DK63479A - Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer - Google Patents

Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer

Info

Publication number
DK63479A
DK63479A DK63479A DK63479A DK63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A DK 63479 A DK63479 A DK 63479A
Authority
DK
Denmark
Prior art keywords
dehydrocyclic
preparing
acid derivatives
imino acid
imino
Prior art date
Application number
DK63479A
Other languages
Danish (da)
English (en)
Inventor
M A Ondetti
S I Natarajan
Original Assignee
Squibb & Sons Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Squibb & Sons Inc filed Critical Squibb & Sons Inc
Publication of DK63479A publication Critical patent/DK63479A/da

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D211/00Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
    • C07D211/04Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D211/68Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member
    • C07D211/72Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, directly attached to ring carbon atoms
    • C07D211/78Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C327/00Thiocarboxylic acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D207/00Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D207/02Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D207/18Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member
    • C07D207/22Heterocyclic compounds containing five-membered rings not condensed with other rings, with one nitrogen atom as the only ring hetero atom with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Hydrogenated Pyridines (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
  • Pyrrole Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
DK63479A 1978-02-15 1979-02-14 Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer DK63479A (da)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
US05/878,144 US4129566A (en) 1978-02-15 1978-02-15 Derivatives of dehydrocyclicimino acids

Publications (1)

Publication Number Publication Date
DK63479A true DK63479A (da) 1979-08-16

Family

ID=25371470

Family Applications (1)

Application Number Title Priority Date Filing Date
DK63479A DK63479A (da) 1978-02-15 1979-02-14 Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer

Country Status (35)

Country Link
US (3) US4129566A (OSRAM)
JP (1) JPS54125683A (OSRAM)
AR (1) AR222481A1 (OSRAM)
AT (1) AT375919B (OSRAM)
AU (1) AU520475B2 (OSRAM)
BE (1) BE874202A (OSRAM)
CA (1) CA1124725A (OSRAM)
CH (1) CH636608A5 (OSRAM)
CS (1) CS213370B2 (OSRAM)
DD (1) DD141670A5 (OSRAM)
DE (1) DE2904823A1 (OSRAM)
DK (1) DK63479A (OSRAM)
EG (1) EG13875A (OSRAM)
ES (1) ES477695A1 (OSRAM)
FI (1) FI67369C (OSRAM)
FR (1) FR2417500A1 (OSRAM)
GB (1) GB2014573B (OSRAM)
GR (1) GR74445B (OSRAM)
HK (1) HK35882A (OSRAM)
HU (1) HU178115B (OSRAM)
IE (1) IE48072B1 (OSRAM)
IL (1) IL56606A0 (OSRAM)
IN (1) IN151091B (OSRAM)
IT (1) IT1113713B (OSRAM)
LU (1) LU80925A1 (OSRAM)
NL (1) NL7901197A (OSRAM)
NO (1) NO153054C (OSRAM)
NZ (1) NZ189574A (OSRAM)
PH (1) PH14730A (OSRAM)
PL (1) PL116509B1 (OSRAM)
PT (1) PT69224A (OSRAM)
RO (1) RO76614A (OSRAM)
SU (1) SU860697A1 (OSRAM)
YU (1) YU36379A (OSRAM)
ZA (1) ZA79483B (OSRAM)

