resolution electrospray-positive mass spectrum for the mono-glucosylated form of apigenin obtained with the mutant ASNp A289W enzyme. On the abscissa: ratio m / z; On the ordinate: relative abundance.
  • Figure 17 illustrates the high resolution mass spectrum in electrospray positive mode for the di-glucosylated forms of apigenin obtained with the mutant ASNp A289W enzyme. On the abscissa: ratio m / z; On the ordinate: relative abundance.
  • Figure 18 illustrates the high resolution MS MS spectrum in negative electrospray mode for one of the two di-glucosylated forms of apigenin (at m / z 593.16) obtained with the mutant ASNp A289W enzyme. On the abscissa: ratio m / z; On the ordinate: relative abundance.
  • Figure 19 illustrates the high resolution MS / MS spectrum in negative electrospray mode for one of the two diglucosylated forms of apigenin (at m / z 593.16) obtained with the mutant ASNp A289W enzyme. On the abscissa: ratio m / z; On the ordinate: relative abundance.
  • FIG. 20 illustrates the UV chromatography profile obtained after glucosylation of naringenin, for the wild ASNp enzyme (ASNp WT), compared with the naringenin standard.
  • ASNp WT wild ASNp enzyme
  • FIG. 21 illustrates the UV chromatography profile obtained after glucosylation of naringenin, for the ASNp 1228 A mutant enzyme.
  • abscissa Retention time in minutes
  • On the ordinate Absorbance in mAU (Milliabsorbance Units).
  • Figure 22 illustrates the UV chromatography profile obtained after glucosylation of naringenin, for the mutant ASNp A289C enzyme.
  • abscissa Retention time in minutes;
  • Absorbance in mAU Meliabsorbance Units.
  • FIG. 23 illustrates the UV chromatography profile obtained after glucosylation of naringenin, for the ASR-C-APY-del truncated wild-type enzyme.
  • Figure 24 illustrates the UV chromatography profile obtained after glucosylation of naringenin, for the mutant ASNp A289P / F290C enzyme.
  • Abscissa Retention time in minutes;
  • Absorbance in mAU Absorbance Units.
  • FIG. 25 illustrates the UV chromatography profile obtained after glucosylation of naringenin, for the wild-type enzyme ⁇ -1, 2 BrS.
  • Figure 26 illustrates the UV chromatography profile obtained after glucosylation of naringenin, for the mutant ASNp F290V enzyme.
  • Figure 27 illustrates the UV chromatography profile obtained after glucosylation of naringenin, for the mutant ASNp R226N enzyme.
  • abscissa Retention time in minutes;
  • Absorbance in mAU Absorbance Units.
  • Figure 28 illustrates the 1 H CO 2 Y NMR spectrum of 4 , -O- ⁇ -D-glucopyranosylnaringenin. On the abscissa and ordinate: chemical shift, in part per million (ppm).
  • Figure 29 illustrates the 1D 13 C NMR spectrum Jmod of the
  • Figure 30 illustrates the 2D HMBC NMR spectrum of 4'-O- ⁇ -D-glucopyranosylnaringenin. On the abscissa and ordinate: chemical shift, in part per million (ppm).
  • Figure 31 illustrates the superposition of chromatographic profiles obtained by LC-UV-MS for the products of glucosylation of morine by the enzyme ⁇ N 123 -GBD-CD2 WT and three of the most effective mutants to glucosylate this flavonoid.
  • abscissa Retention time in minutes;
  • Absorbance in mAU Absorbance Units.
  • Figure 32 illustrates the superposition of chromatographic profiles obtained by LC-UV-MS for the naringenin glucosylation products by the enzyme ⁇ N 123 -GBD-CD2 and three of its mutants effective for glucosylating this flavonoid.
  • abscissa Retention time in minutes;
  • the applicant has developed a new process for synthesizing new structures of ⁇ -gluco-flavonoids specifically glycosylated on non-vicinal hydroxyls, in particular of the B-ring. implements specific mutated glucan-saccharases, identified by the applicant, capable of performing such glucosylation.
  • Glucan saccharases of the invention require only the presence of sucrose, a renewable and cheap agro-resource. As such, a method according to the invention is advantageously inexpensive. Glucan saccharases of the invention
  • the present invention relates first of all to a process for producing O- ⁇ -glucosylated flavonoid derivatives comprising at least one step of incubating an enzyme of the invention with a flavonoid of formula (I) and at least one sucrose.
  • the enzymes of the invention are advantageously capable of glucosylating flavonoids at the level of non-vicinal hydroxyl function (s), in particular present on the B cycle.
  • These enzymes consist more particularly of glucansucrases belonging to the families 13 and 70 of the glycoside hydrolases (GH13 and GH70).
  • Glucansucrases belonging to the family 13 are naturally produced by the bacteria of the genera Deinococcus, Neisseria or Alteromonas.
  • the glucan-saccharases belonging to the 70 family are naturally produced by lactic acid bacteria of the genera Leuconostoc, Lactobacillus, Sireptococcus or Weisscla sp.
  • the inventors have determined variants of these enzymes, mutated at their flavonoid binding site, and able to glucosylate such compounds effectively.
  • GH13 (AmyloSucrase Neisseria polysaccharea) (GH13 family) is GenBank AJ01 1781.1, while its polypeptide sequence is Uniprot Q9ZEU2.
  • the nucleotide sequence of the wild form of the DSR-S enzyme (derived from the strain Leuconostoc mesenteroides B-512F) is GenBank reference 109598.
  • the nucleotide sequence of the wild form of the DSR-E enzyme (from Leuconostoc mesenteroides strain NRRL B-1299) is GenBank AJ430204.1 and reference Uniprot Q8G9Q2.
  • the enzyme AN123-GBD-CD2 (sequence SEQ ID No. 12) is a truncated form of the aforementioned DSR-E enzyme as described in Brison et al., J. Biol. Chem., 2012, 287, 7915-24.
  • Tables 1 and 4 the method for obtaining the mutated enzymes is described in European Patent Application EP 2 100 966 A1.
  • an enzyme according to the invention can be synthesized by conventional methods of synthetic chemistry, or homogeneous chemical syntheses in solution or in solid phase.
  • an enzyme according to the invention can be synthesized by conventional methods of synthetic chemistry, or homogeneous chemical syntheses in solution or in solid phase.
  • one skilled in the art can use the polypeptide synthesis techniques in solution described by HOUBEN WEIL (1974, In method of Organischen Chemie, E. Wunsh ed., Volume 15-1 and 15-II, Thieme , Stuttgart.).
  • An enzyme according to the invention may also be chemically synthesized in the liquid or solid phase by successive couplings of the different amino acid residues (from the N-terminal end to the C-terminal end in the liquid phase, or from the C-terminus towards the N-terminus in solid phase).
  • Those skilled in the art can in particular use the solid phase peptide synthesis technique described by Merrifield (MERRIFIELD RB, (1965a), Nature, vol.207 (996): 522-523, MERRIFIELD RB, (1 65b), Science, vol.150 (693): 178-185.
  • an enzyme according to the invention can be synthesized by genetic recombination, for example according to a production method comprising the following steps:
  • step (b) transfecting a host cell with the recombinant vector obtained in step (a);
  • step b) culturing the host cell transfected in step b) in a suitable culture medium
  • glucan-saccharases that can be used in a process of the invention are chosen from a group comprising:
  • sequence having at least 80% identity with SEQ ID NO: 2 said sequence having an amino acid X 2 representing an amino acid selected from the group consisting of A, C, D, F, G, H, K; L, M, N, P, S, V and Y;
  • amino acid X 4 representing an amino acid selected from the group consisting of C, I, N, P, V and W;
  • amino acid X 5 representing an amino acid selected from the group consisting of A, C, D, G, I, K, L, M, R, V and W;
  • X 9 represents, independently of X 10 , X 11 , X 12 and X 13 , an amino acid selected from the group consisting of G, S, V, C, F, N, I, L and W;
  • X 10 representing, independently of X 9, X 11, X 12 and X 13, an amino acid selected from the group consisting of L, I, M, Y and F;
  • X 11 representing, independently of X 9 , X 10 , X 12 and X 13 , an amino acid selected from the group consisting of E and A;
  • X 11 represents, independently of X 9 , X 10 , X 11 and X 1 , an amino acid selected from the group consisting of L and F;
  • X 12 represents, independently of X 9 , X 10 , X 11 and X 13 , an amino acid selected from the group consisting of A, R, D, N, C, E, Q, G, H, 1, L, K , M, P, S, T, W, Y and V; and X 1 3 representing, independently of X 9 , X 10 , X 11 , and X ! 2 , an amino acid selected from the group consisting of A, R, D, N, C, E, Q, G, H, I, , M, F, P, S, T, W, Y and V.
  • 80% identity with SEQ ID NO: 12 indicated above is preferably such that:
  • X 9 represents, independently of X 10 , X 11 , X 12 and X 13 , an amino acid selected from the group consisting of G, S, V, C, F, N, I, L and W;
  • X 10 represents, independently of X 9, X 11, X 12 and X 13, an amino acid selected from the group consisting of L, I, M, Y and F;
  • X 11 is A
  • X 12 is F
  • X 1 represents L
  • X 10 is F
  • X 11 represents, independently of X 9 , X 10 , X 12 and X 13 , an amino acid selected from the group consisting of E and A;
  • X 12 represents, independently of X 9 , X 10 , X 12 and X 13 , an amino acid selected from the group consisting of L and F;
  • X 13 is L
  • amino acids defined as respectively X 1 , X 2 , X 3 , X 4 . X 5 , X 6 , X 7 , X 8 , X 9 , X 10 . X 11 , X 12 and X 13 are present and as defined above in the glucansucrases of the invention having at least 80% identity with, respectively, a sequence SEQ ID NO: 1 to 7, 9 and 12, as defined above.
  • all the enzymes possessing one of these peptide sequences have a capacity that is statistically greater than that of the wild-type glucosylating enzyme of the invention, having non-vicinal hydroxyl functions, especially on the cycle.
  • the present invention also encompasses sequences having an amino acid sequence of at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% of amino acid identity with one of SEQ ID NO: 1 to 12 such as previously defined and a biological activity of the same nature.
  • the "percentage of identity" between two nucleic acid or amino acid sequences is determined by comparing the two optimally aligned sequences, through a comparison window.
  • the part of the nucleotide sequence in the comparison window may thus comprise additions or deletions (for example "gaps") with respect to the reference sequence (which does not include these additions or deletions) so as to obtain a optimal alignment between the two sequences.
  • the percent identity is calculated by determining the number of positions at which an identical nucleotide base (or identical amino acid) is observed for the two compared sequences, and then dividing the number of positions at which there is identity between the two nucleic bases. (or between the two amino acids) by the total number of positions in the comparison window, then multiplying the result by one hundred in order to obtain the percentage of nucleotide (or amino acid) identity of the two sequences between them.
  • the optimal alignment of the sequences for the comparison can be performed in a computer manner using known algorithms.
  • the present invention also relates to sequences whose amino acid sequence has 100% amino acid identity with amino acids 225 to 450 of SEQ ID NO: 1 to 9, or 100% identity in amino acids with amino acids 2130 to 2170 of the sequence SEQ ID NO: 12 and at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97, 98%, 99% or 100% of amino acid identity with the rest of the sequences SEQ ID NO: 1 to 12 such than previously defined, and a biological activity of the same nature.
  • the glucan-saccharases preferentially used in a method of the invention are chosen from the group comprising:
  • sequence having at least 80% identity with SEQ ID NO: 2 said sequence having an amino acid X 2 representing an amino acid selected from the group consisting of A, C, F, L, M, S or V ;
  • sequence having at least 80% identity with SEQ ID NO: 4 said sequence having an amino acid X 4 representing an amino acid selected from the group consisting of C.I., N.P., V or W; a sequence having at least 80% identity with SEQ ID NO: 5, said sequence having an amino acid X 5 representing an amino acid selected from the group consisting of C, K, R or V;
  • X 9 represents an amino acid selected from the group consisting of G, V, C and F;
  • X 9 represents, independently of X 10 , X 11 , X 12 and X 13 , an amino acid selected from the group consisting of S, N, L and I;
  • X 10 representing, independently of X 9, X 11, X 12 and X 11, an amino acid selected from the group consisting of L, I, M and Y;
  • sequence having at least 80% identity with SEQ ID NO: 12 is the sequence SEQ ID NO: 13.
  • a sequence having at least 80% identity with SEQ ID NO: 12, having the amino acids X 9 , X 10 , X 11 , X 12 and X 13 , is such that:
  • X 9 represents an amino acid selected from the group consisting of G, V, C and F;
  • X 10 representing, independently of X 9, X 11, X 12 and X 13, an amino acid selected from the group consisting of L, I and Y;
  • sequence having at least 80% identity with SEQ ID NO: 12 is the sequence SEQ ID NO: 13.
  • NO: 12 are in particular indicated in Example 1 1 of the present application.
  • Enzymes whose sequence has at least 80% identity with SEQ ID NO 12 have a flavonoid glucosylation efficiency of the invention greater than 5%, 10%, 15%, 20%, 25%, 30% , 35%, 40%, 45% or 50% compared with 20.4 +/- 3.2% or 13.9 +/- 4.7% respectively for the wild-type enzyme (see Tables 7 and 8).
  • Flavonoids derivatives and implements
  • the flavonoids specifically used in a process of the invention are of formula (I) as described above.
  • only one of the groups chosen from R 8 , R 9 , R 10 , R 11 and R 12 represents a hydroxyl group
  • the groups X 8 , R 9 , R 11 and R 12 represent hydrogen atoms.
  • the group R 10 represents a hydroxyl group and the groups R 8 , R 9 , R 11 and R 12 represent hydrogen atoms.
  • the ring C represents a ring of formula (II) or (IV) as defined above. According to one embodiment, the ring C represents a ring of formula (II). In another embodiment, ring C represents a ring of formula (IV).
  • the group R 1 represents a ring B of formula (VI) as defined above.
  • the ring C represents a ring of formula (II) and the group R 1 represents a ring B of formula (VI) as defined above.
  • the ring C represents a ring of formula (IV) and the group R 1 represents a ring B of formula (VI) as defined above.
  • the group R 1 represents a ring B of formula (VI)
  • the groups R 1 ', R 2 and R' represent hydrogen atoms
  • the ring C represents a ring of formula (II) or (IV)
  • the group R 1 represents a ring B of formula (VI)
  • the groups R 1 ', R 2 and R 2 ' represent hydrogen atoms
  • two of the groups R 4 , R 5 , R 6 and R 7 represent a hydroxyl group, the other two groups being as previously defined.
  • the two groups representing a hydroxyl group are the groups R 4 and R 6 .
  • two of the groups R 4 , R 5 , R 6 and R 7 represent a hydroxyl group, the other two groups representing a hydrogen atom. According to one embodiment, the groups R and R 7 represent hydrogen atoms.
  • the groups R4 and represent a hydroxyl group and the groups R5 and R represent a hydrogen atom.
  • X 8 and only one of the groups chosen from R 10 , R 11 and R 12 represent a hydroxyl group
  • R 9 and the other groups of R 10 , R 11 and R 12 being chosen from the group comprising a hydrogen atom; a linear or branched, saturated or unsaturated C 1 -C 10 hydrocarbon group optionally interrupted by at least one heteroatom selected from O, N or S; a halogen atom; a C 5 -C 9 aryl; a C 4 -C 9 heterocycle; a (C 1 -C 3 ) alkoxy group; a C 2 -C 3 acyl; a C 1 -C 3 alcohol; a -COOH group; -NH 2 ; -CONH 2 ; -CHO; -SH; -C (O) O (C -C 3 ); an amino C 1 -C 3 alkyl; a C 1 -C 3 imine; a nitrile group; a C 1 -C 3 haloalkyl; a C 1 -C 3 thioalkyl; a group -C (
  • the group R 1 represents a hydroxyl group.
  • the groups R 9 , R 11 and R 12 represent hydrogen atoms.
  • the groups R 8 and R 10 represent a hydroxyl group and the groups R ⁇ >, R 11 and R 12 represent hydrogen atoms.
  • the ring C represents a ring of formula (II) or (IV), preferably (II), as defined above.
  • the group R 1 represents a ring B of formula (VI) as defined above.
  • the groups R 1 'and R 2 ' represent hydrogen atoms
  • R 2 represents a hydrogen atom or a group -OH, preferably a group -OH
  • the group R 1 represents a ring B of formula (VI)
  • the groups R 1 'and R 2 ' represent hydrogen atoms
  • R 2 represents a group -OH
  • R 3 and R together form a group 0.
  • the ring C represents a ring of formula (II)
  • the group R 1 represents a ring B of formula (VI)
  • the group R 2 represents a group -OH
  • a flavonoid used in a process of the invention has the following formula (VII), (VIII) or (IX):
  • a flavonoid of the invention may be used in a process of the invention at a flavonoid-to-sucrose molar ratio of between 1 and 35,000, the reaction mixture comprising at least F (the) enzyme (s), sucrose and the flavonoid (s) receptor (s).
  • the sucrose to flavonoid molar ratio is between 7 and 292, the reaction mixture comprising at least the enzyme (s), sucrose and the flavonoid (s) receptor (s).
  • the reaction mixture comprising at least the enzyme (s), sucrose and the flavonoid (s) receptor (s).
  • the present invention also relates to certain ⁇ - ⁇ -glucosyl flavonoid derivatives. Those are obtainable from a process of the invention.
  • the present invention relates more particularly to compounds of formula (X) below: in which X ] 4 represents a chain consisting of at least two groups
  • ⁇ -glucoside, and X1 and X are chosen from the group comprising a hydrogen atom, a linear or branched C 1 -C 6 alkyl, a -C (O) ⁇ D (C 2 -C 3 )) group, and a chain consisting of 1 to 600,000 ⁇ -glucoside moieties
