DK147318C - Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf - Google Patents

Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf

Info

Publication number
DK147318C
DK147318C DK110174A DK110174A DK147318C DK 147318 C DK147318 C DK 147318C DK 110174 A DK110174 A DK 110174A DK 110174 A DK110174 A DK 110174A DK 147318 C DK147318 C DK 147318C
Authority
DK
Denmark
Prior art keywords
tetrahydropyridines
piperidines
benzofuranyl
racemic
analogue
Prior art date
Application number
DK110174A
Other languages
Danish (da)
English (en)
Other versions
DK147318B (da
Inventor
Karl Schenker
Raymond Bernasconi
Original Assignee
Ciba Geigy Ag
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ciba Geigy Ag filed Critical Ciba Geigy Ag
Priority to DK283278A priority Critical patent/DK147051C/da
Publication of DK147318B publication Critical patent/DK147318B/da
Application granted granted Critical
Publication of DK147318C publication Critical patent/DK147318C/da

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D213/00Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
    • C07D213/02Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
    • C07D213/04Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D213/24Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
    • C07D213/28Radicals substituted by singly-bound oxygen or sulphur atoms
    • C07D213/30Oxygen atoms
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/24Antidepressants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/26Psychostimulants, e.g. nicotine, cocaine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D405/00Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
    • C07D405/02Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
    • C07D405/04Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings directly linked by a ring-member-to-ring-member bond

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Psychiatry (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Pain & Pain Management (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Pyridine Compounds (AREA)
  • Hydrogenated Pyridines (AREA)
DK110174A 1973-03-02 1974-03-01 Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf DK147318C (da)

Priority Applications (1)

Application Number Priority Date Filing Date Title
DK283278A DK147051C (da) 1973-03-02 1978-06-23 Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive 4-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
CH310373 1973-03-02
CH310373A CH592656A5 (en, 2012) 1973-03-02 1973-03-02

Publications (2)

Publication Number Publication Date
DK147318B DK147318B (da) 1984-06-18
DK147318C true DK147318C (da) 1984-12-24

Family

ID=4248678

Family Applications (1)

Application Number Title Priority Date Filing Date
DK110174A DK147318C (da) 1973-03-02 1974-03-01 Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf

Country Status (24)

Country Link
US (1) US4210655A (en, 2012)
JP (2) JPS599557B2 (en, 2012)
AR (4) AR205619A1 (en, 2012)
AT (1) AT336014B (en, 2012)
BE (1) BE811767A (en, 2012)
CA (1) CA1045139A (en, 2012)
CH (1) CH592656A5 (en, 2012)
CS (5) CS176296B2 (en, 2012)
DD (1) DD113007A5 (en, 2012)
DE (1) DE2408476A1 (en, 2012)
DK (1) DK147318C (en, 2012)
ES (1) ES423711A1 (en, 2012)
FR (1) FR2219781B1 (en, 2012)
GB (1) GB1465581A (en, 2012)
HU (1) HU172464B (en, 2012)
IE (1) IE38907B1 (en, 2012)
IL (1) IL44237A (en, 2012)
LU (1) LU69510A1 (en, 2012)
MX (1) MX3765E (en, 2012)
NL (1) NL179206C (en, 2012)
SE (1) SE410856B (en, 2012)
SU (6) SU560531A3 (en, 2012)
YU (2) YU52374A (en, 2012)
ZA (1) ZA741362B (en, 2012)