Families Citing this family (58)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ZA794723B (en) * 1978-09-11 1980-08-27 Univ Miami Anti-hypertensive agents
US4690939A (en) * 1979-08-14 1987-09-01 University Of Miami Anti-hypertensive agents
US4690940A (en) * 1979-08-14 1987-09-01 University Of Miami Anti-hypertensive agents
US4698355A (en) * 1979-08-14 1987-10-06 University Of Miami Anti-hypertensive agents
US4690937A (en) * 1979-08-14 1987-09-01 University Of Miami Anti-hypertensive agents
US4690938A (en) * 1979-08-14 1987-09-01 University Of Miami Anti-hypertensive agents
US4695577A (en) * 1979-08-14 1987-09-22 University Of Miami Anti-hypertensive agents
US4698356A (en) * 1979-08-14 1987-10-06 University Of Miami Anti-hypertensive agents
US4217458A (en) * 1978-12-08 1980-08-12 E. R. Squibb & Sons, Inc. Acylmercaptoacyl derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids
US4198515A (en) * 1978-12-08 1980-04-15 E. R. Squibb & Sons, Inc. Mercaptoacyl derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids
US4211786A (en) * 1979-03-08 1980-07-08 E. R. Squibb & Sons, Inc. Mercaptoacyldihydropyrazole carboxylic acid derivatives
US4220791A (en) * 1979-03-08 1980-09-02 E. R. Squibb & Sons, Inc. Mercaptoacylpyrazolidinone carboxylic acid derivatives
FR2455585A1 (fr) * 1979-05-04 1980-11-28 Ono Pharmaceutical Co Derives d'oxoaminoacides, procede de fabrication et composition pharmaceutique
US4234489A (en) * 1979-06-25 1980-11-18 E. R. Squibb & Sons, Inc. Pyroglutamic acid derivatives and analogs
US4221912A (en) * 1979-08-22 1980-09-09 E. R. Squibb & Sons, Inc. Dithio derivatives of 4,5-dihydro-1H-pyrrole-2-carboxylic acids and 1,4,5,6-tetrahydropyridine-2-carboxylic acids
US4221804A (en) * 1979-09-27 1980-09-09 Rovnyak George C Mercaptoacyldihydropyrazole carboxylic acid derivatives
US4356182A (en) * 1979-10-22 1982-10-26 E. R. Squibb & Sons, Inc. Mercaptoacyl derivatives of 4-disubstituted prolines
US4291040A (en) * 1979-10-22 1981-09-22 E. R. Squibb & Sons, Inc. Mercaptoacyl derivatives of 4-disubstituted prolines and 4-substituted dehydroprolines
US4266065A (en) * 1980-04-14 1981-05-05 E. R. Squibb & Sons, Inc. Mercaptoacyldihydropyrazole carboxylic acid derivatives
US4308392A (en) * 1979-12-03 1981-12-29 E. R. Squibb & Sons, Inc. Hydroxamic acid derivatives of mercaptoacyl amino acids
US4284561A (en) * 1979-12-03 1981-08-18 E. R. Squibb & Sons, Inc. Hydroxamic acid derivatives of mercaptoacyl amino acids
IE50839B1 (en) * 1980-02-26 1986-07-23 Wyeth John & Brother Ltd Novel processes for preparing proline derivatives and analogous compounds
US4690936A (en) * 1980-03-05 1987-09-01 University Of Miami Anti-hypertensive agents
US4692458A (en) * 1980-03-05 1987-09-08 University Of Miami Anti-hypertensive agents
US4734420A (en) * 1980-03-05 1988-03-29 University Of Miami Anti-hypertensive agents
US4350704A (en) * 1980-10-06 1982-09-21 Warner-Lambert Company Substituted acyl derivatives of octahydro-1H-indole-2-carboxylic acids
US4284624A (en) * 1980-05-02 1981-08-18 E. R. Squibb & Sons, Inc. Mixed disulfides
US4310461A (en) * 1980-06-23 1982-01-12 E. R. Squibb & Sons, Inc. Imido, amido and amino derivatives of mercaptoacyl prolines and pipecolic acids
US4344949A (en) * 1980-10-03 1982-08-17 Warner-Lambert Company Substituted acyl derivatives of 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acids
US4456761A (en) * 1981-02-02 1984-06-26 E. R. Squibb & Sons, Inc. 4-Substituted dehydroprolines
US4499287A (en) * 1981-02-02 1985-02-12 E. R. Squibb & Sons, Inc. Certain-4-hydroxy-proline derivatives
