EP1264840B1 - Peptides hybrides inhibiteurs à action prolongée des infections virales - Google Patents
Peptides hybrides inhibiteurs à action prolongée des infections virales Download PDFInfo
- Publication number
- EP1264840B1 EP1264840B1 EP02014617A EP02014617A EP1264840B1 EP 1264840 B1 EP1264840 B1 EP 1264840B1 EP 02014617 A EP02014617 A EP 02014617A EP 02014617 A EP02014617 A EP 02014617A EP 1264840 B1 EP1264840 B1 EP 1264840B1
- Authority
- EP
- European Patent Office
- Prior art keywords
- fmoc
- peptide
- tbu
- seq
- peptides
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
- C12N2740/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- This invention relates to modified peptides that are inhibitors of viral activity and exhibit antifusogenic properties.
- this invention relates to modified peptide inhibitors of human immunodeficiency virus (HIV), respiratory syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV), and simian immunodeficiency virus (SIV) with long duration of action for the treatment of the respective viral infections.
- HCV human immunodeficiency virus
- RSV respiratory syncytial virus
- HPV human parainfluenza virus
- MeV measles virus
- SIV simian immunodeficiency virus
- which modified peptides are conjugated to endogenous carrier.
- the invention relates to conjugates of the modified peptides and serum albumin.
- Membrane fusion events, while commonplace in normal cell biological processes, are also involved in a variety of disease states, including, for example the entry of enveloped viruses into cells.
- Peptides are known that inhibit or otherwise disrupt membrane fusion-associated events, including, for example, inhibiting retroviral transmission to uninfected cells.
- the synthetic peptide DP-107 and DP-178 derived from separate domains within the human immunodeficiency virus type I ("HIV-1") transmembrane ("TM”) glycoprotein gp41 are potent inhibitors of HIV-1 infection and HIV induced cell-cell fusion.
- a computer searching strategy (computerized antiviral searching technology, C.A.S.T.) based on the predicted secondary structure of DP-107 and DP-178 (T-20), Lambert, et al. identified conserved heptad repeat domains analogous to the DP-107 and DP-178 regions of HIV-1 gp41 within the glycoproteins of other fusogenic viruses.
- Antiviral peptides derived from three representative paramyxoviruses, respiratory syncytial virus (RSV), human parainfluenza virus type 3 (HPIV-3), and measles virus (MV) blocked homologous virus-mediated syncytium formation and exhibited EC 50 values in the range 0.015-0.250 ⁇ M. Moreover, these peptides were highly selective for the virus of origin.
- the present invention meets these and other needs and relates to a conjugate comprising a modified peptide having anti-viral activity and anti-fusogenic activity.
- modified peptides provide for an increased stability in vivo and a reduced susceptibility to peptidase or protease degradation. These modified peptides thereby minimize, e.g., the need for more frequent, or even continual, administration of the peptides.
- the products of varying embodiments of the present invention can be used, e.g., as a prophylactic against and/or treatment for infection of a number of viruses, including human immunodeficiency virus (HIV), human respiratory syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV) and simian immunodeficiency virus (SIV).
- viruses including human immunodeficiency virus (HIV), human respiratory syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV) and simian immunodeficiency virus (SIV).
- HCV human immunodeficiency virus
- RSV human respiratory syncytial virus
- HPV human parainfluenza virus
- MeV measles virus
- SIV simian immunodeficiency virus
- Modification of other peptides involved in viral transfection e.g., Hepatitis, Epstein Barr and other related viruses
- This invention relates to chemically reactive modifications of peptides exhibiting anti-viral and anti-fusogenic activity such that the modified peptides react with available functionalities on blood components to form stable covalent bonds.
- the reactive group is a maleimide which is reactive with thiol group on a mobile blood protein which is albumin.
- the invention provides an antifusogenic conjugate comprising serum albumin and a modified anti-viral peptide, the modified anti-viral peptide comprising a peptide that exhibits anti-viral and antifusogenic activity and a maleimide group coupled thereto either without using a linking group or via a linking group which is (2-amino) ethoxyacetic acid (AEA) or [2-(2-amino)ethoxy]ethoxyacetic acid (AEEA), the modified antiviral peptide being covalently bonded via the maleimide group to a thiol group on the serum albumin.
- AEA (2-amino) ethoxyacetic acid
- AEEA [2-(2-amino)ethoxy]ethoxyacetic acid
- the invention relates to such chemically reactive modifications where the peptide is DP 107 or DP 178 or analogs thereof, including peptides comprised of amino acid sequences from other (non-HIV) viruses that correspond to the gp41 region of HIV from which DP 107 and DP 178 are derived and that exhibit anti-viral or anti-fusogenic activity. More particularly, these peptides preferably exhibit anti-viral activity against, among other, human immunodeficiency virus (HIV), human respiratory syncytial virus (RSV), human parainfluenza virus (HPV), measles virus (MeV) and simian immunodeficiency virus (SIV).
- HCV human immunodeficiency virus
- RSV human respiratory syncytial virus
- HPV human parainfluenza virus
- MeV measles virus
- SIV simian immunodeficiency virus
- the invention also relates to such chemically reactive modifications of the peptides of SEQ ID NO: 1 to SEQ ID NO: 86.
- peptides selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 9, SEQ ID NO: 10 to SEQ ID NO: 30, SEQ ID NO: 31 to SEQ ID NO: 62, SEQ ID NO: 63 to SEQ ID NO: 73 or SEQ ID NO: 74 to SEQ ID NO: 86.
- the invention also relates to compositions for use in the prevention and/or treatment of viral infection comprising a conjugate of a peptide as described above. More particularly, the invention relates to such compositions for use in the prevention and/or treatment of acquired immune deficiency syndrome (AIDS).
- AIDS acquired immune deficiency syndrome
- RSV human respiratory syncytial virus
- HPV human parainfluenza virus
- MeV measles virus
- SIV simian immunodeficiency virus
- Anti-viral peptides shall refer to peptides that inhibit viral infection of cells, by, for example, inhibiting cell-cell fusion or free virus infection.
- the route of infection may involve membrane fusion, as occurs in the case of enveloped viruses, or some other fusion event involving viral and cellular structures.
- Peptides that inhibit viral infection by a particular virus may be referenced with respect to that particular virus, e.g., anti-HIV peptide, anti-RSV peptide, etc.
- Antifusogenic peptides are peptides demonstrating an ability to inhibit or reduce the level of membrane fusion events between two or more entities, e.g., virus-cell or cell-cell, relative to the level of membrane fusion that occurs in the absence of the peptide.
- HIV and anti-HIV peptides The human immunodeficiency virus (HIV), which is responsible for acquired immune deficiency syndrome (AIDS), is a member of the lentivirus family of retroviruses. There are two prevalent types of HIV, HIV-1 and HIV-2, with various strain of each having been identified. HIV targets CD-4+ cells, and viral entry depends on binding of the HIV protein gp41 to CD-4+ cell surface receptors.
- Anti-HIV peptides refer to peptides that exhibit anti-viral activity against HIV, including inhibiting CD-4+ cell infection by free virus and/or inhibiting HIV-induced syncytia formation between infected and uninfected CD-4+ cells.
- SIV and anti-SIV peptides Simian immunodeficiency viruses (SIV) are lentiviruses that cause acquired immunodeficiency syndrome (AIDS)-like illnesses in susceptible monkeys.
- Anti-SIV peptides are peptides that exhibit anti-viral activity against SIV, including inhibiting of infection of cells by the SIV virus and inhibiting syncytia formation between infected and uninfected cells.
- RSV and anti-RSV peptides Respiratory syncytial virus (RSV) is a respiratory pathogen, especially dangerous in infants and small children where it can cause bronchiolitis (inflammation of the small air passages) and pneumonia.
- RSVs are negative sense, single stranded RNA viruses and are members of the Paramyxoviridae family of viruses. The route of infection of RSV is typically through the mucous membranes by the respiratory tract, i.e., nose, throat, windpipe and bronchi and bronchioles.
- Anti-RSV peptides are peptides that exhibit anti-viral activity against RSV, including inhibiting mucous membrane cell infection by free RSV virus and syncytia formation between infection and uninfected cells.
- HPV and anti-HPV peptides Human parainfluenza virus (HPIV or HPV), like RSV, is another leading cause of respiratory tract disease, and like RSVs, are negative sense, single stranded RNA viruses that are members of the Paramyxoviridae family of viruses. There are four recognized serotypes of HPIV -- HPIV-1, HPIV-2, HPIV-3 and HPIV-4. HPIV-1 is the leading cause of croup in children, and both HPIV-1 and HPIV-2 cause upper and lower respiratory tract illnesses. HPIV-3 is more often associated with bronchiolitis and pneumonia.
- Anti-HPV peptides are peptides that exhibit anti-viral activity against HPV, including inhibiting infection by free HPV virus and syncytia formation between infected and uninfected cells.
- MeV and anti-Mev peptides Measles virus (VM or MeV) is an enveloped negative, single-stranded RNA virus belonging to the Paramyxoviridae family of viruses. Like RSV and HPV, MeV causes respiratory disease, and also produces an immuno-suppression responsible for additional, opportunistic infections. In some cases, MeV can establish infection of the brain leading to severe neurlogical complications.
- Anti-MeV peptides are peptides that exhibit anti-viral activity against MeV, including inhibiting infection by free MeV virus and syncytia formation between infected and uninfected cells.
- DP-178 means the 36 amino acid DP-178 peptide corresponding to amino acid residues 638-673 of the gp41 glycoprotein of HIV-1 isolate LAI (HIV LAI ) and having the sequence: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF (SEQ ID NO:1) as well as truncations, deletions and/or insertions thereof. Truncations of the DP178 peptide may comprise peptides of between 3-36 amino acids.
- Deletions consist of the removal of one or more amino acid residues from the DP178 peptide, and may involve the removal of a single contiguous portion of the peptide sequence or multiple portions. Insertions may comprise single amino acid residues or stretches of residues and may be made at the carboxy or amino terminal end of the DP 178 peptide or at a position internal to the peptide.
- DP178 peptide analogs are peptides whose amino acid sequences are comprised of the amino acid sequences of peptide regions of viruses other than HIV-1 LAI that correspond to the gp41 region from which DP178 was derived, as well as an truncations, deletions or insertions thereof.
- viruses may include, but are not limited to, other HIV isolates such as HIV-2 NIHZ , respiratory syncytial virus (RSV), human parainfluenza virus (HPV), simian immunodeficiency virus (SIV), and measles virus (MeV).
- DP178 analogs also refer to those peptide sequences identified or recognized by the ALLMOTI5, 107x178x4 and PLZIP search motifs described in U.S. Patent Nos. 6,013,263 , 6,017,536 and 6,020,459 and incorporated herein, having structural and/or amino acid motif similarity to DP178.
- DP178 analogs further refer to peptides described as "DP178-like" as that term is defined in U.S. Patent Nos. 6,013,263 , 6,017,536 and 6,020,459 .
- DP-107 means the 38 amino acid DP-107 peptide corresponding to amino acid residues 558-595 of the gp41 protein of HIV-1 isolate LAI (HIV LAI ) and having the sequence:
- DP107 peptide analogs are peptides whose amino acid sequences are comprised of the amino acid sequences of peptide regions of viruses other than HIV-1 LAI that correspond to the gp41 region from which DP 107 was derived, as well as truncations, deletions and/or insertions thereof.
- viruses may include, but are not limited to, other HIV isolates such as HIV-2 NIHZ , respiratory syncytial virus (RSV), human parainfluenza virus (HPV), simian immunodeficiency virus (SIV), and measles virus (MeV).
- DP107 analogs also refer to those peptide sequences identified or recognized by the ALLMOTI5.
- DP107 analogs further refer to peptides described as "DP107-like" as that term is defined in U.S. Patent Nos. 6,013,263 , 6,017,536 and 6,020,459 .
- Reactive groups are chemical groups capable of forming a covalent bond. Such reactive groups are coupled or bonded to a DP-107 or DP-178 peptide or analogs thereof or other anti-viral or anti-fusogenic peptide of interest. Reactive groups will generally be stable in an aqueous environment and will be a maleimide capable of forming a covalent bond with a functionality which is a thiol at the target site on a mobile blood component which is serum albumin.
- Functionalities are groups on blood components to which reactive groups on modified anti-viral peptides react to form covalent bonds. Functionalities include thiol groups for bonding to maleimides.