  • a compound according to the invention and glucosylated using a glucansucrase according to the invention may indeed comprise a chain consisting of 1 to 600,000 ⁇ -glucoside groups.
  • the present invention also provides compounds of formula (XI) below:
  • X 17 represents a chain consisting of 1 to 600,000 ⁇ -glucoside moieties
  • X 18 and X 13, which are identical or different, are chosen from the group comprising a hydrogen atom; a linear or branched C 1 -C 6 alkyl; a group -C (O) O (C 2 -C 3 ); and a chain consisting of 1 to 600,000 ⁇ -glucoside moieties.
  • the O- ⁇ -glucosyl flavonoid derivatives of the invention may be used as antioxidant (Heim et al., J. Nutr Biochem., 2002, 13: 572-584).
  • the ⁇ - ⁇ -glucosyl flavonoid derivatives of the invention can be used for their pharmaceutical use in the treatment and / or prevention of hepatotoxicity, allergies, inflammation, ulcers, tumors, menopausal disorders or neurodegenerative diseases (Harbome J. et al., Phytochemistry, 2000 55: 481-504, Quideau S. et al., Angel, Chem., Int., End 201, 50: 586- 621).
  • the O- ⁇ -glucosyl flavonoid derivatives of the invention can be used for their pharmaceutical use as veinotonic. (K. atsenis, Curr Vase, Pharmacol 2005, 3 (1), 1-9)
  • ⁇ - ⁇ -glucosyl flavonoid derivatives of the invention can be used as:
  • insect repellent agent see, for this purpose, the documents JP 2002060304, JP 2003104818, Benavente-garcia et al., J. Agric., Food Chem., 1997, 45).
  • Tables 1 and 4 illustrate indeed a number of glucansucrases tested in the examples of this text and specifies: column 1: the organism from which the enzyme originates; column 2: the various wild-type enzymes tested as well as the mutated positions of the active site of these wild-type enzymes in the mutated glucan-saccharases also tested; column 3: the specificities of majority bonds during the synthesis of the natural polymer; column 4: the Bibliographical references in which these enzymes, both in wild and mutated forms, have been described in the state of the art.
  • a pre-culture of these E. coli strains. coli is carried out for 22 hours at 30 ° C., 700 rpm in 96-well microplates, in 200 ⁇ l of LB culture medium supplemented with 100 ⁇ g ml of ampicillin.
  • These precultures are in turn used to seed the "deep-well" microplates, each well containing 1 ml per well of self-inducing medium ZYM5052 containing in particular 0.2% (w / v) ⁇ -lactose, 0.05%. % (w / v) D-glucose, 0.5% (w / v) glycerol and 0.05% (w / v) L-arabinose (Studier et al., 2005).
  • the cell suspension is centrifuged for 20 minutes at 3000 g at 4 ° C.
  • the cell pellets are resuspended in the 96 well deep well microplates, with 300 ⁇ l of phosphate buffered saline (24 mM sodium phosphate / potassium and 274 mM NaCl) containing 0.5 g L lysozyme and 5 mg / L Bovine pancreatic RNAse.
  • the centrifuged cell lysates containing the recombinant enzymes are transferred into clean deep-well 96-well microplates.
  • the enzymatic extracts obtained are used to conduct the enzymatic flavonoid glucosylation screening reactions.
  • the enzymatic activity of each centrifuged cell lysate is evaluated in microplate format, in final weight after 30 minutes of incubation in the presence of 146 m final sucrose, by determination of reducing sugars by 3,5-dinitrosalicylic acid (DNS). Finally, after dilution in ultrapure water, Tabsorbance is read at 540 nm.
  • the flavonoid acceptor reactions are then carried out in "deep-well” microplates, in a volume of 300 ⁇ , at final concentrations, of sucrose of 146 mM, flavonoid of 2.5 mM (apigenin) or 5 mM ( naringenin) (initially dissolved in 100% DMSO), and 140 ⁇ l of centrifuged cell lysate.
  • the final concentration of DMSO in the reaction medium is 3% (v / v).
  • Incubation is conducted at 30 ° C and 700 rpm. After 24 hours, the enzymes are denatured at 95 ° C for 15 minutes. These microplates are stored at -80 ° C for rapid evaluation of flavonoid glucosylation by liquid chromatography coupled with mass spectrometry (HPLC-MS or LC-MS).
  • reaction media are extensively homogenized diluted l / c 30 in DMSO.
  • the separation of the flavonoids and their glucosylated forms is carried out in inverse phase with a ProntoSIL Eurobond® 53x3.0 mm 120-3-C18-AQ column (porosity of 120 ⁇ , particle size of 3 ⁇ , C 18 grafting, Bischoff Chromatography, Germany).
  • the mobile phase is composed of an ultrapure water mixture (Solvent A) / LC-MS grade acetonitrile (solvent B) each containing 0.05% (v / v) of formic acid.
  • solvent A ultrapure water mixture
  • solvent B LC-MS grade acetonitrile
  • Ionization in mass spectrometry on MSQ Plus equipment is performed in electrospray positive (ESI +) mode for apigenin and negative (ESI-) for naringenin.
  • the voltage of the capillary is set at 3000 V, that of the cone at 75 V.
  • the temperature of the source block is fixed at 450 ° C.
  • the LC-MS / MS system used for high-resolution mass spectrometry or MS / MS fragmentation analysis includes an Ultimate 3000 (Dionex) chromatographic separation system coupled to a linear trap / Orbitrap hybrid mass spectrometer (LQT Orbitrap). Thermo Fischer Scientific). The ionization in mass spectrometry on the equipment LQT Orbitrap is this time carried out either in electrospray mode positive (ESI +) or in negative mode (ESI-).
  • EXAMPLE 2 Determination of rapigenin glucosylation efficiencies by recombinant amylosaccharase of N. polysaccharea and its variants
  • Table 2 illustrates the glucosylation efficiency, during microplate screening, of apigenin for the wild-type form of ASNp (N. polysaccharea recombinant amylosaccharase) as well as for its 174 mutants at its active site.
  • ASNp WT mutation positions of the wild-type enzyme
  • abscissa the amino acid substituting the one present in the sequence of the wild-type enzyme.
  • column 2 was obtained using an enzyme mutated at position 226 by the substitution of the amino acid R (Arginine) with the acid amine A (Alanine).
  • Each cell represents a single mutation at positions R226, 1228, F229, A289, F290, 1330, V331, D394 and R446 or a double mutation, that is, two simple mutations at two of these positions.
  • the gray bar in each box shows the level of glucosylation efficiency compared to the most effective mutant.
  • the 3 double mutant variants are shown in Table 2.
  • the glucosylation efficiencies obtained for R226R, I228I, F229F, A289A, F290F, I330I, V331V, D394D and R446R given in Table 2 are also in the range of 0.5 ⁇ 0.5.
  • ASNp I228F 9.9%; ASNp I228L: 11.1%; ASNp I228M: 5.4%; ASNp F229A: 5.6%; ASNp F229N: 5.7%; ASNp A289W: 22.1%; ASNp F290C: 5.4%; and ASNp F290K: 8.9%.
  • Glucan saccharases of the GH70 family tested for their activity of glucosylation of apigenin are listed in Table 4.
  • Table 4 illustrates the glucan saccharases of the GH70 family (glycoside hydrolase 70) tested in the examples of this text.
  • ASR C-APY-del WT represents the truncated form of ASR (alternansucrase)
  • DSR-S vardelA4N WT represents the wild truncated form DSR-S (dextransucrase)
  • DSR-S vardelA4N F353T represents the truncated form of the DSR-S mutated at position 353 by the substitution of the amino acid F (phenylalanine) with the amino acid T (Threoninc).
  • Glucosylation results of apigenin by glucan saccharases of the GH70 family are reported in Table 5.
  • Table 5 illustrates the glucosylation efficiency of apigenin for the wild form of the truncated DSR-S variant (vardelA4N WT), for the truncated wild type of PASR (ASR C-APY-del WT), for the wild-type form. of the enzyme ⁇ -1, 2 BrS, and for seven mutants of DSR-S vardelA4N.
  • the gray bar in each box shows the level of glucosylation efficiency compared to the most effective mutant. While the wild form of the truncated variant of DSR-S
  • saccharose hydrolysis activities of the wild-type enzymes were taken as references for calculating the relative activities of sucrose hydrolysis of their respective mutants.
  • the mutants show lower sucrose activity alone than wild-type enzymes, the glucosylation efficiencies of these same mutants are 10- to 44-fold higher than for wild-type enzymes. More generally, the correlation coefficient between the glucosylation efficiencies of apigenin and the hydrolysis activities of sucrose, calculated for the set of mutant enzymes of the amylosucrase of N. polysaccharea, is 0.08. This illustrates the interest of the process for identify enzymes that are not very active on sucrose alone but capable of glucosylating the flavonoids of the invention.
  • the nine mutants mentioned in Example 4 can be classified into 6 categories according to the profile of glucosylation products obtained in LC-MS.
  • the superposition of the UV chromatograms (X 3 40 nm) for a representative of each of these 6 categories of profiles (respectively ASNp A289W, DSR-S (vardelA4N S512C), ASNp F290K, ASNp F290C, ASNp F229N and ASNp I228F) is presented in Figure 2
  • the wild-type enzyme has a very low glucosylation efficiency on Papigenine
  • the F290K mutant has a more complex product profile than that of the F290C mutant.
  • the glucosylation product of Papigenin produced by the DSR-S vardelA4N S512C enzyme mutant is a monoglucosylated form (FIG. 13) whose retention time is 4.23 min, and whose m / z ratio in electrospray positive mode was was determined at 433.1 19 ( Figure 1).
  • LC-MS / MS analysis in the negative electrospray mode of this monoglucosylated form produced by DSR-S vardelA4N S512C led to the identification of two major ions whose m / z ratios were determined at 269.0451 and 268.9360 ( Figure 15). , thus making it possible to support obtaining an O-glucosylation at the 4 'position of the B-ring of apigenin.
  • the ASNp A289W enzyme glucosyl Papigenin to give a monoglucosylated product whose retention time is 4.25 min ( Figure 10) and whose m / z ratio in electrospray positive mode was determined at 433.1 120 ( Figure 16) .
  • This analysis also showed that the peak of glucosylation product eluting at 3.68 min (FIG. 10) corresponds to a diglucosylation of apigenin.
  • the m / z ratio in electrospray positive mode was determined at 595, 1645 ( Figure 17).
  • LC-MS / MS analysis in negative electrospray mode reveals that two diglucosylated forms of apigenin co-elute at 3.68 min.
  • Example 7 Determination of the glucosylation efficiencies of naringenin by recombinant TV-Vylosaccharase. polysaccharea and its variants
  • the glucosylation efficiency of the flavonoid was determined from the formula set forth in Example 2.
  • the flavonoid glucosylation efficiencies, expressed as a percentage, were calculated from the peak areas of the various products analyzed, as described in US Pat. Example 1, by HPLC equipped with a UV detector ( ⁇ 340 nm), after 24 hours of reaction. The values obtained are reported in Table 3.
  • Table 3 illustrates the glucosylation efficiency, during microplate screening, of naringenin for the wild-type form of ASNp (N. polysaccharea recombinant amylosaccharase) as well as for the 174 mutants of its active site.
  • ASNp WT mutation positions of the wild-type enzyme
  • abscissa the amino acid substituting the one present in the sequence of the wild-type enzyme.
  • column 2 was obtained using an enzyme mutated at position 226 by the substitution of the amino acid R (Arginine) with the acid amine A (Alanine).
  • Each cell represents a single mutation at positions R226, 1228, F229, A289, F290, 1330, V331, D394 and R446 or a double mutation, that is, two simple mutations at two of these positions.
  • the gray bar in each box shows the level of glucosylation efficiency compared to the most effective mutant.
  • sixteen mutant enzymes stand out more particularly from the screening. Seven of these mutant enzymes in particular have a naringenin glucosylation efficiency greater than 20% and two of them have an efficiency greater than 50%.
  • the glucosylation efficiencies for these sixteen mutated enzymes are respectively: ASNp R226H: 13.5%; ASNp R226N: 16.0%; ASNp R226S: 14.1%; ASNp I228A: 70.2%; ASNp I228C: 30.9%; ASNp I228S: 16.4%; ASNp I228V: 12.3%; and ASNp A289C: 27.8%; ASNp A2891: 11.2%; ASNp A289N: 14.5%; ASNp A289P: 10.3%; ASNp A289V: 21.8%; ASNp F290R: 1 1, 2%; ASNp F290V: 21, 1%; ASNp A289P / F290C: 50.9%; ASNp A289P / F290L: 22.9%.
  • the glucosylation of naringenin illustrates the interest of using directed engineering enzymes for the glucosylation of weakly recognized acceptors such as flavonoids.
  • Example 8 Determination of glucosylation efficiencies of naringenin by glucansucrases of the GH70 family
  • Glucan saccharases of the GH70 family tested for their activity of glucosylation of apigenin are listed in Table 4.
  • the glucosylation results of naringenin by the glucan saccharases of the GH70 family are reported in Table 6.
  • Table 6 illustrates the glucosylation efficiency of naringenin for the wild form of the truncated DSR-S variant (vardelA4N WT), for the truncated wild form of ASR (ASR C-APY-del WT), for the form of the enzyme ⁇ -1, 2 BrS and for seven mutants of DSR-S vardelA4N.
  • the gray bar in each box shows the level of glucosylation efficiency compared to the most effective mutant.
  • the wild form of the ASR truncated variant (ASR C-APY-del WT) has a glucosylation efficiency of 27.1%.
  • the wild-type enzyme ⁇ -1, 2 BrS has a naringenin glucosylation efficiency of 26.8%.
  • the eighteen mutants with a naringenin glucosylation efficiency greater than 10% discussed in Examples 7 and 8 can be classified into seven categories according to the profile of glucosylation products, obtained in LC-MS.
  • the superposition of the UV chromatograms ( ⁇ 340 nm) for a representative of each of these seven categories of profiles is presented in Figure 3.
  • the wild-type enzyme ( Figure 20) has a reduced glucosylation efficiency on naringenin (4.7%). Indeed, if one compares the naringenin standard with the final products of the glucosylation reaction, the appearance on the UV chromatogram of several peaks, low intensities, of glucosylated naringenin ( Figure 20) is detected.
  • the reaction conditions are as follows: final concentration of 146 mM sucrose, 5 mM naringenin (initially dissolved in 150 mM DMSO), PBS buffer pH 7.2, 0.528 pM ASNA p / mL and ultrapure water qs 145 mL .
  • the reaction is conducted with stirring at 30 ° C for 24 h.
  • the enzyme is thermally inactivated.
  • the reaction mixture is stored at -20 ° C.
  • a pre-purification step is carried out by solid phase extraction (SPE) on a cartridge containing 5 g of Cl 8 stationary phase. After conditioning of the column, the centrifuged reaction mixture is deposited on the column and percole by gravity.
  • SPE solid phase extraction
  • the elution is carried out with methanol.
  • the eluate is dried under a stream of nitrogen gas before being taken up in 100% DMSO at a concentration of 100 g / l.
  • the different glucosylated forms of naringenin are separated at room temperature by semi-preparative HPLC-UV on a Waters equipment.
  • a column Cl 8 250 x 10 mm provided with a precolumn makes it possible to separate the different glucosylated forms of naringenin with a mobile aqueous phase at 0.05% (v / v) of acid formic with a gradient of acetonitrile (B).
  • the different steps of the gradient are as follows: 0 min, 22% B; 1 min, 22% B; 17 min, 25% B; 21 min, 29% B; 21.5 min, 95% B; 24.5 min, 95% B; 25 min, 22% B; 27.5 min, 22% B.
  • the elution fractions are collected in an automated manner. The purity of the elution fractions is evaluated by LC-UV-MS with an analytical column Cl 8 250 ⁇ 4.6 mm (gradient described above).
  • the elution fractions containing a monoglucosylated form of 96% pure naringenin, eluting at a retention time of 18.4 min in semi-preparative HPLC-UV, are combined and dried using GeneVac equipment.
  • the product is then solubilized in 300 of deuterated methanol, dried under a stream of nitrogen gas and then lyophilized for 48 hours.
  • the identified compound is 4'-O- ⁇ -D-glucopyranosylnaringenin.
  • the coupling constant 3 JH-i. H-2 of the anomeric H1- proton of the glucosyl residue is 3.4 Hz.
  • mutants glucosylate this flavonol more efficiently than the wild-type enzyme, namely W403G, W403S-F404L, W403V, W403C, W403F, F431 I-D432E-L434I, F431L, A430E-F431L, W403F-F404I, W403C-F404I, W403N-F404Y, W403N-F404H, W403I-F404Y and W403L-F404L.
  • the glucosylation efficiencies obtained for these mutants are shown in Table 7.
  • mutants glucosylate the morin with a glucosylation efficiency greater than or equal to 30% (mutants W403G, W403S-F404L, W403V, W403C, W403F, F4311-D432E-L434I, F431L, A430E-F431L and W403F-F404I ).
  • Two mutants even have a morin glucosylation efficiency greater than or equal to 40% or even 45% (mutants W403S-F404L and W403G).
  • the best glucosylation efficiencies were obtained with the mutants W403S-F404L (49.5%) and W403G (66.7%).
  • Glucosylation products from the morine were detected by LC-UV-MS ( Figure 31).
  • a mono-glucosyl compound, two diglucosyl compounds and a triglucosyl compound have been identified.
  • the best mutant for the glucosylation of the morine is the W403G variant which synthesizes four times more di-glucosylated morine than the wild-type enzyme.
  • Naringenin is glucosylated by ANi 2 3-GBD-CD2 WT with a glucosylation yield of 13.9 ⁇ 4.7% (Table 8).
  • Naringenin is low in glucosylated by the wild enzyme (14%) and the essential is monoglueosylated (13%).
  • a variant of the W403-F404 library shows an increase in the production of the mono-glucosylated product. up to 49% with the mutant W4031-F404Y.
  • a variant (W403S-F404L) converts 10% of the naringenin into a triglucosyl compound (versus only 1% for the wild-type enzyme).
  • the number indicated in each box is the percentage of glucosylation efficiency.
  • the number indicated in each box is the percentage of glucosylation efficiency
  • SEQ ID NO: 10 (Protein - mutated truncated glucansucrase sequence DSR-S vardelMN ' - S512C)