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CH609054A5 (en) * 1975-11-26 1979-02-15 Ciba Geigy Ag Process for the preparation of a novel piperidine derivative
EP0006524A1 (de) 1978-06-22 1980-01-09 Ciba-Geigy Ag Neue Tetrahydropyridin- und Piperidinderivate und deren Säureadditionssalze, Verfahren zu deren Herstellung und solche enthaltende pharmazeutische Zusammensetzungen
US4284638A (en) * 1978-11-21 1981-08-18 Ciba-Geigy Corporation Pharmaceutical compositions with central depressant and antipsychotic activity having a butyrophenone derivative which is substituted in the 4-position and a C-(2-benzofuranyl)-piperidine or C-(2-benzofuranyl)-tetrahydro-pyridine
US5045551A (en) * 1989-09-19 1991-09-03 Allergan, Inc. Acetylenes disubstituted with a heteroaromatic group and a 2-substituted chromanyl, thiochromanyl or 1,2,3,4-tetrahydroquinolinyl group having retinoid-like activity
US5455254A (en) * 1991-02-15 1995-10-03 Mondadori; Cesare Substituted benzofuranylpiperidine as a nootropic agent
RU2095339C1 (ru) * 1991-10-17 1997-11-10 Циба-Гейги АГ Производные гидрохинона в свободном виде или в виде соли, способы их получения, производные пиперидина и способы их получения
JPH07503972A (ja) * 1992-02-21 1995-04-27 ノバルティス アクチェンゲゼルシャフト 外傷後のストレスの治療用薬剤としてのブロファロミン
US5693807A (en) * 1992-10-14 1997-12-02 Ciba-Geigy Corporation Substituted hydroquinone derivatives
ES2132284T3 (es) * 1993-08-05 1999-08-16 Hoechst Marion Roussel Inc Derivados de carbamato de 2-(piperidin-4-il, piridin-4-il y tetrahidropiridin-4-il)-benzofurano-7, su preparacion y su uso como inhibidores de acetilcolinesterasa.
GB9605065D0 (en) * 1996-03-11 1996-05-08 Merck Sharp & Dohme Therapeutic agents
WO2000073269A2 (en) * 1999-06-02 2000-12-07 Regents Of The University Of Minnesota Nicotine receptor ligands
US8796306B2 (en) 2010-06-23 2014-08-05 Sumitomo Chemical Company, Limited Noxious arthropod controlling composition and heterocyclic compound

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1041525A (en) * 1964-11-11 1966-09-07 Belge Produits Chimiques Sa Benzofuran derivatives and processes for preparing the same
FR1461633A (fr) * 1964-11-11 1966-02-25 Belge Produits Chimiques Sa Nouveaux dérivés benzofuranniques, leurs sels et procédés de préparation de cesdérivés et de leurs sels
IE39264B1 (en) * 1973-05-25 1978-08-30 Ciba Geigy Ag New pharmaceutical preparations

Also Published As

Publication number Publication date
ES423711A1 (es) 1977-01-16
MX3765E (es) 1981-06-25
CA1045139A (en) 1978-12-26
DE2408476C2 (en, 2012) 1990-12-06
DE2408476A1 (de) 1974-09-12
US4210655A (en) 1980-07-01
SU651702A3 (ru) 1979-03-05
IE38907L (en) 1974-09-02
AR210858A1 (es) 1977-09-30
YU52374A (en) 1982-06-18
SU649321A3 (ru) 1979-02-25
IL44237A0 (en) 1974-05-16
IE38907B1 (en) 1978-06-21
AU6619274A (en) 1975-09-04
SU560531A3 (ru) 1977-05-30
ZA741362B (en) 1975-01-29
CS176297B2 (en, 2012) 1977-06-30
CS176296B2 (en, 2012) 1977-06-30
SU646911A4 (ru) 1979-02-05
HU172464B (hu) 1978-09-28
JPS599557B2 (ja) 1984-03-03
JPS6046115B2 (ja) 1985-10-14
AR205619A1 (es) 1976-05-21
SE410856B (sv) 1979-11-12
YU212380A (en) 1983-04-27
BE811767A (fr) 1974-09-02
NL7402755A (en, 2012) 1974-09-04
AT336014B (de) 1977-04-12
NL179206C (nl) 1986-08-01
FR2219781B1 (en, 2012) 1977-07-01
CS176266B2 (en, 2012) 1977-06-30
GB1465581A (en) 1977-02-23
JPS584781A (ja) 1983-01-11
CS176299B2 (en, 2012) 1977-06-30
DD113007A5 (en, 2012) 1975-05-12
SU651703A3 (ru) 1979-03-05
AR211860A1 (es) 1978-03-31
IL44237A (en) 1977-08-31
LU69510A1 (en, 2012) 1975-12-09
JPS49117474A (en, 2012) 1974-11-09
CS176298B2 (en, 2012) 1977-06-30
ATA170674A (de) 1976-08-15
AR208554A1 (es) 1977-02-15
YU37163B (en, 2012) 1984-08-31
CH592656A5 (en, 2012) 1977-10-31
FR2219781A1 (en, 2012) 1974-09-27
SU612630A3 (ru) 1978-06-25
DK147318B (da) 1984-06-18