- Blood components are mobile.
- Mobile blood components are blood components that do not have a fixed situs for any extended period of time, generally not exceeding 5, more usually one minute. These blood components are not membrane-associated and are present in the blood for extended periods of time and are present in a minimum concentration of at least 0.1 ⁇ g/ml.
- the mobile blood component is serum albumin. The half-life of mobile blood components is at least about 12 hours.
- Protective groups are chemical moieties utilized to protect peptide derivatives from reacting with themselves. Various protective groups are disclosed herein and in U.S. 5,493,007 . Such protective groups include acetyl, fluorenylmethyloxycarbonyl (Fmoc), t-butyloxycarbonyl (Boc), benzyloxycarbonyl (CBZ), and the like. The specific protected amino acids are depicted in Table 1.
- Linking (spacer) groups are chemical moieties that link or connect reactive entities to antiviral and antifusogenic peptides.
- Linking groups may be the poly ethoxy amino acids, AEA ((2-amino) ethoxy acetic acid) or a preferred linking group AEEA ([2-(2-amino) ethoxy)] ethoxy acetic acid.
- Sensitive Functional Groups - A sensitive functional group is a group of atoms that represents a potential reaction site on an antiviral and antifusogenic peptide. If present, a sensitive functional group may be chosen as the attachment point for the linker-reactive group modification. Sensitive functional groups include but are not limited to carboxyl, amino, thiol, and hydroxyl groups.
- Modified Peptides - A modified peptide is an antiviral and antifusogenic peptide that has been modified by attaching a reactive group.
- the reactive group may be attached to the peptide either via a linking group, or optionally without using a linking group. It is also contemplated that one or more additional amino acids may be added to the peptide to facilitate the attachment of the reactive entity.
- Modified peptides may be administered in vivo such that conjugation with blood components occurs in vivo, or they may be first conjugated to blood components in vitro and the resulting conjugated peptide (as defined below) administered in vivo.
- Conjugated Peptides - A conjugated peptide is a modified peptide that has been conjugated to a blood component via a covalent bond formed between the reactive group of the modified peptide and the functionalities of the blood component, with or without a linking group.
- conjugated peptide can be made more specific to refer to particular conjugated peptides, for example “conjugated DP 178" or “conjugated DP 107.”
- the present invention takes advantage of the properties of existing anti-viral and antifusogenic peptides.
- the viruses that may be inhibited by the peptides include, but are not limited to all strains of viruses listed, e.g., in U.S. Patent Nos. 6,013,263 , 6,017,536 and 6,020,459 at Tables V-VII and IX-XIV therein.
- viruses include, e.g., human retroviruses, including HIV-1, HIV-2, and human T-lympocyte viruses (HTLV-I and HTLV-II), and non-human retroviruses, including bovine leukosis virus, feline sarcoma virus, feline leukemia virus, simian immunodeficiency virus (SIV), simian sarcoma virus, simian leukemia, and sheep progress pneumonia virus.
- human retroviruses including HIV-1, HIV-2, and human T-lympocyte viruses (HTLV-I and HTLV-II)
- non-human retroviruses including bovine leukosis virus, feline sarcoma virus, feline leukemia virus, simian immunodeficiency virus (SIV), simian sarcoma virus, simian leukemia, and sheep progress pneumonia virus.
- Non-retroviral viruses may also be inhibited by the peptides of the present invention, including human respiratory syncytial virus (RSV), canine distemper virus, Newcastle Disease virus, human parainfluenza virus (HPIV), influenza viruses, measles viruses (MeV), Epstein-Barr viruses, hepatitis B viruses, and simian Mason-Pfizer viruses.
- RSV human respiratory syncytial virus
- canine distemper virus Newcastle Disease virus
- HPIV human parainfluenza virus
- influenza viruses measles viruses (MeV)
- Epstein-Barr viruses Epstein-Barr viruses
- hepatitis B viruses hepatitis B viruses
- simian Mason-Pfizer viruses simian Mason-Pfizer viruses
- Non-enveloped viruses may also be inhibited by the peptides of the present invention, and include, but are not limited to, picomaviruses such as polio viruses, hepatitis A virus, enteroviruses, echoviruses, coxsackie viruses, papovaviruses such as papilloma virus, parvoviruses, adenoviruses, and reoviruses.
- picomaviruses such as polio viruses, hepatitis A virus, enteroviruses, echoviruses, coxsackie viruses, papovaviruses such as papilloma virus, parvoviruses, adenoviruses, and reoviruses.
- HIV fusion peptides As an example, the mechanism of action of HIV fusion peptides has been described as discussed in the background section of this application and antiviral and antifusogenic properties of the peptides have been well established.
- a synthetic peptide corresponding to the carboxyl-terminal ectodomain sequence (for instance, amino acid residues 643-678 of HIV-1 class B, of the LAI strain or residues 638-673 from similar strain as well as residues 558-595) has been shown to inhibit virus-mediated cell-cell fusion completely at low concentration.
- the fusion peptide competes with the leucine zipper region of the native viral gp41 thus resulting in the interference of the fusion/infection of the virus into the cell.
- the focus of the present invention is to modify a selected anti-viral and antifusogenic peptide with the DAC (Drug Activity Complex) technology to confer to this peptide improved bio-availability, extended half-life and better distribution through selective conjugation of the peptide onto a protein carrier but without modifying the peptide's anti-viral properties.
- the carrier of choice for this invention would be albumin conjugated through its free thiol by an anti-viral and antifusogenic peptide modified with a maleimide moiety.
- peptide DP178 binds to a conformation of gp41 that is relevant for fusion.
- DP178 and DP178-like peptides are modified.
- other embodiments of the invention include modification of DP107 and DP107-like peptide for use against HIV, as well as peptides analagous to DP107 and DP178 that are found in RSV, HPV, MeV and SIV viruses.
- the DP178 peptide corresponds to amino acid residues 638 to 673 of the transmembrane protein gp41 from the HIV-1 LAI isolate, and has the 36 amino acid sequence (reading from amino to carboxy terminus):
- the peptides of this invention include truncations of the DP178 peptide comprising peptides of between 3 and 36 amino acid residues (i.e., peptides ranging in size from a tripeptide to a 36-mer polypeptide), These truncated peptides are shown in Tables 2 and 3.
- amino acid substitutions of the DP 178 peptide are also within the scope of the invention. HIV-1 and HIV-2 enveloped proteins are structurally distinct, but there exists a striking amino acid conservation within the DP178-corresponding regions of HIV-1 and HIV-2. The amino acid conservation is of a periodic nature, suggesting some conservation of structure and/or function. Therefore, one possible class of amino acid substitutions would include those amino acid changes which are predicted to stabilize the structure of the DP178 peptides of the invention. Utilizing the DP178 and DP178 analog sequences described herein, the skilled artisan can readily compile DP 178 consensus sequences and ascertain from these, conserved amino acid residues which would represent preferred amino acid substitutions.
- the amino acid substitutions may be of a conserved or non-conserved nature.
- conserveed amino acid substitutions consist of replacing one or more amino acids of the DP 178 peptide sequence with amino acids of similar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to aspartic acid (D) amino acid substitution.
- Non-conserved substitutions consist of replacing one or more amino acids of the DP178 peptide sequence with amino acids possessing dissimilar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to valine (V) substitution.
- Amino acid insertions of DP178 may consist of single amino acid residues or stretches of residues. The insertions may be made at the carboxy or amino terminal end of the DP178 or DP178 truncated peptides, as well as at a position internal to the peptide.
- Such insertions will generally range from 2 to 15 amino acids in length. It is contemplated that insertions made at either the carboxy or amino terminus of the peptide of interest may be of a broader size range, with about 2 to about 50 amino acids being preferred.
- One or more such insertions may be introduced into DP178 or DP 178 truncations, as long as such insertions result in peptides which may still be recognized by the 107x178x4, ALLMOTI5 or PLZIP search motifs described above.
- Preferred amino or carboxy terminal insertions are peptides ranging from about 2 to about 50 amino acid residues in length, corresponding to gp41 protein regions either amino to or carboxy to the actual DP178 gp41 amino acid sequence, respectively.
- a preferred amino terminal or carboxy terminal amino acid insertion would contain gp41 amino acid sequences found immediately amino to or carboxy to the DP178 region of the gp41 protein.
- Deletions of DP178 or DP178 truncations are also within the scope of this invention. Such deletions consist of the removal of one or more amino acids from the DP178 or DP178-like peptide sequence, with the lower limit length of the resulting peptide sequence being 4 to 6 amino acids.
- deletions may involve a single contiguous or greater than one discrete portion of the peptide sequences.
- One or more such deletions may be introduced into DP178 or DP178 truncations, as long as such deletions result in peptides which may still be recognized by the 107x 178x4, ALLMOTI5 or PLZIP search motifs described above.
- DP 107 is a 38 amino acid peptide which exhibits potent antiviral activity, and corresponds to residues 558 to 595 of HIV-1 LAI isolate transmembrane (TM) gp41 glycoprotein, as shown here:
- the DP107 peptides include truncations of the DP107 peptide comprising peptides of between 3 and 38 amino acid residues (i.e., peptides ranging in size from a tripeptide to a 38-mer polypeptide), These peptides are shown in Tables 4 and 5, below.
- amino acid substitutions of the DP 178 peptide are also within the scope of the invention.
- DP178 there also exists a striking amino acid conservation within the DP107-corresponding regions of HIV-1 and HIV-2, again of a periodic nature, suggesting conservation of structure and/or function. Therefore, one possible class of amino acid substitutions includes those amino acid changes predicted to stabilize the structure of the DP107 peptides of the invention. Utilizing the DP107 and DP107 analog sequences described herein, the skilled artisan can readily compile DP107 consensus sequences and ascertain from these, conserved amino acid residues which would represent preferred amino acid substitutions.
- the amino acid substitutions may be of a conserved or non-conserved nature.
- conserved amino acid substitutions consist of replacing one or more amino acids of the DP 107 peptide sequence with amino acids of similar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to aspartic acid (D) amino acid substitution.
- Non-conserved substitutions consist of replacing one or more amino acids of the DP107 peptide sequence with amino acids possessing dissimilar charge, size, and/or hydrophobicity characteristics, such as, for example, a glutamic acid (E) to valine (V) substitution.
- Amino acid insertions may consist of single amino acid residues or stretches of residues.
- the insertions may be made at the carboxy or amino terminal end of the DP107 or DP 107 truncated peptides, as well as at a position internal to the peptide.
- Such insertions will generally range from 2 to 15 amino acids in length. It is contemplated that insertions made at either the carboxy or amino terminus of the peptide of interest may be of a broader size range, with about 2 to about 50 amino acids being preferred.
- One or more such insertions may be introduced into DP 107 or DP107 truncations, as long as such insertions result in peptides which may still be recognized by the 107x178x4, ALLMOTI5 or PLZIP search motifs described above.
- Preferred amino or carboxy terminal insertions are peptides ranging from about 2 to about 50 amino acid residues in length, corresponding to gp41 protein regions either amino to or carboxy to the actual DP 107 gp41 amino acid sequence, respectively.
- a preferred amino terminal or carboxy terminal amino acid insertion would contain gp41 amino acid sequences found immediately amino to or carboxy to the DP107 region of the gp41 protein.
- Deletions of DP107 or DP107 truncations are also within the scope of this invention. Such deletions consist of the removal of one or more amino acids from the DP107 or DP 107-like peptide sequence, with the lower limit length of the resulting peptide sequence being 4 to 6 amino acids.
- deletions may involve a single contiguous or greater than one discrete portion of the peptide sequences.
- One or more such deletions may be introduced into DP107 or DP107 truncations, as long as such deletions result in peptides which may still be recognized by the 107x178x4, ALLMOTI5 or PLZIP search motifs.
- Peptides corresponding to analogs of the DP178, DP 178 truncations, DP107 and DP107 truncation sequences of the invention, described, above, may be found in other viruses, including, for example, non-HIV-1 enveloped viruses, non-enveloped viruses and other non-viral organisms.
- Such DP 178 and DP107 analogs may, for example, correspond to peptide sequences present in transmembrane ("TM") proteins of enveloped viruses and may, correspond to peptide sequences present in non enveloped and nonviral organisms.
- TM transmembrane
- Such peptides may exhibit antifusogenic activity, antiviral activity, most particularly antiviral activity which is specific to the virus in which their native sequences are found, or may exhibit an ability to modulate intracellular processes involving coiled-coil peptide structures.