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Dermatology (AREA)
  • Birds (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Environmental Sciences (AREA)
  • Dentistry (AREA)
  • Plant Pathology (AREA)
  • Pest Control & Pesticides (AREA)
  • Agronomy & Crop Science (AREA)
  • Hospice & Palliative Care (AREA)
  • Reproductive Health (AREA)
  • Vascular Medicine (AREA)
  • Endocrinology (AREA)
  • Pulmonology (AREA)

Abstract

La présente invention est relative à un procédé de fabrication de dérivés de flavonoïde O-alpha-glucosylé comprenant au moins une étape d'incubation d'une glucane-saccharase avec un flavonoïde et au moins un saccharose, le flavonoïde étant un flavonoïde monohydroxylé ou hydroxylé de façon non-vicinale sur le cycle B. L'invention concerne également de nouveaux dérivés de flavonoïde O-alpha-glucosylés ainsi que leur utilisation.

Description

Nouveaux flavonoïdes Ο-α-glucosylés sur le cycle B, procédé d'obtention et utilisations.
Domaine de l'invention
La présente invention se rapporte au domaine de la glucosylation de flavonoïdes et plus particulièrement de lα-glucosylation de certains flavonoïdes, afin d'obtenir des dérivés de flavonoïdes Ο-α-glucosylés, notamment sur leur cycle aromatique B, au niveau de fonctions hydroxyle non vicinales.
La présente invention concerne également les composés O-α-glucosylés obtenus à l'issu d'un procédé de glucosylation de l'invention et la mise en œuvre de ces composés à différentes fins, notamment cosmétiques ou thérapeutiques.
Art antérieur
Les flavonoïdes sont des composés ayant une structure carbonée en C6-C3-C6 dont le squelette est un système cyclique de type 1 -benzopyrane, dans lequel le cycle aromatique est défini en tant que cycle A et le cycle pyranique est défini en tant que cycle C, et qui comprend également un substituant phénylique, sur le cycle pyranique, en tant que cycle B.
Ils constituent un groupe de 8000 composés largement répandus dans le règne végétal où ils sont responsables de la couleur d'une partie des fleurs et des fruits. Ils peuvent ainsi y intervenir dans la protection contre les radiations solaires, dans la résistance contre les micro-organismes pathogènes de la plante et contre les animaux herbivores, ainsi que dans les relations d'interaction avec les autres organismes de l'environnement, tels que les champignons symbiotiques, les bactéries voire les insectes (Quideau S et al., Angew. Chem. Int. End. 201 1 50 : 586-621).
11 leur est par ailleurs attribué de nombreuses propriétés biologiques notamment des propriétés antioxydantes, antihépatotoxiques, antiallergiques, antiinflammatoires, anti ulcéreuses et antitumorales (Harborne J et al., Phytochemistry 2000 55 : 481-504 ; Quideau S et al., Angew. Chem. Int. End. 201 1 50 : 586-621 ).
Les flavonoïdes peuvent être hydroxylés en de nombreuses positions, et ces groupements hydroxyle sont fréquemment méthylés, acétylés, prénylés ou sulfatés. Dans les plantes, ils sont le plus souvent présents sous forme d'hétérosides solubles C- ou O-glycosylés.
Il existe à ce jour plusieurs voies d'obtention de flavonoïdes glucosylés.
De nombreux flavonoïdes existent naturellement sous la forme d'hétérosides. ln vivo, la glucosylation repose sur l'utilisation de glucosyl-transférases de type Leloir, capables de transférer le résidu glucosyle d'un nucléotide-sucre (UDP-glucose) sur le squelette du flavonoïde. Ces enzymes, contribuant à la synthèse de métabolites secondaires dans les plantes, sont reconnues pour avoir un large spectre de substrats accepteurs.
Toutefois, leurs niveaux de production par les cellules végétales sont très faibles et la réaction de β-glucosylation est la plus courante, comparativement à Γα-glucosylation. La glucosylation cellulaire peut avoir diverses incidences et influer sur l'adressage et/ou la toxicité des produits obtenus. Ainsi, bien que ce ne soit pas une règle absolue, il faut relever que généralement la glycosylation des flavonoïdes permet d'accroître la stabilité et la solubilité, et par conséquence la disponibilité, de ces molécules.
Plusieurs UDP glycosyl-transférases ont été isolées et clonées dans différents microorganismes. Les formes naturelles ou recombinantes de ces enzymes peuvent ainsi être mises en œuvre in vitro pour la production de flavonoïdes glucosylés.
Par exemple, l'UDP glycosyl-transférase (UGT) de Bacillus cereus a été exprimée dans Escherichia coli (E. coli). Cette enzyme glucosyle Papigénine, la génistéine, le kaempférol, la lutéoline, la naringénine et la quercétine. La position 3 est la position préférentiellement glucosylée, mais en l'absence de fonction hydroxyle sur cette position, la glucosylation a lieu sur la position 7. Les produits obtenus par l'enzyme recombinante sont identiques à ceux produits par l'enzyme sauvage (Ko J H et ai, FEMS Microbiol. Lett. 2006, 258 : 263-268).
De même, l'UDP-glucosyltransférase YjiC de Bacillus licheniformis DSM 13 a été utilisée pour glucosyler Papigénine. Deux formes β-mono-glucosylées, en position 4' ou en position 7, ont été obtenues. Une forme β-diglucosylée sur les positions 4' et 7 a également été caractérisée structural ement (Gurung R.B. et ai, Mol. Cells 2013, 36(4) : 355-361 ).
L'oléandomycine glycosyl-transférase (OleD GT) de Streptomyces antibioticus a été exprimée dans E. coli BL 21. L'enzyme purifiée catalyse la glucosylation de plusieurs flavonoïdes : apigénine, chrysine, daidzéine, génistéine, kaempférol, lutéoline, naringénine et quercétine, à partir d'UDP-glucose. La meilleure conversion (90 %) a été obtenue avec la naringénine à 20 μΜ en 5 h. Aucune indication sur la position de glucosylation n'est précisée dans la publication. (Choi S H et al., Biotechnol. Lett. 2012, 34 : 499-505).
L'UDP-glycosyltransférase RhGTl de Rosa hybrida a été testée sur une collection de 24 flavonoïdes. Elle montre des résultats comparables à ceux obtenus avec l'oléandomycine glycosyl-transférase en terme de reconnaissance d'accepteurs (Wang L et al., Carbohydr. Res. 2013, 368 : 73-77).
A ce jour, six UDP-glycosyl-transférases microbiennes sont connues pour avoir une activité de glucosylation sur les flavonoïdes (Wang L et ai, Carbohydr. Res. 2013, 368 : 73-77).
La glycosylation des flavonoïdes in vitro peut être réalisée par l'emploi d'enzymes du type glycoside-hydrolases, transglycosylases de type cyclodextrine- glucanotransférase ou glycoside-phosphorylases.
Plus particulièrement, la glycosylation enzymatique des flavonoïdes in vitro peut être réalisée via la mise en œuvre de glucane-saccharases. Une telle voie de synthèse conduit à l'obtention de flavonoïdes α-glucosylés, et repose sur l'utilisation de glucane- saccharases appartenant aux familles 13 ou 70 des glycosides-hydrolases (GH 13 et GH 70) (Classification CAZy - Henrissat B, Davies GJ, Curr. Op. Struct. Biol. 1 97, 7 : 637- 644).
Les glucane-saccharases sont des transglucosylases qui catalysent à partir de saccharose la synthèse d'homopolymères, constitués d'unités α-D-glucosyle, appelés glucane. Ces glucanes sont généralement de très haute masse molaire (108 Da), et présentent des structures variées dues à la présence de différents types de liaisons osidiques (α-1 ,2, α-1 ,3, α-1 ,4, et/ou α-1 ,6) ainsi qu'à leur localisation dans le polymère. Des isomères du saccharose et du glucose sont aussi produits à partir du saccharose mais en très faibles quantités comparativement au polymère.
Plus particulièrement, ces enzymes sont capables de glucosyler des molécules hydroxylées dites « accepteurs », introduites dans le milieu réactionnel en supplément du saccharose, tels que des flavonoïdes. Le degré de glucosylation de l'accepteur dépend de sa structure ainsi que de celle de l'enzyme. Ainsi, un accepteur efficace, ou bon accepteur, pourra détourner quasi totalement la synthèse de polymères au profit de sa propre glucosylation. Au contraire, un accepteur inefficace, ou mauvais accepteur, ne pourra que très faiblement détourner la synthèse de polymères et ne sera donc que très peu, voire pas, glucosylé.
C'est pourquoi ces enzymes sont étudiées depuis de nombreuses années afin notamment de proposer des outils enzymatiques innovants, performants pour la synthèse de molécules originales, et répondant à des besoins industriels notamment en termes de synthèse de nouveaux gluco-conjugués d'intérêt. En effet, pour des raisons évidentes, l'industrie est en recherche constante de nouveaux composés, pouvant notamment être produits dans des quantités suffisantes, et notamment à un coût le plus faible possible.
Dès 1995, la glucosylation de la catéchine avec une glucosyltransférase de
Streptococcus sobrinus 6715 (sérotype g) a été réalisée, dans un tampon phosphate 100 mM (pH 6) en présence de 1 g L de catéchine et de 2 % de saccharose (Nakahara et al., Appl. Environ Microbiol. 1995, 61 : 2768-2770). Le produit monoglucosylé obtenu avec un rendement de 13,7 % est la 4'-O-α-D-glucopyranosyl-(+)-catéchine.
Une enzyme similaire, la glucosyltransférase-D de Streptococcus mutons GS-5 a également été testée quelques années après sur le même substrat ( eulenbeld G et ai, Appl. Env. Microbiol. 1999, 65 : 4141 -4147). Deux produits de monoglucosylation ont ainsi été isolés : la 4'-O-α-D-glucopyranosyl-(+)-catéchine et la 7-O-α-D-glucopyranosyl- (+)-catéchine, ainsi qu'un produit di-glucosylé, la 4',7-O-α-D-glucopyranosyl-(+)- catéchine.
Une étude a été réalisée en 2000 pour déterminer la spécificité de la glucosyltransférase-D de Streptococcus mutons GS-5. Plusieurs accepteurs ont été testés (catéchol, 3-méthoxycatéchol, 3-méthylcatéchol, 4-méthylcatéchol, phénol, 3-hydroxyphénol, alcool benzylique, alcool 2-hydroxybenzylique, alcool 2-méthoxybenzylique, l -phényl-l,2-éthanediol, 4-méthylphénol, 3-méthylphénol, alcool 3,5-dihydroxybenzylique, 2-méthoxy-4-méthylphénol, alcool 2-méthoxybenzylique, alcool 3-méthoxybenzylique et catéchine) (Meulenbeld G Hartmans S., Biotechnol. Bioeng. 2000, 70 : 363-369). Seuls les accepteurs possédant deux groupements hydroxyle adjacents, et donc vicinaux, sur le cycle aromatique B ont été glucosylés.
Quelques années plus tard, la glucosylation enzymatique d'une flavone (la lutéoline) et de deux flavanols (la quercétine et la myricétine) a été effectuée en utilisant deux glucane-saccharases : la dextrane-saccharase de Le conostoc mesenteroides NRRL B-512F et l'alternane-saccharase de Leuconostoc mesenteroides NRRL B-23192 (Bertrand A et al., Carbohydr. Res. 2006, 341 : 855-863). Les réactions ont été effectuées dans un mélange de solvants aqueux-organiques pour améliorer la solubilité des substrats. Un taux de conversion de 44 % a été atteint après 24 heures de réaction catalysée par la dextrane- saccharase dans un mélange à 70 % de tampon aqueux acide acétique/acétate de sodium et de 30 % de bis(2-méthoxyéthyl) éther. Deux produits ont été caractérisés par RMN : la 3'-O-α-D-glucopyranosyllutéoline et la 4'-O-α-D-glucopyranosyllutéoline. En présence de l'alternane-saccharase, trois produits supplémentaires, à savoir la 4'-O-α-D-triglucopyranosyllutéoline et deux formes de
4'-O-α-D-diglucopyranosyllutéoline, ont été obtenus avec un taux de conversion en lutéoline de 8 %.
Les deux enzymes ont également été utilisées pour glucosyler la quercétine et la myricétine avec des taux de conversion respectifs de 4 % et 49 %. Aucune glucosylation n'a toutefois été observée lorsque ces deux enzymes ont été utilisées avec de la diosmétine, de la diosmine et de la 7-P-D-glucopyranosyldiosmétine.
La glucosylation de la quercétine en présence de saccharose et de glucane- saccharase de la souche Leuconostoc mesenteroides NRRL B-1299 a également été décrite dans la demande coréenne KR20060063703.
L'épigallocatéchine gallate a également été glucosylée en présence de saccharose et de la glucane-saccharase de Leuconostoc mesenteroides B-1299CB (Moon et al., Journal of Molecular Catalysis B : Enzymatic. 2006, 40 : 1-7). Un mélange de trois produits a été obtenu :
- un produit de monoglucosylation : la 4"-O-α-D-glucopyranosylépigallocatéchine gallate (1 ,7 %) ; et
- deux produits de di-glucosylation : la 7,4"-O-α-D-glucopyranosylépigallocatéchine (22,7 %) et la 4',4"-di-O-α-D-glucopyranosylépigallocatéchine gallate (23,8 %).
La glucosylation de la quercétine a été réalisée en 2007 en présence de saccharose et de la glucane-saccharase de Leuconostoc mesenteroides B-1299CB (Moon Y H et al, Enzyme Microb. Technol. 2007, 40 : 1 124-1 129). Un mélange de deux produits monoglucosylés est obtenu : la 4'-O-α-D-glucopyranosylquercétine et la 3'-O-α-D-glucopyranosylquercétine.
L'amylosaccharase de Deinococ us geothermalis a été exprimée dans E. coîi et étudiée pour la glucosylation de la (+)-catéchine et la 3'-O-α-D-maltosyIcatéchine (Cho H et al. , Enzyme Microb. Technol. 201 1 , 49(2) : 246-253).
Dans la demande de brevet américain US 201 10183930A1 , Auriol et al. ont décrit la préparation de dérivés phénoliques obtenus par condensation enzymatique entre des composés phénoliques sélectionnés parmi les pyrocatéchols ou leurs dérivés, et le résidu glucosyle provenant du saccharose. La production de ces dérivés de composés phénoliques est réalisée avec une glucosyltransférase (EC 2.4.1.5). Les O-α-D-glucosides de composés phénoliques synthétisés présentent une solubilité dans l'eau supérieure à celle de leur parent polyphénol.
Ces composés y sont notamment décrits pour leur utilisation en tant qu'agent antioxydant, antiviral, antibactérien, immunostimulant, antiallergique, antihypertenseur, anti-ischémique, antiarythmique, antithrombique, hypocholestérolémiant, antilipopéroxidant, hépatoprotecteurs, anti-inflammatoires, anticarcinogènes, antimutagènes, antinéoplasiques et vasodilatateurs.
La glucosylation de Tastragaline en présence de saccharose et de la glucane- saccharase de Leuconostoc mesenteroides B-512FMCM a également été réalisée (Kim G E et al.. Enzyme Microb Technol. 2012, 50 : 50-56). Neuf produits ont été isolés, à savoir :
- deux produits de monoglucosylation : le kaempférol-3-O-P-D- glucopyranosyl-(l→6)-O-α-D-glucopyranoside et le kaempférol-3-O-p-D-glucopyranosyl- (l→3)-O-α-D-glucopyranoside ; et
- sept produits de polyglucosylation de l'astragaline (liaisons de type α-(l→6)).
La glucosylation de l'ampélopsine a en outre été réalisée en présence de saccharose et de la glucane-saccharase de Leuconostoc mesenteroides B-1299CB4. Cinq produits de glucosylation ont été isolés et le produit de monoglucosylation caractérisé : il s'agit de la 4'-O-α-D-glucopyranosylampélopsine (Woo H J et ai, Enzyme Microb. Technol. 2012 51 : 31 1 -318).
Toutefois, à la connaissance des inventeurs, et malgré le très grand nombre d'expérimentations effectuées depuis de nombreuses années dans le domaine, la glucosylation de flavonoïdes monohydroxylés ou hydroxylés de façon non-vicinale, sur le cycle B, n'a jamais été réalisée.
Il existe en conséquence un besoin, dans l'état de la technique, pour la disponibilité de flavonoïdes α-glucosylés, et notamment O-α-glucosylés, sur des groupements hydroxylés non vicinaux, notamment sur le cycle B.
Résumé de l'invention
Ainsi, la présente invention fournit un procédé de fabrication de dérivés de flavonoïde O-α-glucosylés comprenant au moins une étape d'incubation d'une glucane- saccharase avec un flavonoïde et au moins un saccharose, dans lequel:
(A) ledit flavonoïde est de formule (I) suivante :
dans laquelle
le cycle C représente un cycle choisi dans le groupe constitué des cycles de formules (II), (111), (IV) ou (V) suivantes:
dans lesquels :
l'un des groupements R1 , R2 ou R3 représente un cycle B de formule (VI)
dans lequel :
(a) un seul des groupements choisi parmi R8, R9, R10, R11 et R 12 représente un groupement hydroxyle,
les autres groupements parmi R8, R9, R10, R11 et R 12, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (C1-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(O)O(C2-C3) ; une aminé en C1-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou
(b) R8 et un seul des groupements choisis parmi R10, R11 et R 12 représentent un groupement hydroxyle,
R9 et les autres groupements parmi R10, R11 et R 12, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement ( C1-C3)alcoxy ; un acyle en C2-C ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(O)O(C2-C3) ; une aminé en C1-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou
(c)R9 et un seul des groupements choisis parmi R11 et R12 représentent un groupement hydroxyle,
les groupements R8, R10, et l'autre groupement parmi R11 et R12, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (C1-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(O)O(C2-C3) ; une aminé en C1-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou
(d) R10 et R 12 représentent un groupement hydroxy,
les groupements R8, R9 et R11, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (C1-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(O)O(C:-C3) ; une aminé en C1-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou
(e) R8, R10 et R12 représentent un groupement hydroxy,
les groupements R9 et R11, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-G) ; un hétérocycle en C4-C9 ; un groupement (C1-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ;-SH ; -C(O)O(C2-C3) ; une aminé en C1-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3; un groupement
-C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
les groupements R1, R2 et R3 qui ne représentent pas un cycle B de formule (VI), identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un alkyle en C1-C6, linéaire ou ramifié ; un groupement -OH ; une aminé en C1-C3 ; un groupement-COOH ; -C(O)O(C2-C3) ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
R1\ R2' et R3\ identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement
(C1-C3)alcoxy ; un acyle en C -C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(O)O(C2-C3) ; une aminé en C2-C3 ; une aminé en C1-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou les groupements R1 et RT lorsque R1 ne représente pas un cycle B de formule (VI), ou R2 et R2' lorsque R2 ne représente pas un cycle B de formule (VI), ou R3 et R ' lorsque R3 ne représente pas un cycle B de formule (VI), forment ensemble un groupement =0;
R , R5, RÔ et R7, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en Cs-Ci» ; un hétérocycle en C4-Cg ; un groupement
(C1-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -OH ; -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(O)O(C2-C3) ; une aminé en d-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-Cj ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
et
(B) ladite glucane-saccharase étant choisie dans le groupe comprenant :
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1, ladite séquence ayant un acide aminé X1 représentant un acide aminé choisi dans le groupe constitué de A, C, E, F, G, H, I, , M, N, P, Q, S, T, V et Y ;
- une séquence ayant au moins 80 % d'identité avec la SEQ 1D NO : 2, ladite séquence ayant un acide aminé X2 représentant un acide aminé choisi dans le groupe constitué de A. C, D, F, G, H, K, L, M, N, P, S, V et Y ;
- une séquence ayant au moins 80 % d'identité avec la SEQ BD NO : 3, ladite séquence ayant un acide aminé X3 représentant un acide aminé choisi dans le groupe constitué de A, C, G, I, K., M, N et W ;
- une séquence ayant au moins 80 % d'identité avec la séquence
SEQ ID NO : 4, ladite séquence ayant un acide aminé X4 représentant un acide aminé choisi dans le groupe constitué de C, I, N, P, V et W ;
- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO : 5, ladite séquence ayant un acide aminé X5 représentant un acide aminé choisi dans le groupe constitué de A, C, D, G, I, K, L, M, R, V et W ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 6, ladite séquence ayant un acide aminé X6 représentant un acide aminé choisi dans le groupe constitué de C, G, Q, S et T ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 7, ladite séquence ayant un acide aminé X7 représentant un acide aminé choisi dans le groupe constitué de A et G ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 8 ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé Xg représentant un acide aminé choisi dans le groupe constitué de C, I et L ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 10 ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 1 ; et - une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés X9, X10, X11, X12 et X13, avec :
(i) X9 représentant, indépendamment de X10, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de G, S, V, C, F, N, I, L et W ;
X10 représentant, indépendamment de XQ, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, I, H, Y et F ;
à l'exception du cas où X9 représente W et X10 représente F ;
X11 représentant A ;
X12 représentant F ; et
X13 représentant L ;
(ii) X9 représentant W ;
X10 représentant F ;
X11 représentant, indépendamment de X9, X10, X11 et X13, un acide aminé choisi dans le groupe constitué de E et A ;
X12 représentant, indépendamment de X9, X10, X11 et X13, un acide aminé choisi dans le groupe constitué de L et F et
X13 représentant L ;
à l'exception du cas où X11 représente A et X12 représente F ;
ou
(iii) X9 représentant W ;