US4532342A (en) * 1981-02-20 1985-07-30 Warner-Lambert Company N-substituted amino acids as intermediates in the preparation of acyl derivatives of 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acids
US4416831A (en) * 1981-04-27 1983-11-22 E. R. Squibb & Sons, Inc. Amino and substituted amino phosphinylalkanoyl compounds
US4374131A (en) * 1981-04-27 1983-02-15 E. R. Squibb & Sons, Inc. Amino and substituted amino phosphinyl-alkanoyl compounds
US4381297A (en) * 1981-05-04 1983-04-26 E. R. Squibb & Sons, Inc. Substituted carbonyl phosphinyl-alkanoyl compounds
US4416833A (en) * 1981-05-04 1983-11-22 E. R. Squibb & Sons, Inc. Substituted carbonyl phosphinyl-alkanoyl compounds
US4432971A (en) * 1981-08-03 1984-02-21 E. R. Squibb & Sons, Inc. Phosphonamidate compounds
US4503043A (en) * 1981-12-07 1985-03-05 Warner-Lambert Company Substituted acyl derivatives of octahydro-1H-isoindole-1-carboxylic acids
US4555506A (en) * 1981-12-24 1985-11-26 E. R. Squibb & Sons, Inc. Phosphorus containing compounds and use as hypotensives
US4560680A (en) * 1982-03-15 1985-12-24 E. R. Squibb & Sons, Inc. Aminoalkyl and related substituted phosphinic acid angiotensin converting enzyme inhibitors
US4452791A (en) * 1982-03-15 1984-06-05 E. R. Squibb & Sons, Inc. Aminoalkyl and related substituted phosphinic acid angiotensin converting enzyme inhibitors
US4560681A (en) * 1982-04-22 1985-12-24 E. R. Squibb & Sons, Inc. Phosphinylmethylaminocarbonyl imino acid compounds useful for treating hypertension
US4448772A (en) * 1982-04-22 1984-05-15 E. R. Squibb & Sons, Inc. Phosphinylmethylaminocarbonyl imino acid compounds useful for treating hypertension
US4452790A (en) * 1982-06-23 1984-06-05 E. R. Squibb & Sons, Inc. Phosphonyl hydroxyacyl amino acid derivatives as antihypertensives
US4703043A (en) * 1982-06-23 1987-10-27 E. R. Squibb & Sons, Inc. Phosphonyl hydroxyacyl amino acid derivatives as antihypertensive
US4616005A (en) * 1982-06-23 1986-10-07 E. R. Squibb & Sons, Inc. Phosphonyl hydroxyacyl amino acid derivatives as antihypertensives
US4567166A (en) * 1982-07-14 1986-01-28 E. R. Squibb & Sons, Inc. Amino and substituted amino phosphinylalkanoyl compounds useful for treating hypertension
US4736066A (en) * 1982-07-19 1988-04-05 E. R. Squibb & Sons, Inc. Intermediate for substituted peptide compounds
US4470973A (en) * 1982-07-19 1984-09-11 E. R. Squibb & Sons, Inc. Substituted peptide compounds
US4742067A (en) * 1982-07-22 1988-05-03 E. R. Squibb & Sons, Inc. Acylalkylaminocarbonyl substituted amino and imino acid compounds
US4623729A (en) 1982-07-22 1986-11-18 E. R. Squibb & Sons, Inc. Acylalkylaminocarbonyl substituted amino and imino acid compounds
US4621092A (en) * 1982-07-22 1986-11-04 E. R. Squibb & Sons, Inc. Substituted proline compounds, composition and method of use
US4524212A (en) * 1982-09-27 1985-06-18 E. R. Squibb & Sons, Inc. Acyloxyketone substituted imino and amino acids
US4514391A (en) * 1983-07-21 1985-04-30 E. R. Squibb & Sons, Inc. Hydroxy substituted peptide compounds
AU632596B2 (en) * 1989-08-21 1993-01-07 E.R. Squibb & Sons, Inc. Phosphonate substituted amino or imino acids useful as antihypertensives
GB9016476D0 (en) * 1990-07-27 1990-09-12 Sandoz Ltd Improvements in or relating to organic compounds
WO2000059483A2 (en) * 1999-04-01 2000-10-12 Alza Corporation Transdermal drug delivery devices comprising a polyurethane drug reservoir
EP3187869B1 (en) * 2014-08-29 2023-03-08 Kyocera Corporation Sensor device and sensing method