- DP178 analogs are peptides whose amino acid sequences are comprised of the amino acid sequences of peptide regions of, for example, other (i.e., other than HIV-1) viruses that correspond to the gp41 peptide region from which DP178 was derived.
- viruses may include, but are not limited to, other HIV-1 isolates and HIV-2 isolates.
- DP178 analogs derived from the corresponding gp41 peptide region of other (i.e., non HIV-1LAI) HIV-1 isolates may include, for example, peptide sequences as shown below.
- the peptides of SEQ ID NO:3, SEQ ID NO:4 and SEQ ID NO:5 are derived from HIV-1 SF2 , HIV-1 RF , and HIV-1 MN , respectively.
- Other DP178 analogs include those derived from HIV-2, including the peptides of SEQ ID NO:6 and SEQ ID NO:7, which are derived from HIV-2 ROD and HIV-2 NIHZ , respectively.
- Still other useful analogs include the peptides of SEQ ID NO:8 and SEQ ID NO:9, which have been demonstrated to exhibit anti-viral activity.
- the DP178 analogs represent peptides whose amino acid sequences correspond to the DP 178 region of the gp41 protein
- the peptides disclosed herein may, additionally, include amino sequences, ranging from about 2 to about 50 amino acid residues in length, corresponding to gp41 protein regions either amino to or carboxy to the actual DP 178 amino acid sequence.
- Table 6 and Table 7 show some possible truncations of the HIV-2 NIHZ DP178 analog, which may comprise peptides of between 3 and 36 amino acid residues (i.e., peptides ranging in size from a tripeptide to a 36-mer polypeptide). Peptide sequences in these tables are listed from amino (left) to carboxy (right) terminus.
- DP 178 and DP107 analogs are recognized or identified, for example, by utilizing one or more of the 107x178x4, ALLMOTI5 or PLZIP computer-assisted search strategies described above.
- the search strategy identifies additional peptide regions which are predicted to have structural and/or amino acid sequence features similar to those of DP107 and/or DP178.
- search strategies are described fully in the example presented in Section 9 of US Patent Nos. 6,013,263 , 6,017,536 and 6,020,459 . While this search strategy is based, in part, on a primary amino acid motif deduced from DP107 and DP 178, it is not based solely on searching for primary amino acid sequence homologies, as such protein sequence homologies exist within, but not between major groups of viruses. For example, primary amino acid sequence homology is high within the TM protein of different strains of HIV-1 or within the TM protein of different isolates of simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Anti-RSV peptides include DP178 and/or DP107 analogs identified from corresponding peptide sequences in RSV which have further been identified to inhibit viral infection by RSV.
- Such peptides of interest include the peptides of Table 16 and peptides of SEQ ID NO:10 to SEQ ID NO:30. Of particular interest are the following peptides:
- the peptide is selected from the group consisting of SEQ ID NO:14 to SEQ ID NO:17 and SEQ ID NO:29
- Anti-HPIV peptides include DP178 and/or DP107 analogs identified from corresponding peptide sequences in HPIV and which have further been identified to inhibit viral infection by HPIV.
- Such peptides of interest include the peptides of Table 17 and SEQ ID NO:31 to SEQ ID NO:62. Of particular interest are the following peptides:
- the peptide is selected from the group consisting of SEQ ID NO:35, SEQ ID NO:38 to SEQ ID NO:42, SEQ ID NO:52 and SEQ ID NO:58.
- Anti-MeV peptides are DP178 and/or DP107 analogs identified from corresponding peptide sequences in measles virus (MeV) which have further been identified to inhibit viral infection by the measles virus.
- Such peptides of particular interest include the peptides of Table 19 and peptides of SEQ ID NO:74 to SEQ ID NO:86. Of particular interest are the peptides listed below.
- the peptide is selected from the group consisting of SEQ. ID NO:77, SEQ ID NO:79, SEQ ID NO:81 and SEQ ID NO:84.
- Anti-SIV peptides are DP178 and/or DP107 analogs identified from corresponding peptide sequences in SIV which have further been identified to inhibit viral infection by SIV.
- Such peptides of interest include the peptides of Table 18 and peptides of SEQ ID NO:63 to SEQ ID NO:73. Of particular interest are the following peptides:
- the invention contemplates modifying peptides that exhibit anti-viral and antifusogenic activity, including such modifications of DP-107 and DP-178 and analogs thereof. Such modified peptides can react with the available reactive functionalities on serum albumin via covalent linkages.
- the invention relates to conjugates of modified peptides with serum albumin and such conjugates for use in preventing or treating a viral infection.
- the method of using the conjugate includes extending the effective therapeutic life of the conjugated anti-viral peptides derivatives as compared to administration of the unconjugated peptides to a patient.
- the modified peptides are of a type designated as a DAC (Drug Affinity Complex) which comprises the anti-viral peptide molecule and a linking group together with a chemically reactive group capable of reaction with a reactive functionality of a mobile blood protein.
- DAC Drug Affinity Complex
- the functionality of the protein will be a thiol group and the reactive group will be a maleimido-containing group such as gamma-maleimide-butyralamide (GMBA) or maleimidopropionic acid (MPA).
- GMBA gamma-maleimide-butyralamide
- MPA maleimidopropionic acid
- Primary amines are the prinipal targets for NHS esters. Accessible ⁇ -amine groups present on the N-termini of proteins react with NHS esters. However, ⁇ -amine groups on a protein may not be desirable or available for the NHS coupling. While five amino acids have nitrogen in their side chains, only the ⁇ -amine of lysine reacts significantly with NHS esters. An amide bond is formed when the NHS ester conjugation reaction reacts with primary amines releasing N-hydroxysuccinimide as demonstrated in the schematic below.
- the functional group on this protein will be a thiol group and the chemically reactive group will be a maleimido-containing group such as MPA or GMBA (gamma-maleimide-butyralamide).
- the maleimido group is most selective for sulfhydryl groups on peptides when the pH of the reaction mixture is kept between 6.5 and 7.4. At pH 7.0, the rate of reaction of maleimido groups with sulfhydryls is 1000-fold faster than with amines.
- a stable thioether linkage between the maleimido group and the sulfhydryl is formed which cannot be cleaved under physiological conditions, as demonstrated in the following schematic.
- the modified peptides are designed to specifically react with thiol groups on mobile blood proteins. Such reaction is established by covalent bonding of the peptide modified with a maleimide link (e.g. prepared from GMBS, MPA or other maleimides) to a thiol group on a mobile blood protein serum albumin.
- a maleimide link e.g. prepared from GMBS, MPA or other maleimides
- maleimide-modified peptides i.e., maleimide peptides
- albumin the most abundant blood protein
- peptide-maleimide-albumin conjugates will tend to comprise approximately a 1:1 molar ratio of peptide to albumin.
- IgG molecules class II
- serum albumin make up the majority of the soluble protein in blood they also make up the majority of the free thiol groups in blood that are available to covalently bond to maleimide-modified peptides.
- Cys 34 of albumin is predominantly in the ionized form, which dramatically increases its reactivity.
- another factor which enhances the reactivity of Cys 34 is its location, which is in a crevice close to the surface of one loop of region V of albumin. This location makes Cys 34 very available to ligands of all kinds, and is an important factor in Cys 34 's biological role as free radical trap and free thiol scavenger.
- peptide-maleimide-albumin conjugates Another advantage of peptide-maleimide-albumin conjugates is the reproducibility associated with the 1:1 loading of peptide to albumin specifically at Cys 34 .
- Other techniques such as glutaraldehyde, DCC, EDC and other chemical activations of, e.g, free amines, lack this selectivity.
- albumin contains 52 lysine residues, 25-30 of which are located on the surface of albumin and therefore accessible for conjugation. Activating these lysine residues, or alternatively modifying peptides to couple through these lysine residues, results in a heterogenous population of conj ugates.
- maleimide-peptides Through controlled administration of maleimide-peptides in vivo, one can control the specific labeling of albumin and IgG in vivo . In typical administrations, 80-90% of the administered maleimide-peptides will label albumin and less than 5% will label IgG. Trace labeling of free thiols such as glutathione will also occur. Such specific labeling is preferred for in vivo use as it permits an accurate calculation of the estimated half life of the administered agent.
- maleimide-peptides can provide specific labeling of serum albumin and IgG ex vivo.
- ex vivo labeling involves the addition of maleimide-peptides to blood, serum or saline solution containing serum albumin and/or IgG. Once conjugation has occurred ex vivo with the maleimide-peptides, the blood, serum or saline solution can be readministered to the patient's blood for in vivo treatment.
- maleimide-peptides are generally quite stable in the presence of aqueous solutions and in the presence of free amines. Since maleimide-peptides will only react with free thiols, protective groups are generally not necessary to prevent the maleimide-peptides from reacting with itself.
- the increased stability of the modified peptide permits the use of further purification steps such as HPLC to prepare highly purified products suitable for in vivo use.
- the increased chemical stability provides a product with a longer shelf life.
- the site at which the chemically reactive group of the modified peptides may react in vivo is serum albumin.
- the serum albumin will remain at least three days, and may remain five days or more (usually not exceeding 60 days, more usually not exceeding 30 days) particularly as to the half life, based on the concentration in the blood.
- the reaction will be with mobile serum albumin.
- mobile it is intended that the component does not have a fixed situs for any extended period of time, generally not exceeding 5 minutes, more usually one minute, although some of the blood component may be relatively stationary for extended periods of time.
- the subject conjugates may be prepared ex vivo by combining blood with modified peptides allowing covalent bonding of the modified peptides to reactive functionalities on blood components and then returning or administering the conjugated blood to the host. Moreover, the above may also be accomplished by first purifying an individual blood component, serum albumin and combining the component ex vivo with the chemically reactive modified peptides. The functionalized blood or blood component may then be returned to the host to provide in vivo the subject therapeutically effective conjugates. The blood also may be treated to prevent coagulation during handling ex vivo .
- Anti-viral and anti-fusogenic peptides may be synthesized by standard methods of solid phase peptide chemistry known to those of ordinary skill in the art.
- peptides may be synthesized by solid phase chemistry techniques following the procedures described by Steward and Young ( Steward, J. M. and Young, J. D., Solid Phase Peptide Synthesis, 2nd Ed., Pierce Chemical Company, Rockford, III., (1984 ) using an Applied Biosystem synthesizer.
- multiple peptide fragments may be synthesized then linked together to form larger peptides. These synthetic peptides can also be made with amino acid substitutions at specific locations.
- the protected or derivatized amino acid is then either attached to an inert solid support or utilized in solution by adding the next amino acid in the sequence having the complimentary (amino or carboxyl) group suitably protected and under conditions suitable for forming the amide linkage.
- the protecting group is then removed from this newly added amino acid residue and the next amino acid (suitably protected) is added, and so forth.
- any remaining protecting groups are removed sequentially or concurrently to afford the final polypeptide.
- a particularly preferred method of preparing compounds useful in the present invention involves solid phase peptide synthesis wherein the amino acid ⁇ -N-terminal is protected by an acid or base sensitive group.
- Such protecting groups should have the properties of being stable to the conditions of peptide linkage formation while being readily removable without destruction of the growing peptide chain or racemization of any of the chiral centers contained therein.
- Suitable protecting groups are 9-fluorenylmethyloxycarbonyl (Fmoc), t-butyloxycarbonyl (Boc), benzyloxycarbonyl (Cbz), biphenylisopropyloxycarbonyl , t-amyloxycarbonyl, isobomyloxycarbonyl, ⁇ , ⁇ -dimethyl-3,5-dimethoxybenzyloxycarbonyl, o-nitrophenylsulfenyl, 2-cyano-t-butyloxycarbonyl, and the like.
- the 9-fluorenyl-methyloxycarbonyl (Fmoc) protecting group is particularly preferred for the synthesis of the peptides.
- side chain protecting groups are, for side chain amino groups like lysine and arginine, 2,2,5,7,8-pentamethylchroman-6-sulfonyl (pmc), nitro, p-toluenesulfonyl, 4-methoxybenzene-sulfonyl, Cbz, Boc, and adamantyloxycarbonyl; for tyrosine, benzyl, o-bromobenzyloxycarbonyl, 2,6-dichlorobenzyl, isopropyl, t-butyl (t-Bu), cyclohexyl, cyclopenyl and acetyl (Ac); for serine, t-butyl, benzyl and tetrahydropyranyl; for histidine, trityl, benzyl, Cbz, p-toluenesulfonyl and 2,4-dinitrophenyl; for tryptophan, for side
- the ⁇ -C-terminal amino acid is attached to a suitable solid support or resin.