X10 représentant F ;
Xu représentant A ;
X12 représentant, indépendamment de X<>, Χ)0, X11 et X13, un acide aminé choisi dans la liste constituée de A, R, D, N, C, E, Q, G, H, I, L, , M, P, S, T, W, Y et V, de préférence I ; et
X13 représentant, indépendamment de X9, X1(), X11 et X12, un acide aminé choisi dans la liste constituée de A, R, D, N, C, E, Q, G, H, I, K, M, F, P, S, T, W, Y et V, de préférence I.
Les inventeurs ont en effet montré, de manière totalement inattendue, que certaines glucane-saccharases spécifiques mutées, décrites ci-après dans le présent texte, possèdent la capacité de générer de nouveaux flavonoïdes O-α-glucosylés sur des groupements hydroxyles non vicinaux, notamment sur le cycle B. Ces enzymes mutées possèdent en effet une activité de glucosylation supérieure, voire très supérieure à leur formes sauvages, de ces flavonoïdes spécifiques, habituellement considérés comme étant de mauvais récepteurs, car très difficiles à glucosyler, notamment sur le cycle B.
Plus particulièrement, une glucane-saccharase mise en œuvre dans un procédé de l'invention est choisie dans le groupe comprenant :
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 , ladite séquence ayant un acide aminé X1 représentant un acide aminé choisi dans le groupe constitué de H, N ou S ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X2 représentant un acide aminé choisi dans le groupe constitué de A, C, F, L, M, S ou V ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X3 représentant une acide aminé choisi dans le groupe constitué de A et N ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 4, ladite séquence ayant un acide aminé X4 représentant une acide aminé choisi dans le groupe constitué de C, I, N, P, V ou W ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 5, ladite séquence ayant un acide aminé X5 représentant un acide aminé choisi dans le groupe constitué de C, , R ou V ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé X8 représentant un acide aminé choisi dans le groupe constitué de C ou L ; et
- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés X9, X10, X11 et X13 , avec :
(i) X9 représentant un acide aminé choisi dans le groupe constitué de G, V, C et
F ;
X10 représentant F ; X11 représentant A ; X12 représentant F ; et X13 représentant L ; (ii) X9 représentant, indépendamment de X9, X10, X11 et X13, un acide aminé choisi dans le groupe constitué de S, N, L et I ;
X10 représentant, indépendamment de X9, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, I, H et Y ;
X11 représentant A ; X12 représentant F ; et X13 représentant L ;
(iii) X9 représentant W ; X10 représentant F ; X11 représentant A ou E ; X12 représentant L ; et X13 représentant L ; ou
ladite séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12 est la séquence SEQ ID NO : 13.
L'invention a également pour objet un dérivé de flavonoïde O-α-glycosylé obtenu par le procédé de l'invention, et notamment de formule (I) telle que définie ci- dessus dans laquelle le cycle C représente le cycle de formule (IV) dans lequel le groupement R1 représente un cycle B de formule (VI) ; et au moins le cycle B est O-α-glycosylé.
La présente invention permet en effet avantageusement d'obtenir des dérivés de flavonoïde selon l'invention au moins O-α-glycosylés, en particulier O-α-glucosylés, sur le cycle B.
L'invention concerne en outre un composé de formule (X) suivante :
dans laquelleX14 représente une chaîne constituée d'au moins deux groupements
α-glucoside, et X 1 5 et X16, identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène ; un alkyle en C1-C6, linéaire ou ramifié ; un groupement -C(O)O(C2-C3) ; et une chaîne constituée de 1 à 600.000 groupementsα-glucoside. Une chaîne constituée de 1 à 600.000 groupements α-glucoside selon l'invention peut plus particulièrement être constituée de 1 à 500.000 groupements α-glucoside, de 1 à 400.000 groupements α-glucoside, de 1 à 300.000 groupements α-glucoside, de 1 à 200.000 groupements α-glucoside, de 2 à 100.000 groupements α-glucoside, de 5 à 50.000 groupements α-glucoside, de 10 à 25.000 groupements α-glucoside ou de 10 à 10.000 groupements α-glucoside.
L'invention est encore relative à un composé de formule (XI) suivante :
dans laquelle
X17 représente une chaîne constituée de 1 à 600.000 groupements α-glucoside, et
X18 et X19, identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène ; un alkyle en C1-C6, linéaire ou ramifié ; un groupement -C(O)O(C2-C ) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside.
La présente invention concerne également l'utilisation cosmétique, à titre d'agent antioxydant, d'au moins un dérivé de flavonoïde Ο-α-glycosylé conforme à l'invention.
La présente invention vise en outre un dérivé de flavonoïde O-α-glycosylé conforme à l'invention, pour son utilisation pharmaceutique dans le traitement et/ou la prévention de l'hépatotoxicité, des allergies, de l'inflammation, des ulcères, des tumeurs, des troubles ménopausiques, ou des maladies neurodégénératives.
Un autre aspect de l'invention concerne un dérivé de flavonoïde O-α-glycosylé conforme à l'invention pour son utilisation pharmaceutique à titre de veinotonique.
Enfin, la présente invention est relative à l'utilisation d'un dérivé de flavonoïde
Ο-α-glycosylé conforme à l'invention à titre d'agent photovoltaïque, d'agent répulsif des insectes, d'agent de blanchiment, d'agent pesticide, fongicide et/ou bactéricide. Dans le cadre de la présente invention, et sauf mention différente dans le texte, on entend par :
- groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S : un alkyle ou un alkylène ;
- alkyle : un groupe aliphatique hydrocarboné saturé, linéaire ou ramifié, comprenant de 1 à 10, de préférence de 1 à 6 atomes de carbone ;
- cycloalkyle : un groupe alkyle cyclique comprenant de 3 à 10 chaînons, de préférence de 3 à 8 chaînons. Le groupe cycloalkyle est éventuellement substitué par un ou plusieurs atomes d'halogène et/ou groupes alkyles ;
- hétérocycle : un groupe alkyle cyclique comprenant de 4 à 9 chaînons, de préférence de 3 à 8 chaînons, et constitué de 1 à 3 cycles, comprenant entre 3 et 6 atomes de carbone et 1 ou plusieurs hétéroatomes, par exemple 1, 2 ou 3 hétéroatomes, de préférence 1 ou 2, choisis parmi l'azote, l'oxygène et le soufre. Le groupe hétérocycle est éventuellement substitué par un ou plusieurs atomes d'halogène et/ou groupes alkyles ;
- groupe alkyle partiellement cyclique : on entend un groupe alkyle dont seulement une partie forme un cycle ;
- alkylène : un groupe alkylène divalent, linéaire ou ramifié, comprenant de 1 à 10, de préférence de 1 à 6, atomes de carbone ;
- aryle : un groupe aromatique cyclique comprenant entre 5 et 9 atomes de carbone, par exemple un groupe phényle ;
- hétéroaryle : un groupe aromatique cyclique comprenant entre 3 et 10 atomes dont 1 ou plusieurs hétéroatomes, par exemple entre 1 et 4 hétéroatomes, tels que l'azote, l'oxygène ou le soufre, ce groupe comprenant un ou plusieurs cycles, de préférence 1 ou 2 cycles. Les hétérocycles peuvent comprendre plusieurs cycles condensés. Les hétéroaryles sont éventuellement substitués par un ou plusieurs groupes alkyles ou un atome d'oxygène. A titre d'exemples, on peut citer les groupes thiényle, pyridinyle, pyrazolyle, imidazolyle. thiazolyle et triazolyle ;
- halogène : un atome de chlore, de fluor, de brome ou d'iode ;
- alcool en C1-C3 : un alcool choisi parmi le méthanol, l'éthanol, le propanol et l'isopropanol ; - un (C1-C3)alcoxy : un groupement choisi parmi un méthoxyle, un éthoxyle, un propyloxyle, et un isopropyloxyle ;
- acyle en C2-C3 : un groupement choisi parmi un acétyle, un propylacétyle et un isopropylacétyle ;
- aminé en C1-C3 : un groupement choisi parmi une méthylamine, une éthylamine et une propylamine ;
- imine en C1-C3 : un groupement choisi parmi une méthylimine, une éthylimine et une propylimine ;
Dans la présente demande le terme « glycoside » est employé afin de désigner un motif glycoside.
Les motifs glycoside sont connus de l'homme du métier.
A titre d'exemples de glycosides monosaccharides, les glycosides suivants peuvent être cités : glucose, fructose, sorbose, mannose, galactose, talose, allose, gulose, idose, glucosamine, N-acétylglucosamine, mannoamine, galactosamine, acide glucuronique, rhamnose, arabinose, acide galacturonique, fucose, xylose, lyxose et ribose.
A titre d'exemples de glycosides di- ou oligo- saccharides, les glycosides suivants peuvent être cités:
- di-saccharides: maltose, gentiobiose, lactose, cellobiose, isomaltose, melibiose, laminaribiose, chitobiose, xylobiose, mannobiose, sophorose, nigerose, kojibiose, rutinose, robinose,
- oligo-sacchacaride: panose, galactotriose, β-glucotriose, β-glucotétraose, galactotétraose, les maltodextrines notamment, maltotriose, isomaltotriose, maltotetraose, maltopentaose, maltoheptaose.
Peuvent également être cités à titre d'exemples de glycosides:
- les dérives de l'amidon, notamment le maltose, les maltodextrines,
- les dérivés de la cellulose,
- les pectines et leurs dérivés,
- la chitine, le chitosane et leurs dérivés,
- les glucoaminoglucanes et leurs dérivés,
- les dérivés du xyloglucanes,
- les galactomannanes et leurs dérivés. Au sens de l'invention, on entend par « une chaîne constituée de 1 à 6 glycoside(s) » un enchaînement de 1 à 6 glycosides mentionnés ci-dessus.
De même, au sens de la présente invention, on entend par « une chaîne constituée de 1 à 600.000 groupements o-glucoside un enchaînement de une à 600.000 unités glucosyle liées les unes aux autres par des liaisons a.
Description des figures
La Figure 1 illustre les efficacités de glucosylation de l'apigénine (histogramme - Ordonnée de gauche - %), les niveaux d'activité relative sur saccharose seul (● points noirs - Ordonnée de droite - UA) et les concentrations massiques en apigénine glucosylée (valeurs portées au-dessus de l'histogramme - mg/L), des enzymes ASNp WT, DSR-S vardelA4N WT et de leurs mutants ASNp I228F, ASNp I228L, ASNp I228M, ASNp F229A, ASNp F229N, ASNp A289W, ASNp F290C, ASNp F290K et DSR-S vardelA4N S512C.
La Figure 2 illustre la superposition des chromatogrammes UV (λ340 nm) pour les six mutants représentatifs des six catégories de profils de produits de glucosylation de l'apigénine. Le nom des enzymes correspondants à ces réactions est indiqué à côté de chaque chromatogramme : ASNp A289W, DSR-S vardelA4N S512C, ASNp F290 , ASNp F290C, ASNp F229N et ASNp 1228F. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 3 illustre la superposition des chromatogrammes UV (λ340 nm) pour les sept mutants représentatifs des six catégories de profils de produits de glucosylation de la naringénine. Le nom des enzymes correspondants à ces réactions est indiqué à côté de chaque chromatogramme : ASNp F290V, ASNp R226N, ASR C-APY del, «-1 ,2 BrS, ASNp A289C, ASNp A289P/F290C et ASNp I228A. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 4 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme ASNp sauvage (ASNp WT), en comparaison avec le standard d'apigénine. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 5 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp I228F. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.
La Figure 6 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp I228L. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 7 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp I228M. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.
La Figure 8 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp F229A. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.
La Figure 9 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp F229N. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.
La Figure 10 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp A289W. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.
La Figure 11 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp F290C. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.
La Figure 12 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp F290K. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.
La Figure 13 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante DSR-S vardelA4N S512C. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.
La Figure 14 illustre le spectre de masse haute résolution en mode électrospray positif pour la forme mono-glucosylée de l'apigénine obtenue avec l'enzyme mutante DSR-S vardelA4N S512C. En abscisse : rapport m/z ; En ordonnée : abondance relative.
La Figure 15 illustre le spectre MS MS haute résolution en mode électrospray négatif pour la forme mono-glucosylée de l'apigénine (à m/z 431 ,11) obtenue avec l'enzyme mutante DSR-S vardelA4N S512C. En abscisse : rapport m/z ; En ordonnée : abondance relative.
La Figure 16 illustre le spectre de masse haute résolution en mode électrospray positif pour la forme mono-glucosylée de l'apigénine obtenue avec l'enzyme mutante ASNp A289W. En abscisse : rapport m/z ; En ordonnée : abondance relative.
La Figure 17 illustre le spectre de masse haute résolution en mode électrospray positif pour les formes di-glucosylées de l'apigénine obtenue avec l'enzyme mutante ASNp A289W. En abscisse : rapport m/z ; En ordonnée : abondance relative.
La Figure 18 illustre le spectre MS MS haute résolution en mode électrospray négatif pour une des deux formes di-glucosylées de l'apigénine (à m/z 593,16) obtenue avec l'enzyme mutante ASNp A289W. En abscisse : rapport m/z ; En ordonnée : abondance relative.
Structure de l'ion m/z à 353,0667, signature d'une glucosylation de chacune des deux positions 5 et 7 du cycle A de l'apigénine.
La Figure 19 illustre le spectre MS/MS haute résolution en mode électrospray négatif pour une des deux formes di-glucosylées de l'apigénine (à m/z 593,16) obtenue avec l'enzyme mutante ASNp A289W. En abscisse : rapport m/z ; En ordonnée : abondance relative.
Fragmentation de la forme di-glucosylée sur la position 4' du cycle B de l'apigénine conduisant à l'ion m/z à 269,0451.
La Figure 20 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pourr l'enzyme ASNp sauvage (ASNp WT), en comparaison avec le standard de naringénine. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La Figure 21 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp 1228 A. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 22 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp A289C. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 23 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme sauvage tronquée ASR-C-APY-del. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 24 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp A289P/F290C. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 25 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme sauvage α- 1 ,2 BrS. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 26 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp F290V. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 27 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp R226N. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 28 illustre le spectre RMN 2D 1H COSY de la 4,-O-α-D-glucopyranosylnaringénine. En abscisse et ordonnée : déplacement chimique, en partie par million (ppm).
La Figure 29 illustre le spectre RMN 1D 13C Jmod de la
4'-O-α-D-glucopyranosylnaringénine. En abscisse et ordonnée : déplacement chimique, en partie par million (ppm). La Figure 30 illustre le spectre RMN 2D HMBC de la 4'-O-α-D-glucopyranosylnaringénine. En abscisse et ordonnée : déplacement chimique, en partie par million (ppm).
La Figure 31 illustre la superposition des profils chromatographiques obtenus par LC-UV-MS pour les produits de glucosylation de la morine par l'enzyme ΔN123-GBD-CD2 WT et trois des mutants les plus efficaces pour glucosyler ce flavonoîde. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).
La Figure 32 illustre la superposition des profils chromatographiques obtenus par LC-UV-MS pour les produits de glucosylation de la naringénine par l'enzyme ΔN123-GBD-CD2 et trois de ses mutants efficaces pour glucosyler ce flavonoîde. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). Description détaillée de l'invention
Afin de rendre disponibles de nouveaux flavonoïdes O-α-glucosylés, le demandeur a mis au point un nouveau procédé de synthèse de nouvelles structures d'α-gluco-flavonoïdes spécifiquement glycosylés sur des hydroxyles non vicinaux, en particulier du cycle B. Ce procédé met en œuvre des glucane-saccharases spécifiques mutées, identifiées par le demandeur, aptes à effectuer une telle glucosylation.
Ces enzymes spécifiques ne nécessitent pour cela que la présence de saccharose, une agro-ressource renouvelable et bon marché. A ce titre, un procédé selon l'invention est avantageusement peu coûteux. Glucane-saccharases de l'invention
La présente invention concerne en premier lieu un procédé de fabrication de dérivés de flavonoîde O-α-glucosylés comprenant au moins une étape d'incubation d'une enzyme de l'invention avec un flavonoîde de formule (I) et au moins un saccharose.
Comme indiqué précédemment, les enzymes de l'invention sont avantageusement aptes à glucosyler des flavonoïdes au niveau de fonction(s) hydroxyle(s) non-vicinale(s), notamment présentent sur le cycle B. Ces enzymes consistent plus particulièrement en des glucane-saccharases appartenant aux familles 13 et 70 des glycoside-hydrolases (GH13 et GH70).
Les glucane-saccharases appartenant à la famille 13 sont naturellement produites par les bactéries des genres Deinococcus, Neisseria ou Alteromonas.
Les glucane-saccharases appartenant à la famille 70 sont quant à elles naturellement produites par des bactéries lactiques des genres Leuconostoc, Lactobacillus, Sireptococcus ou Weisscla sp..
Comme indiqué précédemment, différentes glucane-saccharases sauvages des familles 13 ou 70 des glycoside-hydrolases ont déjà été utilisées pour la production de flavonoïdes glucosylés, mais aucune d'entre elle n'a à ce jour été décrite comme étant capable de glucosyler les flavonoïdes plus particulièrement visés dans la présente invention, à savoir ceux monohydroxylés sur le cycle B ou possédant des fonctions hydroxyles non-vicinales sur le cycle B.
Or, comme montré dans les exemples, les inventeurs ont déterminé des variants de ces enzymes, mutés au niveau de leur site de fixation aux flavonoïdes, et aptes à glucosyler de tels composés de manière efficace.
L'ensemble des enzymes sauvages ou mutées décrites dans la présente demande qui étaient connues de l'homme du métier n'avait à ce jour jamais été mis en œuvre afin de glucosyler des flavonoïdes selon l'invention.
La séquence nucléotidique de la forme sauvage de l'enzyme ASNp
(AmyloSucrase Neisseria polysacchareà) (famille GH13) a pour référence GenBank AJ01 1781.1 tandis que sa séquence polypeptidique a pour référence Uniprot Q9ZEU2.
La séquence nucléotidique de la forme sauvage de l'enzyme DSR-S (issue de la souche Leuconostoc mesenteroides B-512F) a pour référence GenBank 109598.
La séquence nucléotidique de la forme sauvage de l'enzyme DSR-E (issue de la souche Leuconostoc mesenteroides NRRL B-1299) a pour référence GenBank AJ430204.1 et la référence Uniprot Q8G9Q2.
L'enzyme AN123-GBD-CD2 (séquence SEQ ID NO . 12) est une forme tronquée de l'enzyme DSR-E susmentionnée, comme décrit dans Brison et al, J. Biol. Chem., 2012, 287, 7915-24. Des références bibliographiques décrivant ces enzymes mutées sont indiquées dans les Tableaux 1 et 4. En outre, la méthode d'obtention des enzymes mutées est décrite dans la demande de brevet européen EP 2 100 966 Al .
Les séquences peptides des différentes enzymes mutées ou non selon l'invention sont indiquées dans la présente demande. Ainsi, une enzyme selon l'invention peut être synthétisée par des méthodes classiques de chimie de synthèse, soit des synthèses chimiques homogènes en solution ou en phase solide. A titre illustratif, l'homme de l'art peut utiliser les techniques de synthèse de polypeptide en solution décrite par HOUBEN WEIL (1974, In méthode der Organischen Chemie, E. Wunsh éd., volume 15-1 et 15-II, Thieme, Stuttgart.). Une enzyme selon l'invention peut être également synthétisée chimiquement en phase liquide ou solide par des couplages successifs des différents résidus d'acides aminés (de l'extrémité N-terminale vers l'extrémité C-terminale en phase liquide, ou de l'extrémité C-terminale vers l'extrémité N-terminale en phase solide). L'homme de l'art peut notamment utiliser la technique de synthèse peptidique en phase solide décrite par Merrifield (MERRIFIELD RB, (1965a), Nature, vol.207 (996): 522-523 ; MERRIFIELD RB, ( 1 65b), Science, vol.150 (693): 178- 185.)
Selon un autre aspect, une enzyme selon l'invention peut être synthétisée par recombinaison génétique, par exemple selon un procédé de production comprenant les étapes suivantes :
(a) préparer un vecteur d'expression dans lequel a été inséré un acide nucléique codant la séquence peptidique d'une enzyme de l'invention, ledit vecteur comprenant également les séquences régulatrices nécessaires à l'expression dudit acide nucléique dans une cellule hôte choisie ;
(b) transfecter une cellule hôte avec le vecteur recombinant obtenu à l'étape (a) ;