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3531490A (en) * 1968-09-06 1970-09-29 Us Agriculture S-beta-(4-pyridylethyl)-l-cysteine
US3917815A (en) * 1969-09-04 1975-11-04 Oreal Cosmetic compositions containing N-oxypyridyl derivatives
US4066658A (en) * 1975-08-11 1978-01-03 Hoffmann-La Roche Inc. Resolution of d,l-dehydroproline
US4105776A (en) * 1976-06-21 1978-08-08 E. R. Squibb & Sons, Inc. Proline derivatives and related compounds
US4046889A (en) * 1976-02-13 1977-09-06 E. R. Squibb & Sons, Inc. Azetidine-2-carboxylic acid derivatives
AU509899B2 (en) * 1976-02-13 1980-05-29 E.R. Squibb & Sons, Inc. Proline derivatives and related compounds

Also Published As

Publication number Publication date
NZ189574A (en) 1981-05-15
US4129566A (en) 1978-12-12
ZA79483B (en) 1980-03-26
PH14730A (en) 1981-11-19
PT69224A (en) 1979-03-01
IN151091B (OSRAM) 1983-02-19
BE874202A (fr) 1979-08-16
CA1124725A (en) 1982-06-01
AU4400679A (en) 1979-08-23
IT7947986A0 (it) 1979-02-13
DE2904823A1 (de) 1979-08-16
CS213370B2 (en) 1982-04-09
FI67369B (fi) 1984-11-30
HK35882A (en) 1982-08-20
ES477695A1 (es) 1979-10-16
NL7901197A (nl) 1979-08-17
ATA118879A (de) 1984-02-15
NO790495L (no) 1979-08-16
IL56606A0 (en) 1979-05-31
SU860697A1 (ru) 1981-08-30
NO153054B (no) 1985-09-30
IE48072B1 (en) 1984-09-19
US4154942A (en) 1979-05-15
IT1113713B (it) 1986-01-20
PL116509B1 (en) 1981-06-30
CH636608A5 (fr) 1983-06-15
AR222481A1 (es) 1981-05-29
JPS54125683A (en) 1979-09-29
FI790502A7 (fi) 1979-08-16
LU80925A1 (fr) 1979-06-18
US4156084A (en) 1979-05-22
GB2014573A (en) 1979-08-30
EG13875A (en) 1982-09-30
GB2014573B (en) 1982-05-06
FI67369C (fi) 1985-03-11
FR2417500B1 (OSRAM) 1982-10-22
AT375919B (de) 1984-09-25
JPS643870B2 (OSRAM) 1989-01-23
HU178115B (en) 1982-03-28
NO153054C (no) 1986-01-08
IE790292L (en) 1979-08-15
PL213449A1 (OSRAM) 1979-12-03
YU36379A (en) 1983-04-30
RO76614A (ro) 1981-04-30
FR2417500A1 (fr) 1979-09-14
AU520475B2 (en) 1982-02-04
DD141670A5 (de) 1980-05-14
GR74445B (OSRAM) 1984-06-28

Similar Documents

Publication Publication Date Title
DK63479A (da) Fremgangsmaade til fremstilling af derivater af dehydrocycliske iminosyrer
DK491780A (da) Fremgangsmaade til fremstilling af cephalosporansyrederivater
DK336783D0 (da) Fremgangsmade til fremstilling af methylendiphosphonsyrederivater
DK160679A (da) Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid
DK251079A (da) Fremgangsmaade til fremstilling af phenylpiperazinderivater
DK520679A (da) Fremgangsmaade til fremstilling af 3-quinolincarboxulsyrederivater
DK158670C (da) Fremgangsmaade til fremstilling af 6beta-halogensubstituerede penicillansyrederivater
DK357782A (da) Fremgangsmaade til fremstilling af tetrahydrofurancarboxylsyrederivater
DK99980A (da) Fremgangsmaade til fremstilling af mercaptoacyldihydropyrazolcarboxylsyrederivater
DK554481A (da) Fremgangsmaade til fremstilling af cephalosporansyrederivater
DK152752C (da) Fremgangsmaade til fremstilling af l-sulpirid
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
DK344679A (da) Fremgangsmaade til fremstilling af arylglyoxylsyrer
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
DK160312C (da) Fremgangsmaade til fremstilling af derivater af 7-aminothiazolylacetamidocephalosporansyre
DK154554C (da) Fremgangsmaade til fremstilling af alfa-methyl-carbazol-2-eddikesyrederivater
DK444279A (da) Fremgangsmaade til fremstilling af 6-hydroxymethyl-2-(beta-aminoethylthio)-1-carbadethiapen-2-em-3-carboxylsyre
DK36379A (da) Fremgangsmaade til fremstilling af n-ethylethylendiamin
DK143107C (da) Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin
DK154880A (da) Fremgangsmaade til fremstilling af derivater af 6beta-amidinopenicillansyre
DK147420C (da) Fremgangsmaade til fremstilling af acylcyanider
DK195979A (da) Fremgangsmaade til fremstilling af d-homosteroider
PL208226A1 (pl) Sposob wytwarzania nowych pochodnych kwasu trojfluorometylofenoksy-fenoksykrotonowego
DK160494C (da) Fremgangsmaade til fremstilling af 5-bromtetrazolyl-1-eddikesyre
DK276080A (da) Fremgangsmaade til fremstilling af penicillansyrederivater

Legal Events

Date Code Title Description
AHB Application shelved due to non-payment