- suitable solid supports useful for the above synthesis are those materials which are inert to the reagents and reaction conditions of the stepwise condensation-deprotection reactions, as well as being insoluble in the media used.
- the preferred solid support for synthesis of ⁇ -C-terminal carboxy peptides is 4-hydroxymethylphenoxymethyl-copoly(styrene-1% divinylbenzene).
- the preferred solid support for ⁇ -C-terminal amide peptides is the 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxyacetamidoethyl resin available from Applied Biosystems (Foster City, Calif.).
- the ⁇ -C-terminal amino acid is coupled to the resin by means of N,N'-dicyclohexylcarbodiimide (DCC), N,N-diisopropylcarbodiimide (DIC) or O-benzotriazol-1-yl-N,N,N',N'-tetramethyluronium-hexafluorophosphate (HBTU), with or without 4-dimethylaminopyridine (DMAP), 1-hydroxybenzotriazole (HOBT), benzotriazol-1-yloxy-tris(dimethylamino)phosphonium-hexafluorophosphate (BOP) or bis(2-oxo-3-oxazolidinyl)phosphine chloride (BOPCI), mediated coupling for from about 1 to about 24 hours at a temperature of between 10° and 50°C in a solvent such as dichloromethane or DMF.
- DCC N,N'-dicyclohexylcarbodiimide
- the Fmoc group is cleaved with a secondary amine, preferably piperidine, prior to coupling with the ⁇ -C-terminal amino acid as described above.
- the preferred method for coupling to the deprotected 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxyacetamidoethyl resin is O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluoro-phosphate (HBTU, 1 equiv.) and 1-hydroxybenzotriazole (HOBT, 1 equiv.) in DMF.
- HBTU O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluoro-phosphate
- HOBT 1-hydroxybenzotriazole
- the coupling of successive protected amino acids can be carried out in an automatic polypeptide synthesizer as is well known in the art.
- the ⁇ -N-terminal amino acids of the growing peptide chain are protected with Fmoc.
- the removal of the Fmoc protecting group from the ⁇ -N-terminal side of the growing peptide is accomplished by treatment with a secondary amine, preferably piperidine. Each protected amino acid is then introduced in about 3-fold molar excess, and the coupling is preferably carried out in DMF.
- the coupling agent is normally O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluorophosphate (HBTU, 1 equiv.) and 1-hydroxybenzotriazole (HOBT, 1 equiv.).
- the polypeptide is removed from the resin and deprotected, either in successively or in a single operation. Removal of the polypeptide and deprotection can be accomplished in a single operation by treating the resin-bound polypeptide with a cleavage reagent comprising thioanisole, water, ethanedithiol and trifluoroacetic acid.
- a cleavage reagent comprising thioanisole, water, ethanedithiol and trifluoroacetic acid.
- the resin is cleaved by aminolysis with an alkylamine.
- the peptide may be removed by transesterification, e.g. with methanol, followed by aminolysis or by direct transamidation.
- the protected peptide may be purified at this point or taken to the next step directly.
- the removal of the side chain protecting groups is accomplished using the cleavage cocktail described above.
- the fully deprotected peptide is purified by a sequence of chromatographic steps employing any or all of the following types: ion exchange on a weakly basic resin (acetate form); hydrophobic adsorption chromatography on underivitized polystyrene-divinylbenzene (for example, Amberlite XAD); silica gel adsorption chromatography; ion exchange chromatography on carboxymethylcellulose; partition chromatography, e.g. on Sephadex G-25, LH-20 or countercurrent distribution; high performance liquid chromatography (HPLC), especially reverse-phase HPLC on octyl- or octadecylsilyl-silica bonded phase column packing.
- HPLC high performance liquid chromatography
- N-protecting group refers to those groups intended to protect the ⁇ -N-terminal of an amino acid or peptide or to otherwise protect the amino group of an amino acid or peptide against undesirable reactions during synthetic procedures. Commonly used N-protecting groups are disclosed in Greene, "Protective Groups In Organic Synthesis,” (John Wiley & Sons, New York (1981 )), Additionally, protecting groups can be used as pro-drugs which are readily cleaved in vivo, for example, by enzymatic hydrolysis, to release the biologically active parent.
- ⁇ -N-protecting groups comprise loweralkanoyl groups such as formyl, acetyl ("Ac"), propionyl, pivaloyl, t-butylacetyl and the like; other acyl groups include 2-chloroacetyl, 2-bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl, o-nitrophenoxyacetyl,-chlorobutyryl, benzoyl, 4-chlorobenzoyl, 4-bromobenzoyl, 4-nitrobenzoyl and the like; sulfonyl groups such as benzenesulfonyl, p-toluenesulfonyl carbamate forming groups such as benzyloxycarbonyl, p-chlorobenzyloxycarbonyl, p-methoxybenzyloxycarbonyl, p-nitrobenzyloxycarbonyl, 2-nitrobenzyloxy
- carboxy protecting group refers to a carboxylic acid protecting ester or amide group employed to block or protect the carboxylic acid functionality while the reactions involving other functional sites of the compound are performed.
- Carboxy protecting groups are disclosed in Greene, "Protective Groups in Organic Synthesis” pp. 152-186 (1981 ), which is hereby incorporated by reference.
- a carboxy protecting group can be used as a pro-drug whereby the carboxy protecting group can be readily cleaved in vivo, for example by enzymatic hydrolysis, to release the biologically active parent.
- carboxy protecting groups are well known to those skilled in the art, having been extensively used in the protection of carboxyl groups in the penicillin and cephalosporin fields as described in U.S. Pat. Nos. 3,840,556 and 3,719,667 , the disclosures of which are hereby incorporated herein by reference.
- carboxy protecting groups are C 1 -C 8 loweralkyl (e.g., methyl, ethyl or t-butyl and the like); arylalkyl such as phenethyl or benzyl and substituted derivatives thereof such as alkoxybenzyl or nitrobenzyl groups and the like; arylalkenyl such as phenylethenyl and the like; aryl and substituted derivatives thereofsuch as 5-indanyl and the like; dialkylaminoalkyl such_as dimethylaminoethyl and the like); alkanoyloxyalkyl groups such as acetoxymethyl, butyryloxymethyl, valeryloxymethyl, isobutyryloxymethyl, isovaleryloxymethyl, 1-(propionyloxy)-1-ethyl, 1-(pivaloyloxyl)-1-ethyl, 1-methyl-1-(propionyloxy)-1-ethyl, pivaloyloxymethyl, pro
- Representative amide carboxy protecting groups are aminocarbonyl and loweralkylaminocarbonyl groups.
- Preferred carboxy-protected compounds of the invention are compounds wherein the protected carboxy group is a loweralkyl, cycloalkyl or arylalkyl ester, for example, methyl ester, ethyl ester, propyl ester, isopropyl ester, butyl ester, sec-butyl ester, isobutyl ester, amyl ester, isoamyl ester, octyl ester, cyclohexyl ester, phenylethyl ester and the like or an alkanoyloxyalkyl, cycloalkanoyloxyalkyl, aroyloxyalkyl or an arylalkylcarbonyloxyalkyl ester.
- the protected carboxy group is a loweralkyl, cycloalkyl or arylalkyl ester, for example, methyl ester, ethyl ester, propyl ester, isopropyl ester,
- Preferred amide carboxy protecting groups are loweralkylaminocarbonyl groups.
- aspartic acid may be protected at the ⁇ -C-terminal by an acid labile group (e.g. t-butyl) and protected at the ⁇ -C-terminal by a hydrogenation labile group (e.g. benzyl) then deprotected selectively during synthesis.
- an acid labile group e.g. t-butyl
- a hydrogenation labile group e.g. benzyl
- modified peptides will vary widely, depending upon the nature of the various elements comprising the peptide.
- the synthetic procedures will be selected so as to be simple, provide for high yields, and allow for a highly purified stable product.
- the chemically reactive group will be created at the last stage of the synthesis, for example, with a carboxyl group, esterification to form an active ester. Specific methods for the production of modified peptides are described below.
- the selected peptide is first assayed for anti-viral activity, and then is modified with the linking group only at either the N-terminus, C-terminus or interior of the peptide.
- the anti-viral activity of this modified peptide-linking group is then assayed. If the anti-viral activity is not reduced dramatically (i.e., reduced less than 10-fold), then the stability of the modified peptide-linking group is measured by its in vivo lifetime. If the stability is not improved to a desired level, then the peptide is modified at an alternative site, and the procedure is repeated until a desired level of anti-viral and stability is achieved.
- each peptide selected to undergo modification with a linker and a reactive entity group will be modified according to the following criteria: if a terminal carboxylic group is available on the peptide and is not critical for the retention of anti-viral activity, and no other sensitive functional group is present on the peptide, then the carboxylic acid will be chosen as attachment point for the linker-reactive group modification. If the terminal carboxylic group is involved in anti-viral activity, or if no carboxylic acids are available, then any other sensitive functional group not critical for the retention of anti-viral activity will be selected as the attachment point for the linker-reactive entity modification.
- this invention is applicable to any peptide with preferably one chemical step only to modify the peptide (as described above) or two steps (as described above involving prior protection of a sensitive group) or three steps (protection, activation and deprotection). Under exceptional circumstances only, would multiple steps (beyond three steps) synthesis be required to transform a peptide into an active maleimide derivative.
- a maleimide derivative may also be synthesized from a peptide containing a free amino group and a free carboxylic acid.
- GMBS N-[ ⁇ -maleimidobutyryloxy]succinimide ester
- the succinimide ester group will react with the free amino and the maleimide derivative will be purified from the reaction mixture by crystallization or by chromatography on silica or by HPLC.
- a maleimide derivative may be synthesized from a peptide containing multiple other sensitive functional groups and no free carboxylic acids.
- an array of bifunctional crosslinking reagents can be used to convert the molecule into a reactive NHS derivative.
- maleimidopropionic acid (MPA) can be coupled to the free amine to produce a maleimide derivative through reaction of the free amine with the carboxylic group of MPA using HBTU/HOBdDIEA activation in DMF.
- reagents include: azidobenzoyl hydrazide, N-[4-(p-azidosalicylamino)butyl]-3'-[2'-pyridyldithio)propionamide), bis-sulfosuccinimidyl suberate, dimethyl adipimidate, disuccinimidyl tartrate, N-y-maleimidobutyryloxysuccinimide ester, N-hydroxy sulfosuccinimidyl-4-azidobenzoate, N-succinimidyl [4-azidophenyl]-1,3'-dithiopropionate, N-succinimidyl [4-iodoacetyl]aminobenzoate, glutaraldehyde, and succini
- Modified anti-viral peptides may be used as a therapeutic agent in the treatment of patients who are suffering from viral infection, and can be administered to patients according to the methods described below and other methods known in the art. Effective therapeutic dosages of the modified peptides may be determined through procedures well known by those in the art and will take into consideration any concerns over potential toxicity of the peptide.
- the modified peptides can also be administered prophylactically to previously uninfected individuals. This can be advantageous in cases where an individual has been subjected to a high risk of exposure to a virus, as can occur when individual has been in contact with an infected individual where there is a high risk of viral transmission. This can be expecially advantageous where there is known cure for the virus, such as the HIV virus.
- prophylactic administration of a modified anti-HIV peptide would be advantageous in a situation where a health care worker has been exposed to blood from an HIV-infected individual, or in other situations where an individual engaged in high-risk activities that potentially expose that individual to the HIV virus.
- the modified peptides will be administered in a physiologically acceptable medium, e.g. deionized water, phosphate buffered saline (PBS), saline, aqueous ethanol or other alcohol, plasma, proteinaceous solutions, mannitol, aqueous glucose, alcohol, vegetable oil, or the like.
- a physiologically acceptable medium e.g. deionized water, phosphate buffered saline (PBS), saline, aqueous ethanol or other alcohol, plasma, proteinaceous solutions, mannitol, aqueous glucose, alcohol, vegetable oil, or the like.
- Other additives which may be included include buffers, where the media are generally buffered at a pH in the range of about 5 to 10, where the buffer will generally range in concentration from about 50 to 250 mM, salt, where the concentration of salt will generally range from about 5 to 500 mM, physiologically acceptable stabilizers, and the like.