(c) cultiver la cellule hôte transfectée à l'étape b) dans un milieu de culture approprié;
(d) récupérer le surnageant de culture des cellules transfectées ou le lysat cellulaire desdites cellules, par exemple par sonication ou par choc osmotique ; et
(e) séparer ou purifier, à partir dudit milieu de culture, ou à partir du culot de lysat cellulaire, l'enzyme de l'invention ainsi obtenue. Pour purifier une enzyme selon l'invention qui a été produite par des cellules hôtes transfectées ou infectées par un vecteur recombinant codant ladite enzyme, l'homme de l'art peut avantageusement mettre en œuvre des techniques de purification décrites par Molinier-Frenkel (2002, J. Viral. 76, 127- 135), par arayan et al. (1994, Virology 782- 795) ou par Novelli et al. ( 1991 , Virology 185, 365-376).
Ainsi, des glucane-saccharases utilisables dans un procédé de l'invention sont choisies dans un groupe comprenant :
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 , ladite séquence ayant un acide aminé X1 représentant un acide aminé choisi dans le groupe constitué de A, C, E, F, G, H, I, K, M, N, P, Q, S, T, V et Y;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X2 représentant un acide aminé choisi dans le groupe constitué de A, C, D, F, G, H, K, L, M, N, P, S, V et Y ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X3 représentant un acide aminé choisi dans le groupe constitué de A, C, G, I, K, M, N et W ;
- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO :
4, ladite séquence ayant un acide aminé X4 représentant un acide aminé choisi dans le groupe constitué de C, I, N, P, V et W ;
- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO :
5, ladite séquence ayant un acide aminé X5 représentant un acide aminé choisi dans le groupe constitué de A, C, D, G, I, K, L, M, R, V et W ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 6, ladite séquence ayant un acide aminé X6 représentant un acide aminé choisi dans le groupe constitué de C, G, Q, S et T ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 7, ladite séquence ayant un acide aminé X7 représentant un acide aminé choisi dans le groupe constitué de A et G ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 8 ; - une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9 ; ladite séquence ayant un acide aminé X8 représentant un acide aminé choisi dans le groupe constitué de C, I et L
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 10 ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 1 ; et
- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés X9, X10, X11, X12 et X13, avec :
(i) X9 représentant, indépendamment de X10, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de G, S, V, C, F, N, I, L et W ;
X10 représentant, indépendamment de X9, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, I, H, Y et F ;
à l'exception du cas où X9 représente W et X10 représente F ;
X11 représentant A ;
X12 représentant F ; et
X13 représentant L ;
(ii) X9 représentant W ;
X10 représentant F;
X11 représentant, indépendamment de X9, X10, X12 et X13, un acide aminé choisi dans le groupe constitué de E et A ;
X11 représentant, indépendamment de X9, X10, X11 et X1 , un acide aminé choisi dans le groupe constitué de L et F ;
à l'exception du cas où X11 représente A et X12 représente F ;
X11 représentant L ;
ou
(iii) X9 représentant W ;
X10 représentant F ;
X11 représentant A ;
X12 représentant, indépendamment de X9, X10, X11 et X13 , un acide aminé choisi dans le groupe constitué de A, R, D, N, C, E, Q, G, H, 1, L, K, M, P, S, T, W, Y et V ; et X13 représentant, indépendamment de X9, X10, X11, et X!2, un acide aminé choisi dans le groupe constitué de A, R, D, N, C, E, Q, G, H, I, , M, F, P, S, T, W, Y et V. Selon un mode de réalisation de l'invention, une séquence ayant au moins
80 % d'identité avec la SEQ ID NO : 12 indiquée ci-dessus est de préférence telle que :
(i) X9 représente, indépendamment de X10, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de G, S, V, C, F, N, I, L et W ;
X10 représente, indépendamment de X9, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, I, H, Y et F ;
à l'exception du cas où X9 représente W et X10 représente F ;
X11 représente A ;
X12 représente F ; et
X13 représente L ;
ou
(ii) X9 représente W ;
X10 représente F;
X11 représente, indépendamment de X9, X10, X12 et X13, un acide aminé choisi dans le groupe constitué de E et A ;
X12 représente, indépendamment de X9, X10, X12 et X13, un acide aminé choisi dans le groupe constitué de L et F ;
à l'exception du cas où X11 représente A et X12 représente F ;
X13 représente L ;
ou
est la séquence SEQ ID NO : 13.
Dans cette séquence SEQ ID NO : 13, X9 représente W, X10 représente F, X11 représente A, X12 représente I, X11 représente I, et l'acide aspartique (D) en position 432 est substitué par un acide glutamique (E).
Il doit être compris de cette formulation que les acides aminés définis comme étant respectivement X1, X2, X3, X4. X5, X6, X7, X8, X9, X10. X11, X12 et X13 sont présents et tels que définis ci-dessus dans les glucane-saccharases de l'invention ayant au moins 80 % d'identité avec, respectivement, une séquence SEQ ID NO : 1 à 7, 9 et 12, telles que définies ci-dessus.
Comme montré dans les exemples, toutes les enzymes possédant l'une de ces séquences peptidiques présentent une capacité statistiquement supérieure à celle de l'enzyme sauvage à glucosyler les flavonoïdes de l'invention, présentant des fonctions hydroxyle non-vicinales, notamment sur le cycle B.
La présente invention englobe également les séquences dont la séquence d'acides aminés a au moins 80 %, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 %, 99 % ou 100 % d'identité en acides aminés avec l'une des séquences SEQ ID NO : 1 à 12 telles que définies précédemment et une activité biologique de même nature.
Par activité biologique de même nature en ce qui concerne les séquences peptidiques 1 à 12, on entend une même capacité à glucosyler des flavonoïdes monohydroxylés ou hydroxylés de façon non-vicinale sur le cycle B.
Le « pourcentage d'identité » entre deux séquences d'acides nucléiques ou d'acides aminés, au sens de la présente invention, est déterminé en comparant les deux séquences alignées de manière optimale, à travers une fenêtre de comparaison.
La partie de la séquence nucléotidique dans la fenêtre de comparaison peut ainsi comprendre des additions ou des délétions (par exemple des « gaps ») par rapport à la séquence de référence (qui ne comprend pas ces additions ou ces délétions) de manière à obtenir un alignement optimal entre les deux séquences.
Le pourcentage d'identité est calculé en déterminant le nombre de positions auxquelles une base nucléique identique (ou un acide aminé identique) est observé pour les deux séquences comparées, puis en divisant le nombre de positions auxquelles il y a identité entre les deux bases nucléiques (ou entre les deux acides aminés) par le nombre total de positions dans la fenêtre de comparaison, puis en multipliant le résultat par cent afin d'obtenir le pourcentage d'identité en nucléotides (ou en acides aminés) des deux séquences entre elles.
L'alignement optimal des séquences pour la comparaison peut être réalisé de manière informatique à l'aide d'algorithmes connus.
De manière tout à fait préférée, le pourcentage d'identité de séquence est déterminé à l'aide du logiciel CLUSTAL W (version 1.82) les paramètres étant fixés comme suit : ( 1) CPU MODE = ClustalW mp ; (2) ALIGNMENT = « full » ; (3) OUTPUT FORMAT = « aln w/numbers » ; (4) OUTPUT ORDER - « aligned » ; (5) COLOR ALIGNMENT = « no » ; (6) KTUP (word size) = « default » ; (7) WINDOW LENGTH = « default » ; (8) SCORE TYPE = « percent » ; (9) TOPDIAG = « default » ; (10) PAIRGAP = « default » ; (11) PHYLOGENETIC TREE TREE TYPE = « none » ; (12) MATRIX = « default » ; (13) GAP OPEN = « default » ; (14) END GAPS = « default » ; (15) GAP EXTENSION = « default » ; ( 16) GAP DISTANCES = « default » ; (17) TREE TYPE = « cladogram » et (18) TREE GRAP DISTANCES = « hide ».
Plus particulièrement, la présente invention concerne également les séquences dont la séquence d'acides aminés a 100 % d'identité en acides aminés avec les acides aminés 225 à 450 des séquences SEQ ID NO : 1 à 9, ou 100 % d'identité en acides aminés avec les acides aminés 2130 à 2170 de la séquence SEQ ID NO : 12 et au moins 80 %, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 , 98 %, 99 % ou 100 % d'identité en acides aminés avec le reste des séquences SEQ ID NO : 1 à 12 telles que définies précédemment, et une activité biologique de même nature.
Parmi les séquences d'intérêt de l'invention, certaines d'entre elles s'avèrent plus particulièrement intéressantes en termes d'activité de glucosylation.
Ainsi, selon un mode de réalisation, les glucane-saccharases préférentiellement utilisées dans un procédé de l'invention sont choisies dans le groupe comprenant :
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 , ladite séquence ayant un acide aminé X1 représentant un acide aminé choisi dans le groupe constitué de H, N ou S ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X2 représentant un acide aminé choisi dans le groupe constitué de A, C, F, L, M, S ou V ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X3 représentant une acide aminé choisi dans le groupe constitué de A et N ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 4, ladite séquence ayant un acide aminé X4 représentant une acide aminé choisi dans le groupe constitué de C. I, N. P, V ou W ; - une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 5, ladite séquence ayant un acide aminé X5 représentant un acide aminé choisi dans le groupe constitué de C, K, R ou V ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé X8 représentant un acide aminé choisi dans le groupe constitué de C ou L ; et
- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés X9, X10, X11, X12 et X13, avec :
(i) X9 représentant un acide aminé choisi dans le groupe constitué de G, V, C et F ;
X10 représentant F ; X11 représentant A ; X12 représentant F ; et X13 représentant L ;
(ii) X9 représentant, indépendamment de X10, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de S, N, L et I ;
X10 représentant, indépendamment de X9, X11, X12 et X11, un acide aminé choisi dans le groupe constitué de L, I, H et Y ;
X11 représentant A ; X12 représentant F ; et X11 représentant L ;
(iii) X9 représentant W ; X10 représentant F ; X11 représentant A ou E ; X12 représentant L et X13 représentant L ; ou
ladite séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12 est la séquence SEQ ID NO : 13.
Selon un mode préféré, une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, possédant les acides aminés X9, X10, X11, X12 et X13, est telle que :
(i) X9 représentant un acide aminé choisi dans le groupe constitué de G, V, C et F ;
X10 représentant F ; X11 représentant A ; X12 représentant F ; et X13 représentant L ;
(ii) X<) représentant, indépendamment de X9, X10, X11 et X13, un acide aminé choisi dans le groupe constitué de S et I ;
X10 représentant, indépendamment de X9, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, I et Y ;
X11 représentant A ; X12 représentant F ; et X13 représentant L ; ou (iii) X9 représentant W ; X1() représentant F ; Xu représentant A ou E ; X12 représentant L et Xu représentant L ; ou
ladite séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12 est la séquence SEQ 1D NO : 13.
Les mutants plus particulièrement intéressants selon l'invention de SEQ ID
NO : 12 sont notamment indiqués à l'Exemple 1 1 de la présente demande.
Les enzymes dont les séquences ont au moins 80% d'identité avec les SEQ ID NO 1 à 1 1 présentent en effet toutes une efficacité de glucosylation sur les flavonoïdes de l'invention supérieure de 5 %, 10 %, 15 %, 20 %, 25 %, 30 %, 35 %, 40 %, 45 %, 50 %, 55 % ou 60 % comparative ent et respectivement à une activité de 0,5 +/- 0,5 % ou 4,7 +/- 1 ,7 % pour l'enzyme sauvage (voir notamment les Tableaux 2, 3, 5 et 6).
Les enzymes dont la séquence a au moins 80% d'identité avec la SEQ ID NO 12 présentent une efficacité de glucosylation sur les flavonoïdes de l'invention supérieure de 5 %, 10 %, 15 %, 20 %, 25 %, 30 %, 35 %, 40 %, 45 % ou 50 % comparativement et respectivement à une activité de 20,4 +/- 3,2 % ou 13,9 +/- 4,7 % pour l'enzyme sauvage (voir notamment les Tableaux 7 et 8).
Flavonoïdes, dérivés et mises en œuyre
a) Flavonoïdes mis en œuyre dans un procédé de l'invention
Les flavonoïdes spécifiquement mis en œuvre dans un procédé de l'invention sont de formule (I) telle que décrite précédemment.
Selon un mode de réalisation, un seul des groupements choisi parmi R8, R9, R10, R11 et R12, représente un groupement hydroxyle,
les autres groupements parmi R8, R9, R10, R11 et R12, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (C1-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(O)O(C2-C3) ; une aminé en C1-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; et un thioalkyle en C1-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ; De préférence, le groupement R10 représente un groupe hydroxyle.
De préférence, les groupements X8, R9, R11 et R12 représentent des atomes d'hydrogène.
Selon un mode de réalisation préféré, le groupement R10 représente un groupe hydroxyle et les groupements R8, R9, R11 et R12 représentent des atomes d'hydrogène.
Selon un mode de réalisation, le cycle C représente un cycle de formule (II) ou (IV) telle que définies précédemment. Selon un mode de réalisation, le cycle C représente un cycle de formule (II). Selon un autre mode de réalisation, le cycle C représente un cycle de formule (IV).
Selon un mode de réalisation de l'invention, le groupement R] représente un cycle B de formule (VI) telle que définie précédemment.
Selon un mode de réalisation, le cycle C représente un cycle de formule (II) et le groupement R1 représente un cycle B de formule (VI) telle que définie précédemment.
Selon un autre mode de réalisation, le cycle C représente un cycle de formule (IV) et le groupement R1 représente un cycle B de formule (VI) telle que définie précédemment.
Selon un mode de réalisation, les groupements R1', R2 et R2' représentent des atomes d'hydrogène, et R3 et R3' forment ensemble un groupement =0.
Selon un mode de réalisation préféré, le groupement R1 représente un cycle B de formule (VI), les groupements R1', R2 et R ' représentent des atomes d'hydrogène, et R3 et R3' forment ensemble un groupement =O.
Selon un mode de réalisation préféré, le cycle C représente un cycle de formule (II) ou (IV), le groupement R1 représente un cycle B de formule (VI), les groupements R1', R2 et R2' représentent des atomes d'hydrogène, et R3 et R3' forment ensemble un groupement =O.
Selon un mode de réalisation, deux des groupements R4, R5, R6 et R7 représentent un groupement hydroxyle, les deux autres groupements étant tels que précédemment définis. De préférence, les deux groupements représentant un groupement hydroxyle sont les groupements R4 et R6.
Selon un mode de réalisation, deux des groupements R4, R5, R6 et R7 représentent un groupement hydroxyle, les deux autres groupements représentant un atome d'hydrogène. Selon un mode de réalisation, les groupements R et R7 représentent des atomes d'hydrogène.
Selon un mode de réalisation préféré, les groupements R4 et représentent un groupement hydroxyle et les groupements R5 et R représentent un atome d'hydrogène.
Selon un autre mode de réalisation, X8 et un seul des groupements choisis parmi R10, R11 et R12 représentent un groupement hydroxyle,
R9 et les autres groupements parmi R10, R11 et R12, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1 -C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (C1-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(O)O(C -C3) ; une aminé en C1-C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s)
De préférence, le groupement R^ représente un groupe hydroxyle.
De préférence, les groupements R9, R11 et R12 représentent des atomes d'hydrogène.
Selon un mode de réalisation préféré, les groupements R8 et R10 représentent un groupe hydroxyle et les groupements R<>, R11 et R12 représentent des atomes d'hydrogène.
Selon un mode de réalisation, le cycle C représente un cycle de formule (II) ou (IV), de préférence (II), telle que définies précédemment.
Selon un mode de réalisation de l'invention, le groupement R1 représente un cycle B de formule (VI) telle que définie précédemment.
Selon un mode de réalisation, les groupements R1 ' et R2' représentent des atomes d'hydrogène, R2 représente un atome d'hydrogène ou un groupement -OH, de préférence un groupement -OH, et R3 et R3' forment ensemble un groupement =0.
Selon un mode de réalisation préféré, le groupement R1 représente un cycle B de formule (VI), les groupements R1' et R2' représentent des atomes d'hydrogène, R2 représente un groupement -OH, et R3 et R ' forment ensemble un groupement =0. Selon un mode de réalisation préféré, le cycle C représente un cycle de formule (II), le groupement R1 représente un cycle B de formule (VI), le groupement R2 représente un groupement -OH, et R3 et R3' forment ensemble un groupement =0.
Selon un mode de réalisation, un flavonoïde mis en œuvre dans un procédé de l'invention est de formule (VII), (VIII) ou (IX) suivantes :
Un flavonoïde de l'invention peut être mis en œuvre dans un procédé de l'invention à un ratio molaire saccharose sur flavonoïde compris entre 1 et 35 000, le mélange réactionnel comprenant au moins F(les) enzyme(s), le saccharose et le(s) flavonoïde(s) récepteur(s).
De préférence, le ratio molaire saccharose sur flavonoïde est compris entre 7 et 292, le mélange réactionnel comprenant au moins l'(les) enzyme{s), le saccharose et le(s) flavonoïde(s) récepteur(s). b) Dérivés de flavonoïdes O-ct-glucosylés
La présente invention concerne également certains dérivés de flavonoïde Ο-α-glucosylé. Ceux sont aptes à être obtenus à partir d'un procédé de l'invention.
La présente invention vise plus particulièrement des composés de formule (X) suivante : dans laquelle X]4 représente une chaîne constituée d'au moins deux groupements
α-glucoside, et X1 et X|(„ identiques ou différents, sont choisis dans le groupe comprenant un atome d'hydrogène ; un alkyle en C1-C6, linéaire ou ramifié ; un groupement -C(0)<D(C2-C3) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside
Comme illustré dans Moulis et al. Understanding the polymerization mechanism of glycoside-hydrolase family 70 glucansucrases, J. Biol. Chem. 2006, 281 : 31254-31267, un composé selon l'invention, et glucosylé à l'aide d'une glucane- saccharase conforme à l'invention, peut en effet comprendre une chaîne constituée de 1 à 600.000 groupements α-glucoside.
La présente invention vise également des composés de formule (XI) suivante :
dans laquelle
X17 représente une chaîne constituée de 1 à 600.000 groupements α-glucoside, et
X i8 et X|9, identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène ; un alkyle en C1-C6, linéaire ou ramifié ; un groupement -C(O)O(C2- C3) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside. c) Mise en œuyre des dérivés de flavonoïdes Ο-α-glucosylés de l'invention
Selon un mode de réalisation, les dérivés de flavonoïdes O-α-glucosylés de l'invention peuvent être utilisés à titre d'agent antioxydant (Heim et al, J. Nutr. Biochem., 2002, 13 : 572-584).
Selon un mode de réalisation, les dérivés de flavonoïdes Ο-α-glucosylés de l'invention peuvent être mis en œuvre pour leur utilisation pharmaceutique dans le traitement et/ou la prévention de l'hépatotoxicité, des allergies, de l'inflammation, des ulcères, des tumeurs, des troubles ménopausiques ou des maladies neurodégénératives (Harbome J. et al, Phytochemistry, 2000 55 : 481-504 ; Quideau S. et al., Ange . Chem. Int. End. 201 1 , 50 : 586-621 ).
Selon un mode de réalisation, les dérivés de flavonoïdes O-α-glucosylés de l'invention peuvent être mis en œuvre pour leur utilisation pharmaceutique à titre de veinotonique. ( atsenis K., Curr. Vase. Pharmacol. 2005, 3(1 ), 1 -9)
De plus, selon un mode de réalisation de l'invention, les dérivés de flavonoïdes Ο-α-glucosylés de l'invention peuvent être mis en œuvre à titre :
- d'agent photovoltaïque (voir notamment à cet effet le document Meng et al., Nano Lett. 2008, 8(10), 3266-72 ; Narayan M. R., Renew. Sust. Energ. Rev. 2012, 16, 208- 215 ; US 2009/0071534 Al )
- d'agent répulsif des insectes (voir notamment à cet effet les documents JP 2002060304 ; JP 2003104818 ; Benavente-garcia et al, J. Agric. Food Chem., 1997, 45
(12), 4505^1515 ; Singh et al., Natural product sciences, 1997, 3(1), 49-54; Diwan et Saxena, Int. J. Chem. Sci., 2010, 8(2), 777-782 ; Regnault-Roger et al., J. Stored Prod Res, 2004, 40, 395^08) ;
- d'agent de blanchiment (voir notamment à cet effet le document Barkat Ali Khan et al, Asian J. Chem., 201 1 , 23(2), pp 903-906 ; demandes de brevet
WO 2008140440 Al ; WO 2005094770 Al ; Zhu W. & Gao J., J. Invest. Dermatol. Symposium Proceedings, 2008, 13, 20-24 ; Kim J.H. et al., J. Invest. Dermatol., 2008, 128, 1227-1235) ; ou
- d'agent pesticide, fongicide et/ou bactéricide (voir notamment à cet effet les documents WO 2013043031 , CN 102477024 et CN 101002557).