Similar Documents

Publication Publication Date Title
DK136904B (da) Analogifremgangsmade til fremstilling af racemiske eller optisk aktive 2-(heteroarylmethyl)-5,9beta-dialkyl-6,7-benzomorphaner eller syreadditionssalte deraf
DK142750C (da) Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive dopaminderivater eller syreadditionssalte deraf
DK143128C (da) Analogifremgangsmaade til fremstilling af 1-aryloxy-2-hydroxy-3-alkynylaminopropaner eller deres fysiologisk acceptable syreadditionssalte
DK140281B (da) Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive 1-phenoxy-2-hydroxy-3-cycloalkylaminopropaner eller syreadditionssalte heraf.
DK136527B (da) Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive p-alkoxyfenoxypropanolaminer eller syreadditionssalte deraf.
DK147318C (da) Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf
DK125021B (da) Analogifremgangsmåde til fremstilling af 1,2,3,4-tetrahydro-4-phenyl-isoquinolinderivater eller syreadditionssalte deraf eller de tilsvarende optisk aktive forbindelser.
DK137234B (da) Analogifremgangsmåde til fremstilling af racemisk eller optisk aktiv 1-isopropylamino-3-(4-(2-isopropylkarbamoylaminoætyl)-fenoxy)-propanol-2 eller syreadditionssalte deraf.
DK144094C (da) Analogifremgangsmaade til fremstilling af n-substituerede 3-hydroxy-8-oxamorphinaner eller syreadditionssalte deraf
DK153157C (da) Analogifremgangsmaade til fremstilling af 7-alfa-aminoacyl-3-halogen-cephalosporinderivater eller farmaceutisk acceptable syreadditionssalte deraf
DK129127B (da) Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive 2-(furylmethyl)-6,7-benzomorphaner eller deres syreadditionssalte.
DK143445C (da) Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive substituerede 1,1-diphenyl-3-amino-propanol-forbindelser
DK145574C (da) Analogifremgangsmaade til fremstilling af substituerede cyclopropylalkylaminer eller syreadditionssalte deraf
DK141875C (da) Analogifremgangsmaade til fremstilling af normorphinonderivater eller syreadditionssalte deraf
DK125639B (da) Analogifremgangsmåde til fremstilling af racemisk eller optisk aktivt 1-(2-nitrilophenoxy)-2-hydroxy-3-ethylaminopropan eller syreadditionssalte heraf.
DK139582B (da) Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive benzocycloheptaisoquinolin-forbindelser eller syreadditionssalte deraf.
DK138491B (da) Analogifremgangsmåde til fremstilling af N-(1-cyclohexyl-3-pyrrolidinyl)-benzamider eller syreadditionssalte deraf.
DK137085B (da) Analogifremgangsmåde til fremstilling af cycloalkyl-alkyl-estere af vincaminsyrederivater eller syreadditionssalte deraf.
DK133980C (da) Analogifremgangsmade til fremstilling af racemiske eller optisk aktive diphenylalkyllactamimidderivater eller syreadditionssalte deraf
DK130958B (da) Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive 1-phenoxy-2-hydroxy-3-hydroxyalkylaminopropaner eller fysiologisk tålelige syreadditionssalte heraf.
DK145576C (da) Analogifremgangsmaade til fremstilling af 6-fluor-substituerede thioxanthener eller syreadditionssalte deraf
DK143197C (da) Analogifremgangsmaade til fremstilling af 5,7-dihydroxy-tetrahydroisoquinoliner eller farmaceutisk acceptable syreadditionssalte deraf
DK133555C (da) Analogifremgangsmade til fremstilling af racemiske eller optisk aktive n-thienylmethyl-heterocycliske forbindelser eller syreadditionssalte deraf
DK135942C (da) Analogifremgangsmade til fremstilling af racemiske eller optisk aktive 1-(m-acyloxyphenyl)-1-hydroxy-2-n-alkylaminoethanereller syreadditionssalte deraf
DK123102B (da) Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive benzo[b]thiopheneddikesyreforbindelser eller carboxylatsalte deraf.

Legal Events

Date Code Title Description
PUP Patent expired