- the compositions may be lyophilized for convenient
- the subject modified peptides will for the most part be administered parenterally, such as intravenously (IV), intraarterially (IA), intramuscularly (IM), subcutaneously (SC), or the like. Administration may in appropriate situations be by transfusion. In some instances, where reaction of the functional group is relatively slow, administration may be oral, nasal, rectal, transdermal or aerosol, where the nature of the conjugate allows for transfer to the vascular system. Usually a single injection will be employed although more than one injection may be used, if desired.
- the modified peptides may be administered by any convenient means, including syringe, trocar, catheter, or the like.
- the administration will be intravascularly, where the site of introduction is not critical to this invention, preferably at a site where there is rapid blood flow, e.g., intravenously, peripheral or central vein. Other routes may find use where the administration is coupled with slow release techniques or a protective matrix.
- the intent is that the modified peptide be effectively distributed in the blood, so as to be able to react with the blood components.
- the concentration of the conjugate will vary widely, generally ranging from about 1 pg/ml to 50 mg/ml.
- the total administered intravascularly will generally be in the range of about 0.1 mg/ml to about 10 mg/ml, more usually about 1 mg/ml to about 5 mg/ml.
- the blood of the mammalian host may be monitored for the presence of the modified peptide compound one or more times. By taking a portion or sample of the blood of the host, one may determine whether the peptide has become bound to the long-lived blood components in sufficient amount to be therapeutically active and, thereafter, the level of the peptide compound in the blood. If desired, one may also determine to which of the blood components the peptide is bound. This is particularly important when using non-specific modified peptides. For specific maleimide-modified peptides, it is much simpler to calculate the half life of serum albumin and IgG.
- Methods are described for determining the concentration of the anti-viral peptides and/or analogs, or their derivatives and conjugates in biological samples (such as blood) using antibodies specific for the peptides, peptide analogs or their derivatives and conjugates, and to the use of such antibodies as a treatment for toxicity potentially associated with such peptides, analogs, and/or their derivatives or conjugates.
- This is advantageous because the increased stability and life of the peptides in vivo in the patient might lead to novel problems during treatment, including increased possibility for toxicity.
- anti-therapeutic agent antibodies either monoclonal or polyclonal, having specificity for a particular peptide, peptide analog or derivative thereof, can assist in mediating any such problem.
- the antibody may be generated or derived from a host immunized with the particular peptide, analog or derivative thereof, or with an immunogenic fragment of the agent, or a synthesized immunogen corresponding to an antigenic determinant of the agent.
- Preferred antibodies will have high specificity and affinity for native, modified and conjugated forms of the peptide, peptide analog or derivative.
- Such antibodies can also be labeled with enzymes, fluorochromes, or radiolables.
- Antibodies specific for modified peptides may be produced by using purified peptides for the induction of peptide-specific antibodies. By induction of antibodies, it is intended not only the stimulation of an immune response by injection into animals, but analogous steps in the production of synthetic antibodies or other specific binding molecules such as screening of recombinant immunoglobulin libraries. Both monoclonal and polyclonal antibodies can be produced by procedures well known in the art.
- the anti-peptide antibodies may be used to treat toxicity induced by administration of the modified peptide, analog or derivative thereof, and may be used ex vivo or in vivo.
- Ex vivo methods would include immuno-dialysis treatment for toxicity employing anti-therapeutic agent antibodies fixed to solid supports.
- In vivo methods include administration of anti-therapeutic agent antibodies in amounts effective to induce clearance of antibody-agent complexes.
- the antibodies may be used to remove the modified peptides, analogs or derivatives thereof, and conjugates thereof, from a patient's blood ex vivo by contacting the blood with the antibodies under sterile conditions.
- the antibodies can be fixed or otherwise immobilized on a column matrix and the patient's blood can be removed from the patient and passed over the matrix.
- the modified peptide, peptide analogs, derivatives or conjugates will bind to the antibodies and the blood containing a low concentration of peptide, analog, derivative or conjugate, then may be returned to the patient's circulatory system.
- the amount of peptide compound removed can be controlled by adjusting the pressure and flow rate.
- Preferential removal of the peptides, analogs, derivatives and conjugates from the plasma component of a patient's blood can be effected, for example, by the use of a semipermeable membrane, or by otherwise first separating the plasma component from the cellular component by ways known in the art prior to passing the plasma component over a matrix containing the anti-therapeutic antibodies.
- the preferential removal of peptide-conjugated blood cells, including red blood cells can be effected by collecting and concentrating the blood cells in the patient's blood and contacting those cells with fixed anti-therapeutic antibodies to the exclusion of the serum component of the patient's blood.
- the anti-therapeutic antibodies can be administered in vivo, parenterally, to a patient that has received the peptide, analogs, derivatives or conjugates for treatment.
- the antibodies will bind peptide compounds and conjugates. Once bound the peptide activity will be hindered if not completely blocked thereby reducing the biologically effective concentration of peptide compound in the patient's bloodstream and minimizing harmful side effects.
- the bound antibody-peptide complex will facilitate clearance of the peptide compounds and conjugates from the patient's blood stream.
- DP178 (SEQ ID NO:1) is synthesized and modified to include a linker and maleimide group according to the following synthesis scheme. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , DP178 is a potent inhibitor of HIV-1, and inhibits both cell-induced syncytia formation between HIV-1 infected and uninfected cells and infection of uninfected cells be cell-free HIV-1 virus.
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Phe-OH, Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Leu-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ala-OH, Fmoc-Trp(Boc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- DMF N,N -dimethylformamide
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20%, HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- DP107 (SEQ ID NO:2) is synthesized and modified to include a linker and maleimide group according to the following synthesis scheme. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , DP107 exhibits potent antiviral activity against HIV.
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Leu-OH, Fmoc-Ile-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ala-OH, Fmoc-Gl
- DMF N -dimethylformamide
- HBTU O-benzotriazol-1-yl- N, N , N' , N' -tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- DMF N,N -dimethylformamide
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ), dissolved in 5 mL of CHCl 3 :NMM:HOAe (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide VITIELSNIKENKCNGAKVKLIKQELDKYKNAV (SEQ ID NO:16) is modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- the native sequence As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , the native sequence (SEQ ID NO.) inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.
- RSV respiratory syncytial virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide VITIELSNIKENKCNGAKVKLIKQELDKYKNAV (SEQ ID NO:17), which corresponds to the peptide of SEQ ID NO:16 but where a Cysteine (C) has been substitututed for the Methionine (M), residue is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- the native sequence (SEQ ID NO:16) inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBurOH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)
- Step 3 Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3).
- the resin is washed 3 times with N,N- dimethylformamide (DMF) and 3 times with isopropanol.
- the peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO: 14 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:14 inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.
- RSV respiratory syncytial virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Val-OH, Fmoc-Ly
- Step 1 Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N- dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x
- the peptide SEQ ID NO:15 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:15 inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.
- RSV respiratory syncytial virus
- Solid phase peptide synthesis of the modified peptide analog on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH
- DMF N,N -dimethylformamide
- HBTU O-benzotriazol-1-yl- N , N , N ', N '-tetramethyl-uronium hexafluorophosphate
- DIEA Diisoprop
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N- dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by R.P-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:17 which corresponds to SEQ ID NO:16 with a cysteine (C) substituted for the Methionine (M), is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- the native sequence SEQ ID NO:16 inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.
- RSV respiratory syncytial virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Leu
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6x5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:29 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:29 inhibits viral infection of respiratory syncytial virus (RSV), including inhibiting fusion and syncytia formation between RSV-infected and uninfected Hep-2 cells.
- RSV respiratory syncytial virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Ile-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Val-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Thr(
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N- dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:10.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5mL), DCM (6 x 5mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide
- the peptide SEQ ID NO:52 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:52 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
- HPIV3 human parainfluenza virus 3
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Val-OH, Fmoc-Ala-OH, Fmoc-Lys(Bo
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N , N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N- dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N- dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:58 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:58 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
- HPIV3 human parainfluenza virus 3
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Val-OH, Fmoc-Ser(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Val-OH, Fmoc-Ile-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Gln(Trt)-OH, F
- N N , N- dimethylformamide (DMF) and, according to the sequence, activated using O-benzotriazol-1-yl- N , N,N',N' -tetramethyl-uronium hexafluorophosphate (HBTU) and Diisopropylethylamine (DIEA).
- DMF N , N- dimethylformamide
- HBTU N,N',N' -tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N , N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD (II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21
- the peptide SEQ ID NO:35 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:35 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
- HPIV3 human parainfluenza virus 3
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ser(tBu)-OH,
- Step 1 Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 , dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:38 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO: 38 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1 W cells.
- HPIV3 human parainfluenza virus 3
- Solid phase peptide synthesis of the modified peptide analog on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 , (6 x 5mL), 20% HOAc in DCM (6 x 5mL), DCM (6 x 5mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:39 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:39 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
- HPIV3 human parainfluenza virus 3
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH, Fmoc-Trp(Boc)-OH,
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N , N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD-II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21
- the peptide SEQ ID NO:40 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO. inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1W cells.
- HPIV3 human parainfluenza virus 3
- Solid phase peptide synthesis of the modofied peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:41 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:41 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1 W cells.
- HPIV3 human parainfluenza virus 3
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Ile-OH
- N,N -dimethylformamide DMF
- HBTU N,N',N'- tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5mL), 20% HOAc in DCM (6 x 5mL), DCM (6 x 5mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N- dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:42 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:42 inhibits viral infection of human parainfluenza virus 3 (HPIV3), including inhibiting fusion and syncytia formation between HPIV3-infected Hep2 cells and uninfected CV-1 W cells.
- HPIV3 human parainfluenza virus 3
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-His(Boc)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Ile-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gly-OH, Fmoc-Asn(Trt)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Arg(
- N,N- dimethylformamide DMF
- HBTU N,N',N '-tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N , N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N- dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:77 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:77 inhibits viral infection of measles virus (MeV), including inhibiting fusion and syncytia formation between MeV-infected and uninfected Vero cells.
- MeV measles virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- N , N -dimethylformamide DMF
- HBTU O-benzotriazol-1-yl- N,N,N',N '-tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:79 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:79 inhibits viral infection of measles virus (MeV), including inhibiting fusion and syncytia formation between MeV-infected and uninfected Vero cells.
- MeV measles virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N- dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N- dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:81 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO: 79 inhibits viral infection of measles virus (MeV), including inhibiting fusion and syncytia formation between MeV-infected and uninfected Vero cells.
- MeV measles virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH,Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH
- N,N -dimethylformamide DMF
- HBTU O-benzotriazol-1-yl- N,N, N',N'- tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Step 1 Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N- dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO: 84 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:84 inhibits viral infection of measles virus (MeV), including inhibiting fusion and syncytia formation between MeV-infected and uninfected Vero cells.
- MeV measles virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Leu-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Asp(tBu)-OH,Fmoc-Ser(tBu)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Leu-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc
- N , N -dimethylformamide DMF
- HBTU N, N',N' -tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N , N- dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:64 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:64. exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmo
- N , N -dimethylfonnamide DMF
- HBTU O-benzotriazol-1-yl- N,N , N',N'- tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N , N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N-dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N-dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:65 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:65 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmo
- N,N- dimethylformamide DMF
- HBTU N,N',N'- tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:66 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:66 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fm
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in , N , N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloe) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N , N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:67 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:67 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc-
- N,N -dimethylformamide DMF
- HBTU O-benzotriazol-1-yl- N,N,N',N'- tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:68 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:68 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Glu(tBu)-OH, Fmoc
- N,N -dimethylformamide DMF
- HBTU N,N',N'- tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Step 1 Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N- dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:69 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:69 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmo
- N,N -dimethylformamide DMF
- HBTU N,N',N'- tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N , N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 , (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:70 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below.
- SEQ ID NO:70 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Met-OH, Fmoc-Asn(Trt)-OH, Fmoc-Lys(
- N,N -dimethylformamide DMF
- HBTU O-benzotriazol-1-yl- N,N , N',N' -tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N -dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:71 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:71 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- N,N -dimethylformamide DMF
- HBTU O-benzotriazol-1-yl- N,N,N',N' -tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3).
- the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol.