La présente invention est aussi illustrée, sans n'y être aucunement limitée, par les exemples qui suivent. EXEMPLES
Exemple 1 : Production et mise en œuyre de glucane-saccharases recombinantes pour la glucosylation de l'apigénine et de la naringénine
Une librairie de 183 variants incluant 174 mutants, simples ou doubles, construits à partir de l'amylosaccharase de N. polysaccharea (famille GH13 des glycoside- hydrolases) et 10 variants, construits à partir des glucane-saccharases DSR-S, ASR et α- 1 ,2 BrS (appartenant à la famille GH70) ont été testés pour leur aptitude à glucosyler l'apigénine et la naringénine.
L'origine des glucane-saccharases sélectionnées pour l'étude est reportée dans les Tableaux 1 et 4.
Les Tableaux 1 et 4 illustrent en effet un certain nombre des glucane- saccharases testées dans les exemples du présent texte et précise : colonne 1 : l'organisme dont Penzyme est originaire ; colonne 2 : les différentes enzymes sauvages testées ainsi que les positions mutées du site actif de ces enzymes sauvages dans les glucane-saccharases mutées également testées ; colonne 3 : les spécificités de liaisons majoritaires lors de la synthèse du polymère naturel ; colonne 4 : les références bibliographiques dans lesquelles ces enzymes, aussi bien sous formes sauvages que mutées, ont été décrites dans l'état de la technique.
Ces enzymes ont été utilisées sous forme recombinante et sont exprimées chez Eschcrichia coli.
1.1. Production des enzymes en microplaques
L'ensemble des souches d' Eschcrichia coli surexprimant les glucane- saccharases hétérologues des familles GH13 et GH70, sauvages ou leurs mutants, sont maintenues au format microplaque 96 puits afin de faciliter les futures étapes de criblage de glucosylation des flavonoïdes.
A partir des microplaques source, une pré-culture de ces souches d'E. coli est réalisée pendant 22 heures à 30°C, 700 rpm dans des microplaques 96 puits, dans 200 xL de milieu de culture LB supplémenté avec 100 μg mL d'ampicilline. Ces précultures sont utilisées à leur tour pour ensemencer les microplaques « deep-well » dont chaque puits contient 1 mL par puits de milieu auto-inductible ZYM5052 contenant notamment 0,2 % (p/v) d'α-lactose, 0,05 % (p/v) de D-glucose, 0,5 % (p/v) de glycérol et 0,05 % (p/v) de L-arabinose (Studier et ai, 2005).
Après 22 heures de culture à 30°C et à 700 rpm, la suspension cellulaire est centrifugée pendant 20 minutes à 3000 g à 4°C. Les culots cellulaires sont resuspendus dans les microplaques « deep-well » 96 puits, avec 300 μί de tampon phosphate salin (24 mM phosphate de sodium/potassium et 274 mM NaCl) contenant 0,5 g L de lysozyme et 5 mg/L de RNAse pancréatique bovine.
Puis on réalise une incubation de 30 minutes à 30°C sous agitation, ces microplaques étant ensuite stockées une nuit à -80°C. Après décongélation, les microplaques sont vigoureusement agitées puis centrifugées pendant 20 minutes à 3000 g à 4 °C.
Les lysats cellulaires centrifugés contenant les enzymes recombinantes sont transférés dans des microplaques 96 puits « deep-well » propres.
1.2. Mise en œuyre des réactions d'accepteur
Les extraits enzymatiques obtenus sont utilisés pour mener les réactions de criblage enzymatique de glucosylation de flavonoïdes. L'activité enzymatique de chaque lysat cellulaire centrifugé est évaluée au format microplaque, en poids final après 30 minutes d'incubation en présence de 146 m M final de saccharose, par dosage des sucres réducteurs par Facidc 3,5-dinitrosalicylique (DNS). Finalement, après dilution dans de Peau ultrapure, Tabsorbance est lue à 540 nm.
Les réactions d'accepteurs des flavonoïdes sont ensuite réalisées en microplaques « deep-well », dans un volume de 300 μί, à des concentrations finales, en saccharose de 146 mM, en flavonoïde de 2,5 mM (apigénine) ou 5 mM (naringénine) (initialement dissous dans 100 % DMSO), et 140 μί de lysat cellulaire centrifugé.
La concentration finale en DMSO dans le milieu réactionnel est de 3 % (v/v). L'incubation est menée à 30°C et à 700 rpm. Au bout de 24 heures, les enzymes sont dénaturées à 95°C pendant 15 minutes. Ces microplaques sont stockées à - 80°C en vue de l'évaluation rapide de la glucosylation des flavonoïdes par chromatographie en phase liquide couplée à la spectrométrie de masse (HPLC-MS ou LC-MS).
1.3. Techniques analytiques
En vue de leurs analyses par HPLC-MS, les milieux réactionnels extensivement homogénéisés sont dilués au l/30c dans du DMSO. La séparation des flavonoïdes et de leurs formes glucosylées est effectuée en phase inverse avec une colonne ProntoSIL Eurobond® 53x3,0 mm 120-3-C18-AQ (porosité de 120 Â, granulométrie de 3 μηι, greffage C l 8, Bischoff Chromatography, Allemagne).
Cette colonne est maintenue à 40°C sur un système HPLC Dionex Ultimate
3000 équipé d'un détecteur UV/Vis. Ce système est couplé à un spectromètre de masse, simple quadrupole (Thermo Scientific, MSQ Plus).
La phase mobile est composée d'un mélange eau ultrapure (Solvant A) / acétonitrile de qualité LC-MS (solvant B) contenant chacun 0,05 % (v/v) d'acide formique. La séparation est assurée en 10 minutes par un gradient en solvant B défini comme suit ;
0 min, 15 % (v/v) ;
3 min, 25 % (v/v) ;
6.5 min, 49,5 % (v/v) ;
6.6 min, 80 % (v/v) ;
6,8 min, 15 % (v/v) ; et
10 min, 15 % (v/v).
L'ionisation en spectrométrie de masse sur l'équipement MSQ Plus est réalisée en mode électrospray positif (ESI+) pour l'apigénine et négatif (ESI-) pour la naringénine.
La tension du capillaire est réglée à 3000 V, celle du cône à 75 V. La température du bloc source est fixée à 450°C.
Le système LC-MS/MS utilisé pour l'analyse en spectrométrie de masse haute résolution ou en fragmentation MS/MS comprend un système de séparation chromatographique Ultimate 3000 (Dionex) couplé à un spectromètre de masse hybride piège linéaire/Orbitrap (LQT Orbitrap, Thermo Fischer Scientific). L'ionisation en spectrométrie de masse sur l'équipement LQT Orbitrap est cette fois-ci réalisée soit en mode électrospray positif (ESI+) soit en mode négatif (ESI-). Exemple 2 : Détermination des efficacités de glucosylation de rapigénine par l'amylosaccharase recombinante de N. polysaccharea et par ses variants
Les réactions en présence d'accepteur ont été mises en œuvre en appliquant les conditions décrites dans l'exemple 1.
L'efficacité de glucos lation du flavonoïde a été déterminée à partir de la formule suivante :
Efficacité de glucosylation =
(∑(aire de pic de(s) flavonoïde(s) glucosylé(s))) / (∑(aire de pic de(s) flavonoïde(s) glucosylé(s)) + aire du pic de flavonoïde aglycone résiduel) x 100
Les efficacités de glucosylation des flavonoïdes, exprimées en pourcentage, ont été calculées à partir des aires des pics des différents produits analysés, comme décrit dans l'exemple 1 , par HPLC équipé d'un détecteur UV (λ340 nm), après 24 h de réaction. Les valeurs obtenues sont reportées dans le Tableau 2.
Le Tableau 2 illustre l'efficacité de glucosylation, au cours du criblage en microplaques, de l'apigénine pour la forme sauvage de l'ASNp (amylosaccharase recombinante de N. polysaccharea) ainsi que pour ses 174 mutants de son site actif. En ordonnée : les positions de mutation de l'enzyme sauvage (ASNp WT) ; en abscisse : l'acide aminé substituant celui présent dans la séquence de l'enzyme sauvage.
Ainsi, à titre illustratif, le pourcentage de 1 ,7 % indiqué ligne 2, colonne 2 a été obtenu à l'aide d'une enzyme muté en position 226 par la substitution de l'acide aminé R (Arginine) par l'acide aminé A (Alanine).
Chaque case représente une mutation simple sur les positions R226, 1228, F229, A289, F290, 1330, V331 , D394 et R446 ou une mutation double, à savoir deux mutations simples au niveau de deux de ces positions.
La barre grise dans chaque case figure le niveau d'efficacité de glucosylation par rapport au mutant le plus efficace.
Les résultats obtenus pour l'enzyme sauvage sont indiqués au dessus du Tableau 2 ainsi qu'aux intersections R226R, I228I, F229F, A289A, F290F, I330I, V331 V, D394D et R446R.
Les 3 variants double mutants sont indiqués sous le Tableau 2. Pour la forme sauvage de l'enzyme ASNp (Amylosucrase Neisseria polysaccharea), l'efficacité de glucosylation est très faible (0,5 ± 0,5 ; n=16). Les efficacités de glucosylation obtenus pour R226R, I228I, F229F, A289A, F290F, I330I, V331V, D394D et R446R données dans le Tableau 2 sont également comprises dans la gamme de valeurs 0,5 ± 0,5.
Avec une efficacité de glucosylation de l'apigénine supérieure à celle de l'enzyme sauvage (supérieure à 1 %), un grand nombre d'enzymes mutantes ressortent de ce criblage.
Plus particulièrement, avec une efficacité de glucosylation de l'apigénine supérieure à 5 %, huit enzymes ressortent plus particulièrement du criblage.
Les efficacités de glucosylation pour ces huit enzymes mutées sont respectivement les suivantes : ASNp I228F : 9,9 %; ASNp I228L : 1 1 ,1 %; ASNp I228M : 5,4 %; ASNp F229A : 5,6 %; ASNp F229N : 5,7 %; ASNp A289W : 22,1 %; ASNp F290C : 5,4 %; et ASNp F290K : 8,9 %.
Cela illustre l'intérêt d'employer des enzymes issues de l'ingénierie dirigée pour la glucosylation d'accepteurs faiblement reconnus tels que les flavonoïdes monohydroxylés ou hydroxylés de façon non-vicinale, notamment sur le cycle B. Exemple 3 ; Détermination des efficacités de glucosylation de l'apigénine par les glucane-saccharascs de la famille GH70
Les glucane-saccharases de la famille GH70 testées pour leur activité de glucosylation de l'apigénine sont répertoriées dans le Tableau 4.
Le Tableau 4 illustre les glucane-saccharases de la famille GH70 (glycoside- hydrolase 70) testées dans les exemples du présent texte.
Ainsi, ASR C-APY-del WT représente la forme tronquée de l'ASR (alternane- saccharase), DSR-S vardelA4N WT représente la forme tronquée sauvage DSR-S (dextransucrase) et, par exemple, DSR-S vardelA4N F353T représente la forme tronquée de la DSR-S mutée en position 353 par la substitution de l'acide aminé F (Phénylalanine) par l'acide aminé T (Thréoninc). Les résultats de glucosylation de l'apigénine par les glucane-saccharases de la famille GH70 sont reportés dans le Tableau 5.
Le Tableau 5 illustre l'efficacité de glucosylation de l'apigénine pour la forme sauvage du variant tronqué de DSR-S (vardelA4N WT), pour la forme sauvage tronquée de PASR (ASR C-APY-del WT), pour la forme sauvage de l'enzyme α- 1 ,2 BrS, et pour sept mutants de DSR-S vardelA4N.
La barre grise dans chaque case figure le niveau d'efficacité de glucosylation par rapport au mutant le plus efficace. Alors que la forme sauvage du variant tronqué de DSR-S
(DSR-S vardelA4N WT) ne présente qu'une très faible activité de glucosylation (0,5 %), le mutant S512C présente une efficacité de glucosylation de l'apigénine plus élevée (13,9 %). Exemple 4 ; Comparaison des efficacités de glucosylation de l'apigénine pour les enzymes les plus efficaces
Parmi les enzymes testées des familles de GH13 et GH70, neuf mutants ont des efficacités de glucosylation de l'apigénine supérieures à 5 %, à savoir ASNp I228F, ASNp I228L, ASNp I228M, ASNp F229A, ASNp F229N, ASNp A289W, ASNp F290C, ASNp F290K et DSR-S (vardelA4N S512C). Ces efficacités sont comparées pour ces neuf mutants les plus efficaces, avec leurs activités relatives en présence de saccharose seul (voir Figure 1 ).
Les activités d'hydrolyse du saccharose des enzymes sauvages, ASNp WT (GH13) ou DSR-S vardelA4N WT (GH70), ont été prises comme références pour le calcul des activités relatives d'hydrolyse du saccharose de leurs mutants respectifs.
Bien que les mutants présentent des activités sur saccharose seul plus faibles que celles des enzymes sauvages, les efficacités de glucosylation de ces mêmes mutants sont de 10 à 44 fois plus importantes que pour les enzymes sauvages. Plus globalement, le coefficient de corrélation entre les efficacités de glucosylation de l'apigénine et les activités d'hydrolyse du saccharose, calculé pour l'ensemble des enzymes mutantes de l'amylosaccharase de N. polysaccharea, est de 0,08. Cela illustre l'intérêt du procédé pour identifier des enzymes peu actives sur saccharose seul mais capables de glucosyler les flavonoïdes de l'invention.
Dans le cas de l'enzyme mutante ASNp A289W, une concentration massique de 149 mg/mL d'apigénine glucosylée est atteinte.
II s'agit de concentration minimale obtenue en microplaque. Ainsi, un facteur
10 d'amélioration peut être attendu après optimisation du milieu.
Exemple 5 : Analyse LC-MS des produits de glucosylation de Papigénine
Les neufs mutants mentionnés à l'exemple 4 peuvent être classés en 6 catégories suivant le profil de produits de glucosylation obtenu en LC-MS. La superposition des chromatogrammes UV (X340 nm) pour un représentant de chacun de ces 6 catégories de profils (respectivement ASNp A289W, DSR-S (vardelA4N S512C), ASNp F290K, ASNp F290C, ASNp F229N et ASNp I228F) est présentée en Figure 2.
La superposition de ces chromatogrammes met en évidence la diversité de formes d'apigénine glucosylée à laquelle il est possible d'aboutir.
Les profils LC-MS obtenus pour ASNp WT et les neuf mutants les plus efficaces mentionnés à l'exemple 4 sont représentés aux Figures 4 à 13.
Les masses molaires telles que déterminées par LC-MS dans l'exemple 1 du pic d'apigénine glucosylée le plus intense pour chacun des neufs mutants sont les suivantes :
Figure 5 : 432,7 g/mol
Figure 6 : 432,7 g/mol
Figure 7 : non déterminée
Figure 8 : 432,8 g/mol
Figure 9 : 432,7 g/mol
Figure 10 : 594,8 g/mol
Figure 1 1 : donnée non disponible
Figure 12 : donnée non disponible
Figure 13 : 432,7 g/mol.
L'enzyme sauvage a une très faible efficacité de glucosylation sur Papigénine
(0,5 %). En effet, si on compare le standard d'apigénine avec les produits finaux de la réaction de glucosylation, on détecte l'apparition sur le chromatogramme UV de plusieurs pics, de très faibles intensités, d'apigénine glucosylée (Figure 4).
Les mutants I228F (Figure 5), I228L (Figure 6) et I228M (Figure 7) ont des profils de produits similaires entre eux. Toutefois, des variations entre les proportions des différentes formes d'apigénine glucosylée sont observées avec le mutant I228M (Figure 7).
Le groupe de mutants F229A (Figure 8) et F229N (Figure 9) présentent également des profils de produits similaires.
Enfin, le mutant F290K a un profil de produits plus complexe que celui du mutant F290C.
Exemple 6 : Analyse LC-MS haute résolution et LC-MS/MS des produits de glucosylation de Papigénine
Une étude a été réalisée, par LC-MS haute résolution et LC-MS/MS (résultats obtenus chez Imagif), sur les produits de glucosylation de Papigénine obtenus avec les enzymes mutantes ASNp A289W et DSR-S vardelA4N S512C.
Le produit de glucosylation de Papigénine produit par le mutant d'enzyme DSR-S vardelA4N S512C est une forme monoglucosylée (Figure 13) dont le temps de rétention est de 4,23 min, et dont le rapport m/z en mode électrospray positif a été déterminé à 433,1 1 19 (Figure 1 ). L'analyse LC-MS/MS en mode électrospray négatif de cette forme monoglucosylée produite par DSR-S vardelA4N S512C a conduit à l'identification de deux ions majoritaires dont les rapports m/z ont été déterminés à 269.0451 et 268.9360 (Figure 15), permettant ainsi de supporter l'obtention d'une O- glucosylation sur la position 4' du cycle B de l'apigénine.
L'enzyme ASNp A289W glucosyle Papigénine pour donner un produit monoglucosylé dont le temps de rétention est de 4,25 min (Figure 10) et dont le rapport m/z en mode électrospray positif a été déterminé à 433,1 120 (Figure 16). Cette analyse a également montré que le pic de produit de glucosylation éluant à 3,68 min (Figure 10) correspond à une diglucosylation de l'apigénine. Le rapport m/z en mode électrospray positif a été déterminé à 595, 1645 (Figure 17). L'analyse LC-MS/MS en mode électrospray négatif révèle que deux formes diglucosylées de l'apigénine co-éluent à 3,68 min. L'analyse LC-MS/MS en mode électrospray négatif de la première forme diglucosylée produite par ASNp A289W a conduit à l'identification de trois ions majoritaires dont les rapports m/z ont été déterminés à 353,0660, 31 1 ,0555 et 269,0451 (Figure 18). Cela permet ainsi de supporter l'obtention d'une forme diglucosylée pour laquelle chacune des positions 5 et 7 du cycle A est O-glucosylée. L'analyse LC-MS/MS en mode électrospray négatif de la seconde forme diglucosylée produite par ASNp A289W a conduit à l'identification d'un seul ion majoritaire dont le rapport m/z a été déterminé à 269.0451 (Figure 19), permettant ainsi de supporter l'obtention d'une di-O-glucosylation sur la position 4' du cycle B, uniquement, de l'apigénine.
Exemple 7 : Détermination des efficacités de glucosylation de la naringénine par Tamylosaccharase recombinante de TV. polysaccharea et par ses variants
Les réactions en présence d'accepteur ont été mises en œuvre en appliquant les conditions décrites dans l'exemple 1.
L'efficacité de glucosylation du flavonoïde a été déterminée à partir de la formule énoncée à l'exemple 2. Les efficacités de glucosylation des flavonoïdes, exprimées en pourcentage, ont été calculées à partir des aires des pics des différents produits analysés, comme décrit dans l'exemple 1 , par HPLC équipé d'un détecteur UV (λ340 nm), après 24 h de réaction. Les valeurs obtenues sont reportées dans le Tableau 3.
Le Tableau 3 illustre l'efficacité de glucosylation, au cours du criblage en microplaques, de la naringénine pour la forme sauvage de l'ASNp (amylosaccharase recombinante de N. polysaccharea) ainsi que pour les 174 mutants de son site actif. En ordonnée : les positions de mutation de l'enzyme sauvage (ASNp WT) ; en abscisse : l'acide aminé substituant celui présent dans la séquence de l'enzyme sauvage.
Ainsi, à titre illustratif, le pourcentage de 2,4 % indiqué ligne 2, colonne 2 a été obtenu à l'aide d'une enzyme muté en position 226 par la substitution de l'acide aminé R (Arginine) par l'acide aminé A (Alanine).
Chaque case représente une mutation simple sur les positions R226, 1228, F229, A289, F290, 1330, V331 , D394 et R446 ou une mutation double, à savoir deux mutations simples au niveau de deux de ces positions. La barre grise dans chaque case figure le niveau d'efficacité de glucosylation par rapport au mutant le plus efficace.
Les résultats obtenus pour l'enzyme sauvage sont indiqués en-haut du Tableau 3 ainsi qu'aux intersections R226R, I228I, F229F, A289A, F290F, I330I, V331V, D394D et R446R. Les résultats obtenus pour les enzymes doublement mutées sur les positions 289 et 290 sont indiquées en bas du Tableau 3.
Pour la forme sauvage de l'enzyme ASNp l'efficacité de glucosylation est réduite (4.7 ± 1.7; n=1 ).
Avec une efficacité de glucosylation de la naringénine supérieure à celle de l'enzyme sauvage (supérieure à 6,4 %), un grand nombre d'enzymes mutantes ressortent de ce criblage.
Plus particulièrement, avec une efficacité de glucosylation de la naringénine supérieure à 10 %, seize enzymes mutantes ressortent plus particulièrement du criblage. Sept de ces enzymes mutantes ont en particulier une efficacité de glucosylation de la naringénine supérieure à 20 % et deux d'entre elles ont une efficacité supérieure à 50 %.
Les efficacités de glucosylation pour ces seize enzymes mutées sont respectivement les suivantes : ASNp R226H : 13,5 %; ASNp R226N : 16,0 %; ASNp R226S : 14,1 %; ASNp I228A : 70,2 %; ASNp I228C : 30,9 %; ASNp I228S : 16,4 %; ASNp I228V : 12,3 %; et ASNp A289C : 27,8 % ; ASNp A2891 : 11 ,2 % ; ASNp A289N : 14,5 % ; ASNp A289P : 10,3 % ; ASNp A289V : 21 ,8 % ; ASNp F290R : 1 1 ,2 % ; ASNp F290V : 21 ,1 % ; ASNp A289P/F290C : 50,9 % ; ASNp A289P/F290L : 22,9 %.
La glucosylation de la naringénine illustre l'intérêt d'employer des enzymes issues de l'ingénierie dirigée pour la glucosylation d'accepteurs faiblement reconnus tels que les flavonoïdes.
Exemple 8 : Détermination des efficacités de glucosylation de la naringénine par les glucane-saccharases de la famille GH70
Les glucane-saccharases de la famille GH70 testées pour leur activité de glucosylation de l'apigénine sont répertoriées dans le Tableau 4. Les résultats de glucosylation de la naringénine par les glucane-saccharases de la famille GH70 sont reportés dans le Tableau 6.
Le Tableau 6 illustre l'efficacité de glucosylation de la naringénine pour la forme sauvage du variant tronqué de DSR-S (vardelA4N WT), pour la forme sauvage tronquée de l'ASR (ASR C-APY-del WT), pour la forme sauvage de l'enzyme α- 1 ,2 BrS et pour sept mutants de DSR-S vardelA4N.
La barre grise dans chaque case figure le niveau d'efficacité de glucosylation par rapport au mutant le plus efficace.
La forme sauvage du variant tronqué de l'ASR (ASR C-APY-del WT) présente une efficacité de glucosylation de 27,1 %. L'enzyme sauvage α- 1 ,2 BrS présente une efficacité de glucosylation de la naringénine de 26,8 %.
Exemple 9 : Analyse LC-MS des produits de glucosylation de a naringénine
Les dix-huit mutants ayant une efficacité de glucosylation de la naringénine supérieure à 10 % discutés aux exemples 7 et 8 peuvent être classés en sept catégories suivant le profil de produits de glucosylation, obtenu en LC-MS. La superposition des chromatogrammes UV (λ340 nm) pour un représentant de chacune de ces sept catégories de profils est présentée en Figure 3.