- DMF N,N -dimethylformamide
- the peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:72 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:72 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Gly-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-OH, Fmoc-Tyr(tBu)-OH
- N,N -dimethylformamide DMF
- HBTU O-benzotriazol-1-yl- N,N,N',N' -tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Step 1 Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N- dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- the synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N- dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N- dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
- the peptide SEQ ID NO:73 is synthesized and modified to include a linker and maleimide group according to the synthesis scheme set forth below. As reported in U.S. Pat. Nos. 6,013,236 and 6,020,459 , SEQ ID NO:73 exhibits potent antiviral activity as a crude peptide against simian immunodeficiency virus (SIV).
- SIV simian immunodeficiency virus
- Solid phase peptide synthesis of the modified peptide on a 100 ⁇ mole scale is performed using manual solid-phase synthesis, a Symphony Peptide Synthesizer and Fmoc protected Rink Amide MBHA.
- the following protected amino acids are sequentially added to resin: Fmoc-Lys(Aloc)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Gly-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-Asp(tBu)-OH, Fmoc-Trp(Boc)-OH, Fmoc-Ser(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Leu-OH, Fmoc-Lys(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Leu-OH, Fmoc-Glu(tBu)-
- N,N -dimethylformamide DMF
- HBTU O-benzotriazol-1-yl- N,N,N',N' -tetramethyl-uronium hexafluorophosphate
- DIEA Diisopropylethylamine
- Step 1 Removal of the Fmoc protecting group is achieved using a solution of 20% (V/V) piperidine in N,N- dimethylformamide (DMF) for 20 minutes (step 1).
- the selective deprotection of the Lys (Aloc) group is performed manually and accomplished by treating the resin with a solution of 3 eq of Pd(PPh 3 ) 4 dissolved in 5 mL of CHCl 3 :NMM:HOAc (18:1:0.5) for 2 h (Step 2).
- the resin is then washed with CHCl 3 (6 x 5 mL), 20% HOAc in DCM (6 x 5 mL), DCM (6 x 5 mL), and DMF (6 x 5 mL).
- Step 3 The synthesis is then re-automated for the addition of the 3-maleimidopropionic acid (Step 3). Between every coupling, the resin is washed 3 times with N,N -dimethylformamide (DMF) and 3 times with isopropanol. The peptide is cleaved from the resin using 85% TFA/5% TIS/5% thioanisole and 5% phenol, followed by precipitation by dry-ice cold Et 2 O (Step 4).
- DMF N,N -dimethylformamide
- the product is purified by preparative reversed phased HPLC using a Varian (Rainin) preparative binary HPLC system: gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm x 25 cm column and UV detector (Varian Dynamax UVD II) at ⁇ 214 and 254 nm to afford the desired modified peptide (i.e., DAC) in >95% purity, as determined by RP-HPLC.
- Varian (Rainin) preparative binary HPLC system gradient elution of 30-55% B (0.045% TFA in H 2 O (A) and 0.045% TFA in CH 3 CN (B)) over 180 min at 9.5 mL/min using a Phenomenex Luna 10 ⁇ phenyl-hexyl, 21 mm
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Tropical Medicine & Parasitology (AREA)
- AIDS & HIV (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Pulmonology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
Claims (18)
- Conjugué anti-fusogène comprenant la sérumalbumine et un peptide antiviral modifié, le peptide antiviral modifié comprenant un peptide qui présente une activité antivirale et anti-fusogène et un groupe maléimide couplé à celui-ci soit sans utiliser un groupe de liaison soit via un groupe de liaison qui est l'acide (2-amino)éthoxyacétique (AEA) ou l'acide [2-(2-amino)éthoxy]éthoxyacétique (AEEA), le peptide antiviral modifié étant lié de manière covalente via le groupe maléimide à un groupe thiol sur la sérumalbumine.
- Conjugué tel que revendiqué à la revendication 1 dans lequel le peptide est DP178 ou DP107 ou des analogues de ceux-ci.
- Conjugué tel que revendiqué dans l'une quelconque des revendications précédentes dans lequel le conjugué présente une activité antivirale et anti-fusogène contre le virus de l'immunodéficience humaine (HIV).
- Conjugué tel que revendiqué à la revendication 3 dans lequel le peptide est choisi parmi le groupe constitué de SEQ ID NO : 1 à SEQ ID NO : 9.
- Conjugué tel que revendiqué à la revendication 3 dans lequel le peptide est DP178 ou DP107.
- Conjugué tel que revendiqué à la revendication 1 dans lequel le conjugué présente une activité antivirale et anti-fusogène contre le virus respiratoire syncytial humain (RSV).
- Conjugué tel que revendiqué à la revendication 6 dans lequel le peptide est choisi parmi le groupe constitué de SEQ ID NO : 10 à SEQ ID NO : 30.
- Conjugué tel que revendiqué à la revendication 7 dans lequel le peptide est choisi parmi le groupe constitué de SEQ ID NO : 14 à SEQ ID NO : 17 et SEQ ID NO : 29.
- Conjugué tel que revendiqué à la revendication 1 dans lequel le conjugué présente une activité antivirale et anti-fusogène contre le virus parainfluenza humain (HPIV).
- Conjugué tel que revendiqué à la revendication 9 dans lequel le peptide est choisi parmi le groupe constitué de SEQ ID NO 31 à SEQ ID NO : 62.
- Conjugué tel que revendiqué à la revendication 10 dans lequel le peptide est choisi parmi le groupe constitué de SEQ ID NO : 35, SEQ ID NO : 38 à SEQ ID NO : 42, SEQ ID NO : 52 et SEQ ID NO : 58.
- Conjugué tel que revendiqué à la revendication 1 dans lequel le conjugué présente une activité antivirale et anti-fusogène contre le virus de la rougeole (MeV).
- Conjugué tel que revendiqué à la revendication 12 dans lequel le peptide est choisi parmi le groupe constitué de SEQ ID NO : 74 à SEQ ID NO : 86.
- Conjugué tel que revendiqué à la revendication 13 dans lequel le peptide est choisi parmi le groupe constitué de SEQ ID NO : 77, SEQ ID NO : 79, SEQ ID NO : 81 et SEQ ID NO : 84.
- Conjugué tel que revendiqué à la revendication 1 dans lequel le peptide présente une activité antivirale et anti-fusogène contre le virus de l'immunodéficience simienne (SIV).
- Conjugué tel que revendiqué à la revendication 15 dans lequel le peptide est choisi parmi le groupe constitué de SEQ ID NO : 63 à SEQ ID NO : 73.
- Conjugué tel que revendiqué dans l'une quelconque des revendications précédentes dans lequel le groupe maléimide est couplé au peptide via un groupe de liaison.
- Conjugué anti-fusogène tel que revendiqué dans l'une quelconque des revendications précédentes utilisable dans la prévention ou le traitement d'une infection virale.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP09009474A EP2110381A1 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs à action prolongée des infections virales |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US134406 | 1987-12-17 | ||
US13440699P | 1999-05-17 | 1999-05-17 | |
US15340699P | 1999-09-10 | 1999-09-10 | |
US153406 | 1999-09-10 | ||
EP00932570A EP1179012B2 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs a action prolongee des infections virales |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP00932570A Division EP1179012B2 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs a action prolongee des infections virales |
EP00932570A Division-Into EP1179012B2 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs a action prolongee des infections virales |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP09009474A Division EP2110381A1 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs à action prolongée des infections virales |
Publications (2)
Publication Number | Publication Date |
---|---|
EP1264840A1 EP1264840A1 (fr) | 2002-12-11 |
EP1264840B1 true EP1264840B1 (fr) | 2009-09-23 |
Family
ID=26832297
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP00932570A Expired - Lifetime EP1179012B2 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs a action prolongee des infections virales |
EP02014617A Expired - Lifetime EP1264840B1 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs à action prolongée des infections virales |
EP09009474A Withdrawn EP2110381A1 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs à action prolongée des infections virales |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP00932570A Expired - Lifetime EP1179012B2 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs a action prolongee des infections virales |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP09009474A Withdrawn EP2110381A1 (fr) | 1999-05-17 | 2000-05-17 | Peptides hybrides inhibiteurs à action prolongée des infections virales |
Country Status (14)
Country | Link |
---|---|
US (4) | US7582301B1 (fr) |
EP (3) | EP1179012B2 (fr) |
JP (3) | JP4216480B2 (fr) |
CN (1) | CN1351611A (fr) |
AT (2) | ATE443714T1 (fr) |
AU (1) | AU761591B2 (fr) |
BR (1) | BR0010757A (fr) |
CA (1) | CA2372338A1 (fr) |
DE (2) | DE60043021D1 (fr) |
DK (1) | DK1264840T3 (fr) |
ES (2) | ES2334106T3 (fr) |
HK (1) | HK1053128A1 (fr) |
PT (1) | PT1264840E (fr) |
WO (1) | WO2000069902A1 (fr) |
Families Citing this family (66)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6514500B1 (en) | 1999-10-15 | 2003-02-04 | Conjuchem, Inc. | Long lasting synthetic glucagon like peptide {GLP-!} |
US20090175821A1 (en) * | 1999-05-17 | 2009-07-09 | Bridon Dominique P | Modified therapeutic peptides with extended half-lives in vivo |
WO2000069911A1 (fr) | 1999-05-17 | 2000-11-23 | Conjuchem, Inc. | Peptides insulinotropes a longue duree d'action |
US20040266673A1 (en) * | 2002-07-31 | 2004-12-30 | Peter Bakis | Long lasting natriuretic peptide derivatives |
US6887470B1 (en) | 1999-09-10 | 2005-05-03 | Conjuchem, Inc. | Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components |
US7601691B2 (en) * | 1999-05-17 | 2009-10-13 | Conjuchem Biotechnologies Inc. | Anti-obesity agents |
DK1264840T3 (da) | 1999-05-17 | 2009-11-16 | Conjuchem Biotechnologies Inc | Langtidsvirkende fusionspeptidinhibitorer af viral infektion |
AU2002233089B2 (en) | 2001-02-16 | 2005-12-22 | Conjuchem Biotechnologies Inc. | Long lasting glucagon-like peptide 2 (GLP-2) for the treatment of gastrointestinal diseases and disorders |
DE60216151T2 (de) | 2001-05-31 | 2007-09-27 | ConjuChem Biotechnologies Inc., Montreal | Langwirkende Fusionspeptidinhibitoren gegen HIV-Infektion |
CA2450548C (fr) | 2001-06-15 | 2012-05-01 | F. Hoffmann-La Roche Ag | Acetylation de fragments gp41 |
EA007918B1 (ru) | 2002-09-24 | 2007-02-27 | Франтиэ Биотекнолоджиз Ко., Лтд. | Пептидные производные-ингибиторы слияния при вич-инфекции |
US7556813B2 (en) * | 2002-09-27 | 2009-07-07 | Trimeris, Inc. | Antiviral peptide-polymer conjugate comprising a polymer covalently attached to two or more synthetic HIV gp41 HR1 and/or HR2 peptides |
CA2443365C (fr) * | 2002-11-19 | 2010-01-12 | F. Hoffmann-La Roche Ag | Methodes de production par recombinaison de peptides antifusiogenes |
US20090123468A1 (en) | 2003-10-24 | 2009-05-14 | Gencia Corporation | Transducible polypeptides for modifying metabolism |
US8062891B2 (en) | 2003-10-24 | 2011-11-22 | Gencia Corporation | Nonviral vectors for delivering polynucleotides to plants |
US8133733B2 (en) | 2003-10-24 | 2012-03-13 | Gencia Corporation | Nonviral vectors for delivering polynucleotides to target tissues |
US8507277B2 (en) | 2003-10-24 | 2013-08-13 | Gencia Corporation | Nonviral vectors for delivering polynucleotides |
ES2411962T3 (es) | 2003-10-24 | 2013-07-09 | Gencia Corporation | Métodos y composiciones para suministrar polinucleótidos |
ES2347902T3 (es) * | 2004-04-23 | 2010-11-22 | Conjuchem Biotechnologies Inc. Canadian Corporation 4528590 | Fase solida para uso en un procedimiento para la purificacion de conjugados de albumina. |
US7723063B2 (en) * | 2004-04-28 | 2010-05-25 | Intrinsic Lifesciences | Methods for measuring levels of bioactive human hepcidin |
EP1747233A4 (fr) * | 2004-05-06 | 2007-04-25 | Composes pour cible virale specifique | |
WO2007053946A1 (fr) * | 2005-11-09 | 2007-05-18 | Conjuchem Biotechnologies Inc. | Procede de traitement du diabete et/ou de l'obesite en reduisant les effets secondaires nauseeux au moyen d'un peptide insulinotrope conjugue a de l'albumine |
CN101384623B (zh) * | 2005-12-22 | 2013-07-24 | 常山凯捷健生物药物研发(河北)有限公司 | 白蛋白与治疗剂的预成型偶联物的制备方法 |
CN101002945B (zh) | 2006-01-20 | 2012-09-05 | 清华大学 | 一种用于肿瘤治疗的新型复合物 |
CN100475270C (zh) | 2006-01-20 | 2009-04-08 | 清华大学 | 一种治疗肿瘤的药物及其应用 |
CA2651793C (fr) | 2006-02-02 | 2015-07-07 | Trimeris, Inc. | Peptides inhibiteurs de fusion du vih a proprietes biologiques ameliorees |
CN100366633C (zh) * | 2006-04-18 | 2008-02-06 | 河北师范大学 | 棕点湍蛙抗病毒多肽及其在制药中的应用 |
KR101105610B1 (ko) | 2006-08-17 | 2012-01-18 | 에프. 호프만-라 로슈 아게 | Ccr5 에 대한 항체 및 항푸소제닉 펩타이드의 컨쥬게이트 |
TW200817438A (en) | 2006-08-17 | 2008-04-16 | Hoffmann La Roche | A conjugate of an antibody against CCR5 and an antifusogenic peptide |
US20090099074A1 (en) * | 2007-01-10 | 2009-04-16 | Conjuchem Biotechnologies Inc. | Modulating food intake |
US20090088378A1 (en) * | 2007-01-12 | 2009-04-02 | Omar Quraishi | Long lasting inhibitors of viral infection |
TW200902544A (en) * | 2007-03-13 | 2009-01-16 | Hoffmann La Roche | Peptide-complement conjugates |
WO2008144584A2 (fr) * | 2007-05-16 | 2008-11-27 | Conjuchem Biotechnologies Inc. | Dérivés d'acide cystéique de peptides antiviraux |
CL2008002092A1 (es) | 2007-07-20 | 2009-05-29 | Hoffmann La Roche | Conjugado que contiene dos o mas peptidos antifusogenicos y un anticuerpo anti-cd-4; metodo de produccion; composicion farmaceutica que lo comprende; polipeptidos antifusogenicos y uso del conjugado para tratar infecciones viricas. |
EP2594583A1 (fr) | 2007-08-08 | 2013-05-22 | Novozymes Biopharma DK A/S | Variants de transferrine et conjugues |
EP2036980A1 (fr) * | 2007-09-14 | 2009-03-18 | Gruber, Jens | Dérégulation de l'expression génétique à l'aide de particules semblables à un virus chargées d'acide nucléique |
JP2011506442A (ja) * | 2007-12-11 | 2011-03-03 | コンジュケム バイオテクノロジーズ インコーポレイテッド | インスリン分泌性ペプチド結合体の製剤 |
SG2014012918A (en) | 2009-02-11 | 2014-04-28 | Novozymes Biopharma Dk As | Albumin variants and conjugates |
CN102481309B (zh) * | 2009-07-17 | 2014-06-18 | 翰林大学校产学协力团 | 包含脂质体包胶的寡核苷酸和表位的免疫刺激性组合物 |
CN105567699A (zh) | 2009-10-30 | 2016-05-11 | 诺维信生物制药丹麦公司 | 白蛋白变体 |
WO2011124718A1 (fr) | 2010-04-09 | 2011-10-13 | Novozymes A/S | Dérivés et variants d'albumine |
EP2616487B1 (fr) | 2010-09-14 | 2015-03-25 | F.Hoffmann-La Roche Ag | Polypeptide de fusion à serpine-doigt de zinc |
US20130225496A1 (en) | 2010-11-01 | 2013-08-29 | Novozymes Biopharma Dk A/S | Albumin Variants |
CN104011072B (zh) | 2011-05-05 | 2018-10-12 | 阿尔布梅迪克斯医疗有限公司 | 白蛋白变体 |
WO2013039861A2 (fr) | 2011-09-12 | 2013-03-21 | modeRNA Therapeutics | Acides nucléiques modifiés et leurs procédés d'utilisation |
US20140315817A1 (en) | 2011-11-18 | 2014-10-23 | Eleven Biotherapeutics, Inc. | Variant serum albumin with improved half-life and other properties |
EP3330283A3 (fr) | 2012-03-16 | 2018-07-11 | Albumedix A/S | Variants d'albumine |
CN104411338A (zh) | 2012-04-02 | 2015-03-11 | 现代治疗公司 | 用于产生与人类疾病相关的生物制剂和蛋白质的修饰多核苷酸 |
DE18200782T1 (de) | 2012-04-02 | 2021-10-21 | Modernatx, Inc. | Modifizierte polynukleotide zur herstellung von proteinen im zusammenhang mit erkrankungen beim menschen |
EP2834264A1 (fr) | 2012-04-04 | 2015-02-11 | Yeda Research and Development Co. Ltd. | Conjugués de lipopeptide comprenant un sphingolipide et des peptides dérivés de gp41 du vih |
US20140128326A1 (en) | 2012-11-08 | 2014-05-08 | Novozymes Biopharma Dk A/S | Albumin variants |
KR20150118123A (ko) | 2013-02-16 | 2015-10-21 | 노보자임스 바이오파마 디케이 에이/에스 | 약동학적 동물 모델 |
EP2981334A4 (fr) * | 2013-04-03 | 2016-11-23 | Univ California | Compositions et procédés d'inhibition de l'activité virale |
CN105992770B (zh) | 2013-11-01 | 2021-06-25 | 奥斯陆大学 | 白蛋白的变体及其用途 |
CN103864921B (zh) * | 2014-01-16 | 2017-12-26 | 苏州大学 | 双重靶向治疗癌症的叶酸‑阿霉素免疫制剂及其制备方法 |
WO2015140591A1 (fr) | 2014-03-21 | 2015-09-24 | Nordlandssykehuset Hf | Anticorps anti-cd14 et leurs utilisations |
WO2015164615A1 (fr) | 2014-04-24 | 2015-10-29 | University Of Oslo | Anticorps anti-gluten et leurs utilisations |
CA2989966C (fr) | 2015-08-20 | 2024-04-30 | Albumedix A/S | Variants de l'albumine et leurs conjugues |
CN108473559A (zh) | 2015-11-10 | 2018-08-31 | 威特拉公司 | 特异性结合脂多糖的抗体分子-药物共轭物及其应用 |
EP3535585A1 (fr) | 2016-11-04 | 2019-09-11 | Aarhus Universitet | Identification et traitement de tumeurs caractérisées par une surexpression du récepteur fc néonatal |
WO2018096396A1 (fr) | 2016-11-22 | 2018-05-31 | University Of Oslo | Variants d'albumine et leurs utilisations |
WO2018136626A1 (fr) | 2017-01-18 | 2018-07-26 | Visterra, Inc. | Conjugués molécule d'anticorps-médicament et leurs utilisations |
CN111303245B (zh) * | 2020-02-21 | 2023-06-27 | 成都奥达生物科技有限公司 | 一种抗合胞病毒膜融合抑制剂 |
CA3178465A1 (fr) | 2020-04-03 | 2021-10-07 | Visterra, Inc. | Conjugues molecule d'anticorps-medicament et leurs utilisations |
WO2021211303A1 (fr) * | 2020-04-14 | 2021-10-21 | Contrafect Corporation | Polypeptides antiviraux dérivés de bactériophages et leur utilisation contre des virus |
EP4442251A1 (fr) | 2023-04-05 | 2024-10-09 | Albumedix Ltd | Formulations et leurs utilisations |
Family Cites Families (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3719667A (en) | 1970-08-24 | 1973-03-06 | Lilly Co Eli | Epimerization of 6-acylamido and 6-imido penicillin sulfoxide esters |
US3840556A (en) | 1971-05-28 | 1974-10-08 | Lilly Co Eli | Penicillin conversion by halogen electrophiles and anti-bacterials derived thereby |
US4652629A (en) * | 1985-07-03 | 1987-03-24 | The Salk Institute For Biological Studies | Synthetic peptide-based anti-rabies compositions and methods |
US5116944A (en) * | 1989-12-29 | 1992-05-26 | Neorx Corporation | Conjugates having improved characteristics for in vivo administration |
US5612034A (en) * | 1990-10-03 | 1997-03-18 | Redcell, Inc. | Super-globuling for in vivo extended lifetimes |
JPH06509551A (ja) | 1991-04-05 | 1994-10-27 | ジェネンテク,インコーポレイテッド | Gp II↓bIII↓aに対する高い特異性を有する血小板凝集阻害剤 |
FR2686899B1 (fr) * | 1992-01-31 | 1995-09-01 | Rhone Poulenc Rorer Sa | Nouveaux polypeptides biologiquement actifs, leur preparation et compositions pharmaceutiques les contenant. |
AU688733B2 (en) | 1992-07-20 | 1998-03-19 | Duke University | Compounds which inhibit HIV replication |
GB9316895D0 (en) * | 1993-08-13 | 1993-09-29 | Guy S And St Thomas Hospitals | Hepatoselective insulin analogues |
EP0602290B1 (fr) * | 1992-12-04 | 1999-08-25 | ConjuChem, Inc. | Antigène de surface du virus de l'hépatite B conjugué à des anticorps et utilisation d'un tel conjugué |
US5614487A (en) | 1993-05-28 | 1997-03-25 | Genentech, Inc. | Sustained release pharmaceutical composition |
US6479055B1 (en) | 1993-06-07 | 2002-11-12 | Trimeris, Inc. | Methods for inhibition of membrane fusion-associated events, including respiratory syncytial virus transmission |
US5464933A (en) * | 1993-06-07 | 1995-11-07 | Duke University | Synthetic peptide inhibitors of HIV transmission |
US6017536A (en) | 1993-06-07 | 2000-01-25 | Trimeris, Inc. | Simian immunodeficiency virus peptides with antifusogenic and antiviral activities |
US6518013B1 (en) * | 1993-06-07 | 2003-02-11 | Trimeris, Inc. | Methods for the inhibition of epstein-barr virus transmission employing anti-viral peptides capable of abrogating viral fusion and transmission |
US6342225B1 (en) * | 1993-08-13 | 2002-01-29 | Deutshces Wollforschungsinstitut | Pharmaceutical active conjugates |
JP3871713B2 (ja) | 1995-05-10 | 2007-01-24 | 協和醗酵工業株式会社 | 新規毒素複合体 |
US6576636B2 (en) * | 1996-05-22 | 2003-06-10 | Protarga, Inc. | Method of treating a liver disorder with fatty acid-antiviral agent conjugates |
JP4086936B2 (ja) | 1996-10-03 | 2008-05-14 | 株式会社ブリヂストン | ダミーウェハ |
US6150088A (en) * | 1997-04-17 | 2000-11-21 | Whitehead Institute For Biomedical Research | Core structure of gp41 from the HIV envelope glycoprotein |
ES2178854T3 (es) * | 1997-11-07 | 2003-01-01 | Conjuchem Inc | Bibliotecas de marcadores de afinidad para albumina de suero humano. |
WO1999024462A2 (fr) * | 1997-11-07 | 1999-05-20 | Conjuchem, Inc. | Nouveaux conjugues de peptides renfermant rgd et supports endogenes |
US6107489A (en) * | 1998-03-17 | 2000-08-22 | Conjuchem, Inc. | Extended lifetimes in vivo renin inhibitors |
WO1999048536A2 (fr) | 1998-03-23 | 1999-09-30 | Conjuchem, Inc. | Apport local d'agents therapeutiques a action prolongee |
US6258782B1 (en) * | 1998-05-20 | 2001-07-10 | Trimeris, Inc. | Hybrid polypeptides with enhanced pharmacokinetic properties |
MXPA01003770A (es) * | 1998-10-13 | 2002-05-06 | Univ Georgia Res Found | Peptidos bioactivos estabilizados, y metodos de identificacion, sintesis y uso de los mismos. |
US20030190740A1 (en) * | 1998-10-13 | 2003-10-09 | The University Of Georgia Research Foundation, Inc | Stabilized bioactive peptides and methods of identification, synthesis, and use |
DK1264840T3 (da) | 1999-05-17 | 2009-11-16 | Conjuchem Biotechnologies Inc | Langtidsvirkende fusionspeptidinhibitorer af viral infektion |
US20090175821A1 (en) * | 1999-05-17 | 2009-07-09 | Bridon Dominique P | Modified therapeutic peptides with extended half-lives in vivo |
DE19926154A1 (de) | 1999-06-09 | 2000-12-14 | Ktb Tumorforschungs Gmbh | Verfahren zur Herstellung einer injizierbaren Arzneimittelzubereitung |
DE19926475A1 (de) | 1999-06-10 | 2000-12-14 | Ktb Tumorforschungs Gmbh | Träger-Pharmaka-Konjugate |
US7090851B1 (en) | 1999-09-10 | 2006-08-15 | Conjuchem Inc. | Long lasting fusion peptide inhibitors of viral infection |
DE60216151T2 (de) | 2001-05-31 | 2007-09-27 | ConjuChem Biotechnologies Inc., Montreal | Langwirkende Fusionspeptidinhibitoren gegen HIV-Infektion |
ES2347902T3 (es) * | 2004-04-23 | 2010-11-22 | Conjuchem Biotechnologies Inc. Canadian Corporation 4528590 | Fase solida para uso en un procedimiento para la purificacion de conjugados de albumina. |
EP1747233A4 (fr) * | 2004-05-06 | 2007-04-25 | Composes pour cible virale specifique |
-
2000
- 2000-05-17 DK DK02014617T patent/DK1264840T3/da active
- 2000-05-17 AU AU50271/00A patent/AU761591B2/en not_active Ceased
- 2000-05-17 US US09/623,533 patent/US7582301B1/en not_active Expired - Fee Related
- 2000-05-17 DE DE60043021T patent/DE60043021D1/de not_active Expired - Lifetime
- 2000-05-17 DE DE60000665T patent/DE60000665T3/de not_active Expired - Lifetime