La superposition de ces chromatogrammes met en évidence la diversité de formes de naringénine glucosylée à laquelle il est possible d'aboutir.
Les profils LC-MS obtenus pour ASNp WT, les cinq enzymes mutantes de l'ASNp et les deux glucane-saccharases de la famille GH70 les plus efficaces sont représentés aux Figures 20 à 27.
Les masses molaires, telles que déterminées par LC-MS dans l'exemple 1 , du pic de naringénine glucosylée le plus intense pour chacun de ces profils sont les suivantes :
Figure 20 : non déterminé
Figure 21 : 433,6 g/mol
Figure 22 : 595,5 g/mol
Figure 23 : 758,4 g/mol
Figure 24 : 595,5 g/mol Figure 25 : 433,8 g/mol
Figure 26 : 433,8 g/mol
Figure 27 : 758,0 g/mol
L'enzyme sauvage (Figure 20) a une efficacité réduite de glucosylation sur l naringénine (4,7 %). En effet, si on compare le standard de naringénine avec les produits finaux de la réaction de glucosylation, on détecte l'apparition sur le chromatogramme UV de plusieurs pics, de faibles intensités, de naringénine glucosylée (Figure 20).
Les profils de glucosylation de la naringénine obtenus avec les enzymes ASNp R226N, ASNp I228A, ASNp A289C, ASNp F290V, ASNp A289P F290C, ASR-C-APY- del ou α- 1 ,2 BrS sont tous distincts (Figures 21 à 27).
Exemple 10 : Production, purification et détermination structurale par RMN de la 4,-O-α-D-glucopyranosylnaringénine par le mutant I228A de l'ASNp
Production de la 4,-O-α-D-glucopyranosylnaringénine
La production des produits de glucosylation est réalisée avec l'enzyme ASNp
I228A sur 204 mg de naringénine. Les conditions réactionnelles sont les suivantes : concentration finale en saccharose 146 mM, en naringénine 5 mM (initialement dissoute dans du DMSO à 150 mM), tampon PBS pH 7,2, ASNp 1228A 0,5 U/mL et eau ultrapure qsp 145 mL. La réaction est menée sous agitation à 30°C pendant 24 h. Au terme de la réaction, l'enzyme est thermiquement inactivée. Le mélange réactionnel est conservé à - 20°C.
Purification de la 4'-O-α-D-glucopyranosylnaringénine
Une étape de pré-purification est réalisée par extraction sur phase solide (SPE) sur une cartouche contenant 5 g de phase stationnaire Cl 8. Après conditionnement de la colonne, le mélange réactionnel centrifugé est déposé sur la colonne et percole par gravité.
Après les étapes de lavage avec de l'eau ultrapure, l'élution est réalisée avec du méthanol.
L'éluat est séché sous un flux d'azote gazeux avant d'être repris dans 100% DMSO à une concentration de 100 g/L.
Les différentes formes glucosylées de la naringénine sont séparées à température ambiante par HPLC-UV semi-préparative sur un équipement Waters. Une colonne Cl 8 250 x 10 mm munie d'une précolonne permet de séparer les différentes formes glucosylées de la naringénine avec une phase mobile aqueuse à 0,05% (v/v) d'acide formique avec un gradient d'acétonitrile (B). Les différentes étapes du gradient sont les suivantes : 0 min, 22% B ; 1 min, 22% B ; 17 min, 25% B ; 21 min, 29% B ; 21 ,5 min, 95% B ; 24,5 min, 95% B ; 25 min, 22% B ; 27,5 min, 22 % B. Sur la base du signal UV, les fractions d'élution sont collectées de manière automatisée. La pureté des fractions d'élution est évaluée par LC-UV-MS avec une colonne analytique Cl 8 250 x 4,6 mm (gradient décrit ci-dessus)
Les fractions d'élution contenant une forme monoglucosylée de la naringénine pure à 96%, éluant à un temps de rétention de 18,4 min en HPLC-UV semi-préparative, sont rassemblées et séchées grâce un équipement GeneVac. Le produit est ensuite solubilisé dans 300 de méthanol deutéré, séché sous un flux d'azote gazeux puis lyophilisé pendant 48h.
Caractérisation structurale de la 4'-O-α-D-glucopyranosylnariniiénine La détermination structurale de ce produit de mono-glucosylation a été effectuée par RMN.
Les spectres 1H, 1 H-1 H COSY, JMod, 1 H-13C HMBC ont été enregistrés sur un équipement Bruker Avance 500 MHz à 298 K (500 MHz pour 1 H et 125 MHz pour l3C) avec une sonde 5 mm z-gradient TBI. Les données ont été acquises et traitées grâce au logiciel TopSpin 3. L'échantillon a été analysé dans du méthanol deutéré.
L'attribution des différents signaux RMN est portée sur les Figures 28, 29 et
30. Le composé identifié est la 4'-O-α-D-glucopyranosylnaringénine. La constante de couplage 3JH-i. H-2 du proton anomérique H-l " du résidu glucosyle est de 3,4 Hz.
Exemple 11 : Glucosylation de la naringénine et de la morine par l'enzyme ANm-GBD-CD2 et ses mutants
Des variants simples ou doubles construits à partir de la glucane-saccharase AN i23-GBD-CD2 (appartenant à la famille GH70 des glycoside-hydrolases) ont été testés pour leur aptitude à glucosyler la naringénine et la morine. Les résultats de glucosylation de ces deux flavonoïdes, par des variants de AN| 23-GBD-CD2, sont reportés dans les Tableaux 7 et 8. Concernant la morine, l'enzyme sauvage la glucosyle avec une efficacité de glucosylation de 20,4 ± 3,2%.
Quatorze mutants glucosylent ce flavonol plus efficacement que l'enzyme sauvage, à savoir W403G, W403S-F404L, W403V, W403C, W403F, F431 I-D432E- L434I, F431 L, A430E-F431 L, W403F-F404I, W403C-F404I, W403N-F404Y, W403N- F404H, W403I-F404Y et W403L-F404L. Les efficacités de glucosylation obtenues pour ces mutants sont représentées dans le Tableau 7.
Parmi eux, neuf mutants glucosylent la morine avec une efficacité de glucosylation supérieure ou égale à 30% (mutants W403G, W403S-F404L, W403V, W403C, W403F, F4311-D432E-L434I, F431 L, A430E-F431 L et W403F-F404I). Deux mutants ont même une efficacité de glucosylation de la morine supérieure ou égale à 40%, voire à 45% (mutants W403S-F404L et W403G). Les meilleures efficacités de glucosylation ont été obtenues avec les mutants W403S-F404L (49,5%) et W403G (66,7%). Des produits de glucosylation de la morine ont été détectés par LC-UV-MS (Figure 31 ). Un composé mono-glucosylé, deux composés diglucosylés et un composé triglucosylé ont été identifiés. Le meilleur mutant pour la glucosylation de la morine est le variant W403G qui synthétise quatre fois plus de morine di-glucosylé que l'enzyme sauvage. La naringénine est glucosylée par ANi23-GBD-CD2 WT avec un rendement de glucosylation de 13,9 ± 4,7% (Tableau 8).
Neuf variants présentent une efficacité de glucosylation supérieure à 20%, à savoir W403I-F404Y, W403V, W403G, W403F, W403S-F404L, W403C, F431 I-D432E- L434I, F431 L et A430E-F431 L. Les efficacités de glucosylation obtenues sont représentées dans le Tableau 8.
Sept d'entre eux ont une efficacité de glucosylation supérieure ou égale à 25 % (W403I-F404Y, W403V, W403G, W403F, W403S-F404L, W403C, et F431 I-D432E- L434I). Plus particulièrement, trois variants ont une efficacité de glucosylation supérieure ou égale à 30 %, voire à 35% (W403G, W403F, W403I-F404Y). Le meilleur taux de conversion de 59,3% a été obtenu avec le variant W4031-F404Y. Concernant les produits de glucosylation de la naringénine, des produits de réaction ont été détectés par LC-UV- M S (Figure 32). Un composé monoglucosylé. deux composés diglucosylés et un composé triglucosylé ont été identifiés par spectrométrie de masse.
La naringénine est peu glucosylée par l'enzyme sauvage (14%) et l'essentiel est monoglueosylée (13%). En particulier, un variant de la banque W403-F404 présente une augmentation de la production du produit mono-glucosylé. jusqu'à 49% avec le mutant W4031-F404Y. Finalement, un variant (W403S-F404L) convertit 10% de la naringénine en composé triglucosylé (contre seulement 1% pour l'enzyme sauvage).
Liaisons
majoritaires
Organisme Glucane-saccharase Références
dans le polymère
naturel
Albenne C. et al, J. Biol. Chem. , 2004 279(1)
726-734
ASNp WT et 152 mutants Champion E., 2008. Thèse de doctorat, INSA,
Neisseria simples et 3 mutants Toulouse
polysaccharea doubles du site actif -(l→4)
(EC 2.4.1.4) (Positions 228, 229, 289, Champion C. et al, J. Am. Chem. Soc., 2009,
290, 330, 331 , 394, 446) 131 , 7379-7389
Champion C. et al., J. Am. Chem. Soc, 2012,
134, 18677-18688
EP08290238.8
Tableau 1
nd : donnée non disponible
Tableau 2 54
nd : donnée non disponible
Tableau 3 Liaisons
Organisme Clueane-saecharase majoritaires dans le Références
polymère naturel
Moulis. C, 2006. Thèse de
Leuconostoc doctorat, INSA, Toulouse et mesenteroides B-512F DSR-S varde WN WT -(l→6) Moulis C. et al., FEMS (EC 2.4.1.5) Microbiol. Lett, 2006
261 203-210
7 mutants de DSR-S
vardeLd4N : F353T ou S512C
Leuconostoc ou F353W ou
Irague R. et al, Anal. Chem. mesenteroides B-512F H463R/T464D/S512T ou -(l→6)
2011 83(4) 1202-1206 (EC 2.4.1.5) H463R/T464V/S512T ou
D460A/H463S/T464L ou
D460M/H463 Y/T464M/S512C
Joucla. G., 2003. Thèse de
Leuconostoc
doctorat, INSA, Toulouse et mesenteroides NRRL B- a-(l→3)
ASR C-APY-del Joucla G et al, FEBSLett. 1355 / -(l→6)
2006 580(3) 763-768 (EC 2.4.1.140)
Leuconostoc
mesenteroides NRRL B- Mutant de DSR-E B ri son et al , J. Biol. Chem., a-(l→2)
1299 AN123-GBD-CD2 2012, 287, 7915-24
Tableau 4
Tableau 5
Le nombre indiqué dans chaque case est le pourcentage d'efficacité de glucosylation.
Tableau 6
Le nombre indiqué dans chaque case est le pourcentage d'efficacité de glucosylation
Morine Na ri ngénine
Tableau 7 Tableau 8
Efficacités de glucosylation de la morine (Tableau 7) et de la naringénine (Tableau 8) par la glucane-saccharase ANi23-GBD-CD2 sauvage et les meilleurs mutants issus du criblage secondaire.
SEQUENCES :
Série SEQ ID NO : 1 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) R226Xj)
SPNSQYLKTRILDIYTPEQRAGIE SEDWRQFSRRMDTHFPKLMNELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYV DLFAGDL GLKDKIPYFQELGLTYLHLMPLF CPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLX,EIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVAFIWKQMGTSCENLPQAHALIRAFNAVMRIAAP AVFFKSE AIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREWLLHQALTYRHNLPEHT AWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQY NPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLND DDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSNP RFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQ AMPFKAHDLIGG KTVSLNQDLTLQPYQVMWLEIA
Série SEQ ID NO : 2 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) I228Xi>
SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDroiARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAG1SAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREX2FPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGE MLFLANLGVDILRMDAVAFIWKQMGTSCENLPQAHALffiAFNAVMRIAAPAVFFKS EAWHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRPFVM FDGSFARGVPFQ YNPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLN DDDWSQDSN SDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSN PRFDGGRLX FNTNN HIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA Série SEQ ID NO : 3 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) F229X3
SPNSQYL TRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFP LM ELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIAREN PDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIX3PDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGE MLFLANLGVDILRMDAVAFIWKQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKS EAIVHPDQVVQYIGQDECQ1GYNPLQMALLWNTLATREVNLLHQALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFL RFFVNRFDGSFARGVPFQ YNPSTGDCRVSGTAAALVGLAQDDPHAVDR1 LLYSIALSTGGLPLIYLGDEVGTLN DDDWSQDSNKSDDSRWAHRPRY EALYAQR DPSTAAGQIYQDLRHMIAVRQS PRFDGGRLVTFNTNNKHIIGYIRN ALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA
SEQ ID NO : 4 : (Protéine = séquence mutée de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) Α289Χ^
S PN SQ Y L TR1 LDI YTPEQRAG IEKS EDWRQFSRRM DTHFPKLMNELDS V
YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKJPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVX4FIWKQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKS EATVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQ YNPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLN DDDWS QD SNKSDD SRW AHRPRYNE AL Y AQRNDP ST AAGQrYQDLRHMIA VRQ SN PRFDGGRLVTFNT WKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA Série SEQ ID NO : 5 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) F290X§)
SPN SQYLKTR I LDI YTPEQR AG 1 E S ED WRQFSRRM DTHFPK LMNE LOS V YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDID1ARENNPDWILSNKQVGGVCYV DLFAGDLKGLKD IPYFQELGLTYLHL PLF CPEG SDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVAX5IW QMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKS EAIVHPDQVVQYIGQDECQIGYNPLQMALL WTLATREVNLLHQ ALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQ YNPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLN DDDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSN PRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA
Série SEQ 1D NO : 6 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) V331X¾)
SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGNNE ALLPMLEMLL AQ AWQ SYS QRNS SLKDDDIARENNPD WILSNKQ VGG VC YV DLFAGDL GLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVOILRMDAVAFIW Q GTSCENLPQAHALIRAFNAVMRIAAPAVFF SE AIX6HPDQWQYIGQDECQIGYNPLQMALLAVNTLATREVNLLHQALTYRHNLPEHT AWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQY NPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLND DDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSNP RFDGGRLVTFNTNN HI1GYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIGG KTVSLNQDLTLQPYQVMWLEIA Série SEQ 1D NO : 7 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) D394X7J
SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDEDLARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVAFIWKQMGTSCENLPQ,A_HALIRAFNAV RIAAPAVFFKSE AWHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEHT AWVNYVRSHDX7IGWTFADEDAAYLGISGYDHRQFLNRFFWRFDGSFARGVPFQY NPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLND DDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSNP RFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIGG KT VS LNQDLTLQP YQ VMWLEI A
SEQ 1D NO : 8 ; (Protéine = séquence mutée de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) R446Q
SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIF HTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVAFIWKQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKSE
ArVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEHT AWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQY NPSTGDCQVSGTAAALVGLAQDDPHAVDRI LLYSIALSTGGLPLIYLGDEVGTLND DDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSNP RFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIGG KTVSLNQDLTLQPYQVMWLEIA Série SEQ ID NO : 9 : (Protéines = séquences doublement mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) A289P/F290X&
SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGN EALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYS PWVFRAMAGEM LFLANLGVDILRMDAVPXglWKQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKS EAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQ YNP STGDCRVS GT AAALVGLAQDDPH A VDRIKLLYS IALS TGGLPLIYLGDE VGTLN DDDWSQDSN SDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSN PRFDGGRLVTFNTN KHIIGYIR NALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA
SEQ ID NO : 10 : (Protéine — séquence mutée de la glucane-saccharase tronquée DSR-S vardelMN '- S512C)
TQQVSGKYVEKDGSWYYYFDDGKNAKGLSTIDNNIQYFYESG QAKG QYVTIDNQTYYFDKGSGDELTGLQSIDGNIVAFNDEGQQIFNQYYQSENGTTYYFD DKGHAATGIK IEGKNYYFDNLGQLKKGFSGVIDGQIMTFDQETGQEVSNTTSEIKE GLTTQNTDYSEHNAAHGTDAEDFENIDGYLTASSWYRPTGILPvNGTDWEPSTDTDF RPILS V WWPDK TQ VNYLNYM ADLGFISN ADSFETGD S Q S LLNE ASNY VQKS IEMK ISAQQSTEWLKDAMAAFIVAQPQWNETSEDMS DHLQNGALTYVNSPLTPDANSN FRLLNRTPTNQTGEQAYNLDNSKGGFELLLANQEDNSNVVVEAEQLNWLYYLMNF GTITA DADANFDGIRVDAVDNVDADLLQIAADYF LAYGVDQNDATANQHLSIL EDWSHNDPLYVTDQGSNQLTMDDYVHTQLIWSLTKSSDIRGTMQRFVDYYMVDR S DSTENEAIPNYSFVRAHDCEVQTVLAQrVSDLYPDVENSLAPTTEQLAAAFKVYN EDEKLADKKYTQYNMASAYAMLLTNKDTVPRVYYGDLYTDDGQYMAT SPYYD AINTLLI ARVQYVAGGQSMSVDSNDVLTSVRYGKDAMTASDTGTSETRTEGlGVrV SNNAELQLEDGHTVTLHMGAAHKNQAYRALLSTTADGLAYYDTDENAPVAYTDA NGDLIFTNESIYGVQNPQVSGYLAVWVPVGAQQDQDARTASDTTTNTSD VFHSN A LDSQVF EGFSNFQAFATDSSEYTNVVIAQNADQFKQWGVTSFQLAPQYRSSTD TSFLDSIIQNGYAFTDRYDLGYGTPTKYGTADQLRDAIKALHASGIQAIADWVPDQI YNLPEQELATVTRTNSFGDDDTDSDIDNALYWQSRGGGQYQEMYGGAFLEELQA LYPSLFKVNQISTGVPIDGSVKITEWAAKYFNGSNIQGKGAGYVLKDMGSNKYFKV VSNTEDGDYLPKQLTNDLSETGFTHDDKGIIYYTLSGYRAQNAFIQDDDNNYYYFD KTGHLVTGLQKIN HTYFFLPNGIELVKSFLQNEDGT YFDKKGHQVFDQYITDQN GNAYYFDDAGVMLKSGLATIDGHQQYFDQNGVQVKDKFVIGTDGYKYYFEPGSG NLAILRYVQNSKNQWFYFDGNGHAVTGFQTLNGKKQYFYNDGHQSKGEFIDADGD TFYTSATDGRLVTGVQKINGITYAFDNTGNLITNQYYQLADGKYMLLDDSGRAKT GFVLQDGVLRYFDQNGEQVKDAIIVDPDTNLS . SEQ 1D NO : 1 1 : (Protéine = séquence de lu glucane-saccharase a-1,2 BrS) MRQKETITRKKLYKSGKSWVAAATAFAVMGVSAVTTVSADTQTPVGT TQSQQDLTGQRGQDKPTTKEVIDKKEPVPQVSAQNAGDLSADAKTTKADDKQDTQ PTNAQLPDQGNKQTNSNSDKGVKESTTAPVKTTDVPSKSVTPETNTSINGGQYVEK DGQFVY1DQSGKQVSGLQNIEGHTQYFDPKTGYQTKGELKNIDDNAYYFDKNSGN GRTFTKISNGSYSEKDGMWQYVDSHDKQPVKGLYDVEGNLQYFDLSTGNQAKHQI RSVDGVTYYFDADSGNATAFKAVTNGRYAEQTTKDKDGNETSYWAYLDNQGNAI KGLNDVNGEIQYFDEHTGEQLKGHTATLDGTTYYFEG KGNLVSVVNTAPTGQYK INGDNVYYLDNN EAU GLYGINGNLNYFDLATGIQLKGQAKNIDGIGYYFDKDTG NGSYQYTLMAPSNKNDYTQHNVV NLSES FKNLVDGFLTAETWYRPAQILSHGT DWVASTDKDFRPLITVWWPNKDIQV YLRLMQNEGVLNQSAVYDLNTDQLLLNE AAQQAQIGIEKKISQTGNTDWLN VLFTTHDGQPSFIKQQYLWNSDSEYHTGPFQG GYLKYQNSDLTPNVNSKYRNADNSLDFLLANDVDNSNPIVQAEDLNWLYYLLNFG S ITTQGK ENN SN FD S 1 RI D A V D F V S N D L I QRT Y D Y LR AA Y G V DKN D F. AN AH LS L V E AGLDAGTTTIHQD ALIESDIREAMKKSLTNGPGSNISLSNLIQDKEGDKLIADRANNS TENVAIPNYSIIHAHDKDIQDKVGAAITDATGADWTNFTPEQLQKGLSLYYEDQRKI EKKYNQYNIPSAYALLLTNKDTVPRVYYGDMYQDDGQYMQKQSLYFDTITALME AR QFVAGGQTINVDDNGVLTSVRFGKGA TA DIGTNETRTQGIGVVIANDPSLK LSKDSKVTLHMG AAHRNQNYRALLLTTDNGIDS YS S SK AP VIKTDDNGDLVFSNQ DINDQLNTKVHGFLNSEVSGYLSAWVPLDATEQQDARTLPSEKSVNDG VLHSNA ALDSNLIYEAFSNFQPMPTNRNEYTWVL DKADTFKSWGITSFEMAPQYRSSQDKT FLDSTÎDNGYAFTDRYDLGFEKPTKYGNDEDLRQAIKQLHSSGMQVMADVVANQI YNLPGKEVASTNRVDW GN LSTPFGTQMYVVNTVGGGKYQ KYGGEFLDKLK AAYPDIFRSKOTEYDVKNYGGNGTGSVYYTVDSKTRAELDTDTKIKEWSAKYMN GTNVLGLGMGYVL DWQTGQYFNVSNQNMKFLLPSDLISNDITVQLGVPVTDKKII FDPASAYNMYSNLPEDMQVMDYQDDKKSTPSD PLSSYNNKQVQVTRQYTDSKGV SW LITFAGGDLQGQKLWVDSRALTMTPFKTMNQISFISYANRNDGLFLNAPYQVK GYQLAGMSNQYKGQQVTIAGVANVSGKDWSL1SFNGTQYWIDSQALNTNFTHDM NQKVFV TTSNLDGLFLNAPYRQPGYKLAGLAKNYNNQTVTVSQQYFDDQGTVW SQVVLGGQTVWVDNHALAQMQVRDTNQQLYVNSNGRNDGLFLNAPYRGQGSQLI GMTADYNGQHVQVTKQGQDAYGAQWRLITLNNQQVWVDSRALSTTIMQAMNDD MYVNSSQRTDGLWLNAPYTMSGAKWAGDTRSANGRYVHISKAYSNEVGNTYYLT NLNGQSTWIDKRAFTATFDQWALNATIVARQRPDGMFKTAPYGEAGAQFVDYVT N YNQQTVPVTKQH S DAQGNQ W YLAT VN GTQ Y WÏDQRS FS P VVTK VVDYQ AKI VP
RTTRDGVFSGAPYGEVNAKLV
NMATAYQNQVVHATGEYTNASGITWSQFALSGQEDKLWIDKRALQA
Série SEQ ID NO : 12 : (Protéine = séquence mutée de la glucane-saccharase AN123-GBD-CD2j (W403X9 ; F404X,,, ; A430X, , ; F431X12 ; et L434X13.)
MAHHHHHHVTSLYKKAGSAAAPFTMAQAGHYITKNGNDWQYDTNGE LAKGLRQDSNGKLRYFDLTTGIQAKGQFVTIGQETYYFSKDHGDAQLLPMVTEGH YGTITL QGQDTKTAWVYRDQNNTIL GLQNINGTLQFFDPYTGEQLKGGVAKYD DKLFYFESGKGNLVSTVAGDYQDGHYISQDGQTRYADKQNQLVKGLVTVNGALQ YFDNATGNQIKNQQVIVDGKTYYFDDKGNGEYLFTNTLDMSTNAFSTKNVAFNHD SSSFDHTVDGFLTADTWYRPKSILANGTTWRDSTDKDMRPLITVWWPNKNVQVNY LNFMKANGLLTTAAQYTLHSDQYDLNQAAQDVQVAIERRIASEHGTDWLQ LLFE SQNNNPSFVKQQFIWNKDSEYHGGGDAX9X10QGGYLKYGNNPLTPTTNSDYRQPG NXnX12DFX13LANDVDNS PVVQAENLNWLHYLMNFGTITAGQDDANFDSIRIDAV DFIHNDTIQRTYDYLRDAYQVQQSEAKANQHISLVEAGLDAGTSTIHNDALIESNLR EAATLSLTNEPGKNKPLTNMLQDVDGGTLITDHTQNSTENQATPNYSIIHAHDKGV QEKVGAAITDATGADWTNFTDEQLKAGLELFY DQRATNKKYNSYNIPSrYALML TNKDTVPRMYYGDMYQDDGQYMAK SIYYDALVSLMTAR SYVSGGQTMSVDN HGLL SVRFGKDAMTA DLGTSATRTEGLGVIIGNDPKLQLNDSDKVTLDMGAAH KNQKYRAVILTTRDGLATFNSDQAPTAWTNDQGTLTFSNQEINGQDNTQIRGVANP QVSGYLAVWVPVGASDNQDARTAATTTENHDGKVLHSNAALDSNL1YEGFSNFQP ATTHDELTNVVIAKNADVFNNWGITSFEMAPQYRSSGDHTFLDSTIDNGYAFTDR YDLGFNTPTKYGTDGDLRATIQALHHA MQVMADVVDNQVYNLPGKEWSATRA GWGNDDATGFGTQLYVTNSVGGGQYQEKYAGQYLEALKAKYPDLFEGKAYDY WY NYANDGSNPYYTLSHGDRESIPADVAI QWSAK\'MNGTNVLGNGMGYVLK. DWHNGQYFKLDGDKSTLPKGGRADPAFLYKVVSAWSHPQFEK
Série SEQ 1D NO : 13 : (Protéine = séquence mutée de la glucane-sacchamse ANj23-GBD-CD2 (F431I ; D432E et L434L)
MAHHHHHHVTSLYKI GSAAAPFTMAQAGHYITKNGNDWQYDTNGE LAKGLRQDSNGKLRYFDLTTGIQAKGQFVTIGQETYYFSKDHGDAQLLPMVTEGH YGTITLKQGQDTKTAWVYRDQNNTIL GLQNINGTLQFFDPYTGEQLKGGVAKYD DKLFYFESGKGNLVSTVAGDYQDGHYISQDGQTRYADKQNQLVKGLVTVNGALQ YFDNATGNQIKNQQVrVDGKTYYFDDKGNGEYLFTNTLDMSTNAFSTKNVAFNHD SSSFDHTVDGFLTADTWYRPKSILANGTTWRDSTDKDMRPLITVWWPNKNVQVNY LNFMKANGLLTTAAQYTLHSDQYDLNQAAQDVQVAIERRIASEHGTDWLQKLLFE SQNNNPSFVKQQFIWNKDSEYHGGGDAWFQGGYLKYGNNPLTPTTNSDYRQPGN AIEFILANDVDNSNPVVQAENLN LHYLMNFGTITAGQDDANFDSIRIDAVDFIHND TIQRTYDYLRDAYQVQQSEAKANQHISLVEAGLDAGTSTUiNDALIESNLREAATLS LTNEPGKNKPLTNMLQDVDGGTLITDHTQNSTENQATPNYSIIHAHDKGVQEKVGA
A[TDATGADWTNFTDEQLKAGLELFYKDQRATNK.KYNSYNIPS1YAL LTNKDTVP RMYYGDMYQDDGQYMANKSIYYDALVSLMTARKSYVSGGQTMSVDNHGLLKSV RFGKDAMTANDLGTSATRTEGLGVIIGNDPKLQLNDSDKVTLDMGAAHKNQ YR AVILrrRDGLATFNSDQAPTAWTNDQGTLTFS QEINGQDNTQIRGVANPQVSGYL AVWVPVGASDNQDARTAATTTENHDGKVLHSNAALDSNLIYEGFSNFQPKATTHD ELTNVVIAKNADVFNNWGrrSFEMAPQYRSSGDHTFLDSTIDNGYAFTDRYDLGFN TPTKYGTDGDLRATIQALHHANMQVMADVVDNQVYNLPGKEVVSATRAGVYGN DDATGFGTQLYVTNSVGGGQYQEKYAGQYLEALKAKYPDLFEGKAYDYWYKNY ANDGSNPYYTLSHGDRESIPADVAIKQWSAKYMNGTNVLGNGMGYVLKDWHNG QYFKLDGDKSTLPKGGRADPAFLYKVVSAWSHPQFEK