- 2000-05-17 CA CA002372338A patent/CA2372338A1/fr not_active Abandoned
- 2000-05-17 BR BR0010757-3A patent/BR0010757A/pt not_active IP Right Cessation
- 2000-05-17 AT AT02014617T patent/ATE443714T1/de active
- 2000-05-17 PT PT02014617T patent/PT1264840E/pt unknown
- 2000-05-17 ES ES02014617T patent/ES2334106T3/es not_active Expired - Lifetime
- 2000-05-17 EP EP00932570A patent/EP1179012B2/fr not_active Expired - Lifetime
- 2000-05-17 EP EP02014617A patent/EP1264840B1/fr not_active Expired - Lifetime
- 2000-05-17 ES ES00932570T patent/ES2185595T5/es not_active Expired - Lifetime
- 2000-05-17 JP JP2000618318A patent/JP4216480B2/ja not_active Expired - Fee Related
- 2000-05-17 WO PCT/US2000/013651 patent/WO2000069902A1/fr active IP Right Grant
- 2000-05-17 CN CN00807671A patent/CN1351611A/zh active Pending
- 2000-05-17 AT AT00932570T patent/ATE226593T1/de not_active IP Right Cessation
- 2000-05-17 EP EP09009474A patent/EP2110381A1/fr not_active Withdrawn
-
2003
- 2003-06-10 HK HK03104059.7A patent/HK1053128A1/xx not_active IP Right Cessation
-
2004
- 2004-09-24 US US10/950,010 patent/US7608271B2/en not_active Expired - Fee Related
-
2007
- 2007-10-23 US US11/877,221 patent/US20080199483A1/en not_active Abandoned
- 2007-10-23 US US11/877,300 patent/US20080176794A1/en not_active Abandoned
- 2007-12-17 JP JP2007325307A patent/JP2008101021A/ja not_active Withdrawn
-
2009
- 2009-04-16 JP JP2009100410A patent/JP2009167208A/ja not_active Withdrawn
Also Published As
Publication number | Publication date |
---|---|
US20050070475A1 (en) | 2005-03-31 |
JP2009167208A (ja) | 2009-07-30 |
DE60000665T2 (de) | 2003-06-26 |
ES2334106T3 (es) | 2010-03-05 |
PT1264840E (pt) | 2010-01-04 |
JP2002544287A (ja) | 2002-12-24 |
EP1179012B2 (fr) | 2009-07-15 |
US7582301B1 (en) | 2009-09-01 |
ES2185595T5 (es) | 2009-12-17 |
EP1179012B9 (fr) | 2003-09-10 |
DK1264840T3 (da) | 2009-11-16 |
BR0010757A (pt) | 2002-02-19 |
JP2008101021A (ja) | 2008-05-01 |
ATE226593T1 (de) | 2002-11-15 |
EP1179012A1 (fr) | 2002-02-13 |
EP1264840A1 (fr) | 2002-12-11 |
DE60000665D1 (de) | 2002-11-28 |
CA2372338A1 (fr) | 2000-11-23 |
AU5027100A (en) | 2000-12-05 |
AU761591B2 (en) | 2003-06-05 |
US7608271B2 (en) | 2009-10-27 |
ATE443714T1 (de) | 2009-10-15 |
DE60043021D1 (de) | 2009-11-05 |
EP2110381A1 (fr) | 2009-10-21 |
ES2185595T3 (es) | 2003-05-01 |
JP4216480B2 (ja) | 2009-01-28 |
EP1179012B1 (fr) | 2002-10-23 |
US20080176794A1 (en) | 2008-07-24 |
HK1053128A1 (en) | 2003-10-10 |
WO2000069902A1 (fr) | 2000-11-23 |
DE60000665T3 (de) | 2009-10-29 |
CN1351611A (zh) | 2002-05-29 |
US20080199483A1 (en) | 2008-08-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1264840B1 (fr) | Peptides hybrides inhibiteurs à action prolongée des infections virales | |
EP1390399B1 (fr) | Inhibiteurs peptidiques de fusion longue duree contre les infections a vih | |
US7090851B1 (en) | Long lasting fusion peptide inhibitors of viral infection | |
US20090088377A1 (en) | Cysteic acid derivatives of anti-viral peptides | |
US20090088378A1 (en) | Long lasting inhibitors of viral infection | |
EP1479691B1 (fr) | Inhibiteurs peptidiques de fusion longue durée contre les infections à VIH | |
EP1752469B1 (fr) | Inhibiteurs peptidiques de fusion longue durée contre les infections à VIH | |
US20120065369A1 (en) | Long lasting fusion peptide inhibitors for hiv infection |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20020702 |
|
AC | Divisional application: reference to earlier application |
Ref document number: 1179012 Country of ref document: EP |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE |
|
AX | Request for extension of the european patent |
Free format text: AL PAYMENT 20020702;LT PAYMENT 20020702;LV PAYMENT 20020702;MK PAYMENT 20020702;RO PAYMENT 20020702;SI PAYMENT 20020702 |
|
17Q | First examination report despatched |
Effective date: 20030210 |
|
AKX | Designation fees paid |
Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE |
|
AXX | Extension fees paid |
Extension state: MK Payment date: 20020702 Extension state: LV Payment date: 20020702 Extension state: RO Payment date: 20020702 Extension state: SI Payment date: 20020702 Extension state: AL Payment date: 20020702 Extension state: LT Payment date: 20020702 |
|
RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: CONJUCHEM BIOTECHNOLOGIES INC. |
|
GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
GRAS | Grant fee paid |
Free format text: ORIGINAL CODE: EPIDOSNIGR3 |
|
GRAA | (expected) grant |
Free format text: ORIGINAL CODE: 0009210 |
|
AC | Divisional application: reference to earlier application |
Ref document number: 1179012 Country of ref document: EP Kind code of ref document: P |
|
AK | Designated contracting states |
Kind code of ref document: B1 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE |
|
AX | Request for extension of the european patent |
Extension state: AL LT LV MK RO SI |
|
REG | Reference to a national code |
Ref country code: GB Ref legal event code: FG4D |
|
REG | Reference to a national code |
Ref country code: CH Ref legal event code: EP |
|
REG | Reference to a national code |
Ref country code: IE Ref legal event code: FG4D |
|
REF | Corresponds to: |
Ref document number: 60043021 Country of ref document: DE Date of ref document: 20091105 Kind code of ref document: P |
|
REG | Reference to a national code |
Ref country code: SE Ref legal event code: TRGR |
|
REG | Reference to a national code |
Ref country code: DK Ref legal event code: T3 |
|
REG | Reference to a national code |
Ref country code: CH Ref legal event code: NV Representative=s name: PATENTANWAELTE SCHAAD, BALASS, MENZL & PARTNER AG |
|
REG | Reference to a national code |
Ref country code: PT Ref legal event code: SC4A Free format text: AVAILABILITY OF NATIONAL TRANSLATION Effective date: 20091223 |
|
REG | Reference to a national code |
Ref country code: GR Ref legal event code: EP Ref document number: 20090403121 Country of ref document: GR |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: FI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090923 |
|
REG | Reference to a national code |
Ref country code: ES Ref legal event code: FG2A Ref document number: 2334106 Country of ref document: ES Kind code of ref document: T3 Ref country code: HK Ref legal event code: GR Ref document number: 1053128 Country of ref document: HK |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: CY Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090923 |
|
PLBE | No opposition filed within time limit |
Free format text: ORIGINAL CODE: 0009261 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT |
|
26N | No opposition filed |
Effective date: 20100624 |
|
PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: LU Payment date: 20110429 Year of fee payment: 12 |
|
PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: IE Payment date: 20110426 Year of fee payment: 12 Ref country code: PT Payment date: 20110502 Year of fee payment: 12 Ref country code: GR Payment date: 20110427 Year of fee payment: 12 Ref country code: CH Payment date: 20110427 Year of fee payment: 12 Ref country code: FR Payment date: 20110621 Year of fee payment: 12 Ref country code: SE Payment date: 20110426 Year of fee payment: 12 Ref country code: MC Payment date: 20110426 Year of fee payment: 12 Ref country code: ES Payment date: 20110506 Year of fee payment: 12 |
|
PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: BE Payment date: 20110511 Year of fee payment: 12 Ref country code: DK Payment date: 20110427 Year of fee payment: 12 Ref country code: AT Payment date: 20110426 Year of fee payment: 12 Ref country code: GB Payment date: 20110503 Year of fee payment: 12 Ref country code: NL Payment date: 20110429 Year of fee payment: 12 |
|
PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: DE Payment date: 20110505 Year of fee payment: 12 Ref country code: IT Payment date: 20110430 Year of fee payment: 12 |
|
REG | Reference to a national code |
Ref country code: PT Ref legal event code: MM4A Free format text: LAPSE DUE TO NON-PAYMENT OF FEES Effective date: 20121119 |
|
BERE | Be: lapsed |
Owner name: CONJUCHEM BIOTECHNOLOGIES INC. Effective date: 20120531 |
|
REG | Reference to a national code |
Ref country code: NL Ref legal event code: V1 Effective date: 20121201 |
|
REG | Reference to a national code |
Ref country code: LT Ref legal event code: MM9D Effective date: 20120517 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: MC Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120531 |
|
REG | Reference to a national code |
Ref country code: CH Ref legal event code: PL |
|
REG | Reference to a national code |
Ref country code: SE Ref legal event code: EUG |
|
REG | Reference to a national code |
Ref country code: AT Ref legal event code: MM01 Ref document number: 443714 Country of ref document: AT Kind code of ref document: T Effective date: 20120517 |
|
REG | Reference to a national code |
Ref country code: DK Ref legal event code: EBP |
|
GBPC | Gb: european patent ceased through non-payment of renewal fee |
Effective date: 20120517 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LI Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120531 Ref country code: AT Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120517 Ref country code: CH Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120531 |
|
REG | Reference to a national code |
Ref country code: GR Ref legal event code: ML Ref document number: 20090403121 Country of ref document: GR Effective date: 20121204 |
|
REG | Reference to a national code |
Ref country code: IE Ref legal event code: MM4A |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: PT Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20121119 Ref country code: BE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120531 Ref country code: SE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120518 Ref country code: IT Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120517 Ref country code: GR Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20121204 |
|
REG | Reference to a national code |
Ref country code: FR Ref legal event code: ST Effective date: 20130131 |
|
REG | Reference to a national code |
Ref country code: DE Ref legal event code: R119 Ref document number: 60043021 Country of ref document: DE Effective date: 20121201 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: NL Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20121201 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: DK Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120531 Ref country code: FR Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120531 Ref country code: IE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120517 Ref country code: GB Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120517 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: DE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20121201 |
|
REG | Reference to a national code |
Ref country code: ES Ref legal event code: FD2A Effective date: 20130821 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: ES Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120518 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LU Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120517 |