Claims

REVENDICATIONS
1. Procédé de fabrication de dérivés de flavonoïde O-α-glucosylés comprenant au moins une étape d'incubation d'une glucane-saccharase avec un flavonoïde et au moins un saccharose, dans lequel:
(A) ledit flavonoïde est de formule (I) suivante :
dans laquelle
le cycle C représente un cycle choisi dans le groupe constitué des cycles de formule (II), (III). (IV) ou (V) suivantes :
(II)
(IV) (V)
dans lesquels l'un des groupements R1, R2 ou R3 représente un cycle B de formule (VI) suivante :
dans lequel :
(a) un seul des groupements choisi parmi R8, R9, R10, Ru et R! 2 représente un groupement hydroxyle,
les autres groupements parmi R8, R9, Rio, Ru et R12. identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou S : un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C1-C3 ; une imine en Q-C3 ; un groupement nitrile ; un halogénoalkyle en d-C3 ; un thioalkyle en C1-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou
(b) R8 et un seul des groupements choisis parmi R10, Ru et Ri2 représentent un groupement hydroxyle.
R9 et les autres groupements parmi Rio, Ru et Ri2, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydroearboné en C1-C10 linéaire ou ramifié, saturé ou in saturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou S ; un atonie d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acylc en C2-C3 ; un alcool en d-C3 ; un groupement -COOH ; -N¾ ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une amine en 1 -C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3; un groupement -C(W) ; et un groupement --O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou
(c) Ry et un seul des groupements choisis parmi Ru et Ri représentent un groupement hydroxyle,
les groupements Rs, Rio, et l'autre groupement parmi R, , et R12 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en Ci -Cm linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétéroeyele en C4-Cy ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C]-C3 ; une imine en C1 -C3 ; un groupement nitrile ; un halogénoalkyle en Ci-C3 ; un thioalkyle en C 1 -C3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou
(d) Rio et R12 représentent un groupement hydroxy.
les groupements Rs, R<>, et Ru , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétéroeyele en C4-Cg ; un groupement (C[-C3)alcoxy ; un acyle en C2-C3 ; un alcool en Q-C3 ; un groupement - COOH ; -NH2 ; -CONH2 ; -CHO ;-SH ; -C(0)0(C2-C3) ; une aminé en C1-C3 ; une imine en C 1 -C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en Ci-C3; un groupement -C( W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou
(e) Rg, Rio et R12 représentent un groupement hydroxy.
les groupements R9 et Ru, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou S : un atome d'halogène ; un aryle en C5-C9 ; un hétéroeyele en C4-C9 ; un groupement (Ci~C3)alcoxy ; un acyle en C2-C3 ; un alcool en Ci-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C1-C3 ; une imine en Ci-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en CrC3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
les groupements R1} R2 et R3 qui ne représentent pas un cycle B de formule (VI), identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un alkyle en Ci-C6, linéaire ou ramifié ; un groupement -OH ; une aminé en C]-C3 ; un groupement -COOH ; -C(0)0(C2-C3) ; un groupement -C(W) ; et un groupement -O(VV) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
Ri', R2' et R3', identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en Ci -Cm linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou
5 ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-CN)alcoxy ; un acyle en C2-C3 ; un alcool en Ci-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C2-C3 ; une aminé en C1-C3 ; une imine en C 1-C3 ; un groupement nitrile ; un halogénoalkyle en Ci-C3 ; un thioalkyle en C)-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
ou les groupements R1 et R ' lorsque Rj ne représente pas un cycle B de formule (VI). ou R2 et R2' lorsque R2 ne représente pas un cycle B de formule (VI), ou R3 et R3' lorsque R3 ne représente pas un cycle B de formule (VI). forment ensemble un groupement =0;
R4, R5, R<, et R ;. identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en CrC10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -OH ; -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C1-Q ; une imine en Ci-C ; un groupement nitrile ; un halogénoalkyle en C] -C3 ; un thioalkyle en C1-C3 ; un groupement -C( W) ; et un groupement— 0( W) ; W représentant une chaîne constituée de 1 à
6 glycoside(s) ; (B) ladite glucane-saecharase étant choisie dans le groupe comprenant :
- une séquence ayant au moins 80 % d'identité avec la SEQ JD NO : 1 , ladite séquence ayant un acide aminé X] représentant un acide aminé choisi dans le groupe constitué de A, C. E, F, G, H, I, K, M, N, P, Q, S, T, V et Y;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X2 représentant un acide aminé choisi dans le groupe constitué de A, C, D, F, G, H, K, L, M, N, P, S, V et Y ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X3 représentant un acide aminé choisi dans le groupe constitué de A, C, G, I, K, M, N et W ;
- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO : 4, ladite séquence ayant un acide aminé X4 représentant un acide aminé choisi dans le groupe constitué de C, I, N, P. V et W ;
- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO : 5, ladite séquence ayant un acide aminé X5 représentant un acide aminé choisi dans le groupe constitué de A, C. D, G, I, K. L, M, R, V et W ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 6, ladite séquence ayant un acide aminé X6 représentant un acide aminé choisi dans le groupe constitué de C, G, Q, S et T ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 7, ladite séquence ayant un acide aminé X7 représentant un acide aminé choisi dans le groupe constitué de A et G ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 8 ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé X8 représentant un acide aminé choisi dans le groupe constitué de C. 1 et L ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 10 ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 1 : et
- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 1 2. ladite séquence ayant des acides aminés X9, X10, X11, X12 et X13, avec :
(i) XQ représentant, indépendamment de X10, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de G, S, V, C, F, N, I, L et W ; X10 représentant, indépendamment de X X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, 1. H, Y et F ;
à l'exception du cas où Xc, représente W et X10 représente F ;
X11 représentant A ;
X12 représentant F ; et
X11 représentant L ;
(ii) X9 représentant W ;
X10 représentant F;
X11 représentant, indépendamment de X9, Χκ,, X12 et X11, un acide aminé choisi dans le groupe constitué de E et A ;
X12 représentant, indépendamment de Xc,, X10, X11 et X13, un acide aminé choisi dans le groupe constitué de L et F ; et
X13 représentant L ;
à l'exception du cas où X11 représente A et Xj2 représente F ;
ou
(iii) Xg représentant W ;
X i d représentant F ;
X11 représentant A ;
X12 représentant, indépendamment de X9, X10, X11 et X13, un acide aminé choisi dans la liste constituée de A, R, D. N, C, E, Q, G. H, I, L, K, M, P, S. T, W. Y et V ; et
X13 représentant, indépendamment de X9, X10, X11 et X , un acide aminé choisi dans la liste constituée de A. R, D. N, C, E, Q, G. H, I, K, M. F. P, S. T, W, Y et V.
2. Procédé selon la revendication 1 , dans lequel un seul des groupements choisi parmi R,s. R9, R1o, Rn et R12, de préférence R1o, représente un groupement hydroxyle,
les autres groupements parmi R8, R9, R]0. Rn et R!2, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en Ci -Cm linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hetéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétéroeyele en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CON¾ ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C1-C3 ; une imine en C1 -C3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C3 ; et un thioalkyle en C1-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;
les groupements R8, R9, Ru et Rn représentant de préférence des atomes d'hydrogène.
3. Procédé selon la revendication 2, dans lequel Rm représente un groupement hydroxyle et R8, R9, Ru et R12 représentent des atomes d'hydrogène.
4. Procédé selon la revendication 1, dans lequel :
R8 et un seul des groupements choisis parmi R1o, Ru et R12, de préférence R1o, représentent un groupement hydroxyle,
R() et les autres groupements parmi R1o, Ru et R12, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; ~CON¾ ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C 1 -C3 ; une iminc en C1-C3 ; un groupement nitrile ; un halogénoalkyle en Ci-C3 ; un thioalkyle en Ci-C3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s).
5. Procédé selon la revendication 4, dans lequel R1o représente un groupement hydroxyle et R9, Ru et R12 représentent des atomes d'hydrogène.
6. Procédé selon l'une quelconque des revendications précédentes, dans lequel le cycle C représente un cycle de formule (II) ou (IV) telles que définies en revendication 1.
7. Procédé selon l'une quelconque des revendications précédentes, dans lequel R1 représente un cycle B de formule (VI) telle que définie en revendication 1.
8. Procédé selon l'une quelconque des revendications précédentes, dans lequel R1' et R2' représentent des atomes d'hydrogène, R2 représente un atome d'hydrogène ou un groupement -OH, et R3 et R3' forment ensemble un groupement =0.
9. Procédé selon l'une quelconque des revendications précédentes, dans lequel deux des groupements R4. R5, R,, et R7. de préférence R4 et R(1. représentent un groupement hydroxyle, les deux autres groupements étant tels que définis en revendication 1.
10. Procédé selon l'une quelconque des revendications précédentes, dans lequel R5 et R? représentent des atomes d'hydrogène.
1 1 . Procédé selon l'une quelconque des revendications précédentes, dans lequel ledit flavonoïde est de formule (VII). (VIII) ou ( IX) suivantes :
12. Procédé selon l'une quelconque des revendications précédentes, dans lequel la glucane-saecharase est choisie dans le groupe comprenant :
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 , ladite séquence ayant un acide aminé X1 représentant un acide aminé choisi dans le groupe constitué de H, N ou S ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X2 représentant un acide aminé choisi dans le groupe constitué de A. C, F, L, M, S ou V ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X3 représentant une acide aminé choisi dans le groupe constitué de A et N ;
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 4, ladite séquence ayant un acide aminé X4 représentant une acide aminé choisi dans le groupe constitué de C. I. N, P. V ou W ; - une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 5, ladite séquence ayant un acide aminé X5 représentant un acide aminé choisi dans le groupe constitué de C, . R ou V :
- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé X8 représentant un acide aminé choisi dans le groupe constitué de C ou L ; et
- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés XQ, XJ O, XH, X12 et X13, avec :
(i) X9 représentant un acide aminé choisi dans le groupe constitué de G, V, C et F ;
X10 représentant F ; X11 représentant A ; X12 représentant F ; et X13 représentant
L ;
(ii) X9 représentant, indépendamment de X10, X1 1 , X12 et X,3. un acide aminé choisi dans le groupe constitué de S, N, L et I ;
X10 représentant, indépendamment de X». X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, I, H et Y ;
X11 représentant A ; X!2 représentant F ; et X13 représentant L ;
(iii) X9 représentant W ; X10 représentant F ; X11 représentant A ou E ; X12 représentant L ; et X13 représentant L ; ou
ladite séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12 est la séquence SEQ ID NO : 1 3.
1 3. Dérivé de flavonoïde Ο-α-glycosylé obtenu par le procédé tel que défini dans l'une quelconque des revendications 1 à 12, dans lequel :
le cycle C représente le cycle de formule (IV) dans lequel le groupement R, représente un cycle B de formule (VI) ; et
au moins le cycle B est O-α-glycosylé.
14. Composé de formule (X) suivante
dans laquelleX représente une chaîne constituée d'au moins deux groupements α-glucoside, et X15 et X1(„ identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène : un alkyle en Ci-C(„ linéaire ou ramifié ; un groupement -C(0)0(C2-C3) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside.
15. Composé de formule XI) suivante :
dans laquelle
X17 représente une chaîne constituée de 1 à 600.000 groupements α-glucoside, et X18 et X19, identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène ; un alkyle en Ci-C6, linéaire ou ramifié ; un groupement -C(0)0(C2-C3) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside.
1 6. Utilisation cosmétique, à titre d'agent antioxydant, d'au moins un dérivé de flavonoïde Ο-α-glycosylé tel que défini dans l'une des revendications 14 et 15.
1 7. Dérivé de flavonoïde O-α-glycosylé tel que défini dans l'une des revendications 14 et 15, pour son utilisation pharmaceutique dans le traitement et/ou la prévention de l'hépatotoxicité, des allergies, de l'inflammation, des ulcères, des tumeurs, des troubles ménopausiques, ou des maladies neurodégénératives.
18. Dérive de flavonoïde Ο-α-glycosylé tel que défini dans l'une des revendications 14 et 15, pour son utilisation pharmaceutique à titre de veinotonique.
19. Utilisation d'un dérivé de flavonoïde O-α-glycosylé tel que défini dans l'une des revendications 14 et 1 5, à titre d'agent photovoltaïque, d'agent répulsif des insectes, d'agent de blanchiment, d'agent pesticide, fongicide et/ou bactéricide.
EP15714775.2A 2014-03-24 2015-03-24 Nouveaux flavonoïdes o-alpha-glucosylés sur le cycle b, procédé d'obtention et utilisations Withdrawn EP3122890A1 (fr)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
FR1452461A FR3018821A1 (fr) 2014-03-24 2014-03-24 Nouveaux flavonoides o-alpha-glucosyles sur le cycle b, procede d'obtention et utilisations
FR1456417A FR3018822B1 (fr) 2014-03-24 2014-07-03 Nouveaux flavonoides o-alpha-glucosyles sur le cycle b, procede d'obtention et utilisations
PCT/EP2015/056307 WO2015144731A1 (fr) 2014-03-24 2015-03-24 NOUVEAUX FLAVONOÏDES O-α-GLUCOSYLÉS SUR LE CYCLE B, PROCÉDÉ D'OBTENTION ET UTILISATIONS

Publications (1)

Publication Number Publication Date
EP3122890A1 true EP3122890A1 (fr) 2017-02-01

Family

ID=51225663

Family Applications (1)

Application Number Title Priority Date Filing Date
EP15714775.2A Withdrawn EP3122890A1 (fr) 2014-03-24 2015-03-24 Nouveaux flavonoïdes o-alpha-glucosylés sur le cycle b, procédé d'obtention et utilisations

Country Status (4)

Country Link
US (1) US10647739B2 (fr)
EP (1) EP3122890A1 (fr)
FR (2) FR3018821A1 (fr)
WO (1) WO2015144731A1 (fr)

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106565654B (zh) * 2016-10-14 2018-08-31 云南中烟工业有限责任公司 一种从白云参中提取的新型黄酮类化合物、其制备方法及其用途
CN107382938B (zh) * 2017-07-26 2020-09-22 云南中烟工业有限责任公司 一种能改善卷烟抽吸喉部舒适性的黄酮类化合物及其制备方法与应用
CN107721961B (zh) * 2017-09-07 2020-08-25 云南中烟工业有限责任公司 一种从芦荟中提取的黄酮类化合物及其制备方法和应用
CN107759552B (zh) * 2017-09-07 2020-08-25 云南中烟工业有限责任公司 一种具有抗氧化活性的黄酮类化合物及其制备方法和应用
CN107721960B (zh) * 2017-09-07 2020-08-25 云南中烟工业有限责任公司 一种从山楂中提取的黄酮类化合物及其制备方法和应用
CN107778275B (zh) * 2017-10-18 2020-08-25 云南中烟工业有限责任公司 一种从玫瑰废渣中提取的异黄酮类化合物及其制备方法和应用
CN107759554B (zh) * 2017-10-18 2020-08-25 云南中烟工业有限责任公司 一种羟丙基异黄酮类化合物及其制备方法和应用
CN107903234B (zh) * 2017-10-18 2020-08-25 云南中烟工业有限责任公司 一种从木瓜中提取的异黄酮类化合物及其制备方法和应用
KR102105412B1 (ko) * 2018-06-20 2020-04-29 한국원자력연구원 항암 활성을 갖는 크로만 화합물 및 이를 유효성분으로 포함하는 암 예방 및 치료용 약학 조성물
CN109456292B (zh) * 2018-10-23 2022-06-10 中山大学 一种海洋真菌来源的香豆素类化合物及其制备方法与应用
CN110205351A (zh) * 2019-05-23 2019-09-06 广东金骏康生物技术有限公司 一种糖基化柚皮素的制备方法及其应用
CN112410321B (zh) * 2020-11-26 2022-01-28 昆明理工大学 一种β-葡萄糖苷酶Ttbgl3及其应用
CN114807159B (zh) * 2021-12-23 2023-09-29 西藏自治区农牧科学院农业研究所 一种与耐旱性相关的c-糖基黄酮代谢基因及其用途
CN115478026B (zh) * 2022-06-29 2023-07-04 中南大学 一种耐辐射球菌及其应用
US20250255332A1 (en) * 2022-08-23 2025-08-14 Givaudan Sa Compositions comprising aromadendrin 3-acetate
WO2025198996A1 (fr) * 2024-03-19 2025-09-25 Danisco Us Inc. Procédé d'amélioration du goût dans un produit alimentaire

Family Cites Families (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH11225840A (ja) 1998-02-12 1999-08-24 Miyagen:Kk 管脚ノンスリップカバー、およびその製造法
JP2001046096A (ja) * 1999-08-09 2001-02-20 Lotte Co Ltd α−グルコシダーゼによる配糖体の製造方法及び新規なα−グルコシダーゼ並びにその製造方法
JP4947608B2 (ja) 2000-06-05 2012-06-06 株式会社コシイプレザービング フラボノイド誘導体の抽出方法
JP2003104818A (ja) 2001-07-26 2003-04-09 Nippon Fine Chem Co Ltd フラボノイド配糖体を含有する害虫防除剤
JP2007530607A (ja) 2004-03-30 2007-11-01 ユニリーバー・ナームローゼ・ベンノートシヤープ ビタミンおよびフラボノイドを含むスキンライトニング組成物
KR100716797B1 (ko) * 2004-12-03 2007-05-14 전남대학교산학협력단 당전이 효소를 이용한 당전이 화합물의 유도체 제조방법 및 이로부터 제조된 유도체
US20100227826A1 (en) 2005-12-07 2010-09-09 Mercier Michel F Stable Flavonoid Solutions
EP1867729A1 (fr) 2006-06-14 2007-12-19 Libragen Derivés phénoliques solubles dans l'eau avec des utilisations thérapeutiques et dermocosmetiques
CN100569077C (zh) 2007-01-24 2009-12-16 四川大学 一种狼毒黄酮混配杀虫剂及其制备方法
KR20100015996A (ko) * 2007-04-09 2010-02-12 가부시끼가이샤 하야시바라 세이부쓰 가가꾸 겐꾸조 에쿠올류를 유효 성분으로 함유하는 미백제
TW200915583A (en) 2007-09-17 2009-04-01 Univ Nat Taiwan Science Tech Photoelectric electrodes capable of absorbing solar energy, fabrication methods, and applications thereof
EP2100966A1 (fr) 2008-03-12 2009-09-16 Institut Pasteur Mutants de glycoside hydrolases et leurs utilisations dans la synthèse d'oligosaccharides complexes et disaccharides intermédiaires
CN102477024A (zh) 2010-11-26 2012-05-30 西北农林科技大学农药研究所 一类用于防治植物病害的黄酮化合物
MX2011010032A (es) 2011-09-23 2013-03-25 Promotora Tecnica Ind S A De C V Plaguicida a base de alcaloides isoquinolicos, flavonoides, aceites vegetales y/o esenciales.

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
GERWIN H. MEULENBELD ET AL: "Transglycosylation byStreptococcus mutans GS-5 glucosyltransferase-D: Acceptor specificity and engineering of reaction conditions", BIOTECHNOLOGY AND BIOENGINEERING, vol. 70, no. 4, 1 January 2000 (2000-01-01), pages 363 - 369, XP055589722, ISSN: 0006-3592, DOI: 10.1002/1097-0290(20001120)70:4<363::AID-BIT1>3.0.CO;2-2 *
See also references of WO2015144731A1 *
TAKUMI AKIYAMA ET AL: "Naringin Glycosides [alpha]-Glucosylated on Ring B Found in the Natural Food Additive, Enzymatically Modified Naringin", BIOSCIENCE, BIOTECHNOLOGY, AND BIOCHEMISTRY, vol. 64, no. 10, 1 January 2000 (2000-01-01), pages 2246 - 2249, XP055145111, ISSN: 0916-8451, DOI: 10.1271/bbb.64.2246 *

Also Published As

Publication number Publication date
FR3018822B1 (fr) 2018-03-23
WO2015144731A1 (fr) 2015-10-01
FR3018822A1 (fr) 2015-09-25
FR3018821A1 (fr) 2015-09-25
US20170107242A1 (en) 2017-04-20
US10647739B2 (en) 2020-05-12

Similar Documents

Publication Publication Date Title
WO2015144731A1 (fr) NOUVEAUX FLAVONOÏDES O-α-GLUCOSYLÉS SUR LE CYCLE B, PROCÉDÉ D&#39;OBTENTION ET UTILISATIONS
CA2378562C (fr) Procede de production d&#39;oligosaccharides
Tzeng et al. KpsF is the arabinose-5-phosphate isomerase required for 3-deoxy-D-manno-octulosonic acid biosynthesis and for both lipooligosaccharide assembly and capsular polysaccharide expression in Neisseria meningitidis
EP2859112A1 (fr) Procédé de production d&#39;oligosaccharides et d&#39;oligosaccharide glycosides par fermentation
US12404294B2 (en) Glycolipopeptide biosurfactants
Nolte et al. Glycosylation of caffeic acid and structural analogues catalyzed by novel glucansucrases from Leuconostoc and Weissella species
EP4149957B1 (fr) Souches bactériennes et procédé de production d&#39;oligosaccharides
Park et al. Enzymatic synthesis of piceid glucosides using maltosyltransferase from Caldicellulosiruptor bescii DSM 6725
EP4176072A1 (fr) Procédé de preparation de polyglucosides d&#39;alkyle et polyglucosides d&#39;alkyle obtenus selon le procédé
JP5314955B2 (ja) 新規微生物、イヌリナーゼ、イヌリン分解剤、イヌロオリゴ糖の製造方法及びイヌリナーゼの製造方法
Wieneke et al. Structural and functional characterization of galactooligosaccharides in Nostoc commune: β-d-galactofuranosyl-(1→ 6)-[β-d-galactofuranosyl-(1→ 6)] 2-β-d-1, 4-anhydrogalactitol and β-(1→ 6)-galactofuranosylated homologues
EP3271469A1 (fr) Production de synthons glycosyles par voie enzymatique
CN112010924A (zh) 新型诺西肽糖基化衍生物及其制备方法和应用
WO2024121244A1 (fr) Nouveaux cannabinoïdes-oligosaccharides
Shim et al. Enzymatic preparation of phenolic glucosides by Streptococcus mutans
Kang et al. Efficient biosynthesis of naringenin-ɑ-maltoside by amylosucrase obtained from Deinococcus planocerae
KR101434602B1 (ko) 미생물 변이체를 이용한 케르세틴에서 3―o―자일로실 케르세틴을 제조하는 방법
JP6156947B2 (ja) 配糖体の製造方法
JP2019216633A (ja) 配糖体の製造方法
JP2011051933A (ja) α−グリコシルアントシアニン
KR20160052106A (ko) 수용성 강화 페놀화합물 유도체 및 이의 제조방법
KR101414724B1 (ko) 당전이 효소를 이용한 안사마이신 배당체의 제조방법
Uchida et al. Formation of 3′-O-β-Galactosyl Compounds of 5-Bromouridine by Sporobolomyces singularis
TW202421109A (zh) 芒果苷醣苷及其製備方法
Nolte et al. Comparative analysis of non-natural acceptor glucosylation with sucrase enzymes of family GH 70

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20161024

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20190523

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE

Owner name: INSTITUT NATIONAL DES SCIENCES APPLIQUEES DE TOULOUSE

Owner name: INSTITUT NATIONAL DE RECHERCHE POUR L'AGRICULTURE, L'ALIMENTATION ET L'ENVIRONNEMENT

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20240530