DK147318C - Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf - Google Patents
Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte derafInfo
- Publication number
- DK147318C DK147318C DK110174A DK110174A DK147318C DK 147318 C DK147318 C DK 147318C DK 110174 A DK110174 A DK 110174A DK 110174 A DK110174 A DK 110174A DK 147318 C DK147318 C DK 147318C
- Authority
- DK
- Denmark
- Prior art keywords
- tetrahydropyridines
- piperidines
- benzofuranyl
- racemic
- analogue
- Prior art date
Links
- -1 2-BENZOFURANYL Chemical class 0.000 title 1
- 239000002253 acid Substances 0.000 title 1
- 150000003839 salts Chemical class 0.000 title 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/24—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with substituted hydrocarbon radicals attached to ring carbon atoms
- C07D213/28—Radicals substituted by singly-bound oxygen or sulphur atoms
- C07D213/30—Oxygen atoms
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/24—Antidepressants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/26—Psychostimulants, e.g. nicotine, cocaine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D405/00—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
- C07D405/02—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
- C07D405/04—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Psychiatry (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Pain & Pain Management (AREA)
- Plural Heterocyclic Compounds (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Pyridine Compounds (AREA)
- Hydrogenated Pyridines (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK283278A DK147051C (da) | 1973-03-02 | 1978-06-23 | Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive 4-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CH310373A CH592656A5 (Direct) | 1973-03-02 | 1973-03-02 | |
| CH310373 | 1973-03-02 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DK147318B DK147318B (da) | 1984-06-18 |
| DK147318C true DK147318C (da) | 1984-12-24 |
Family
ID=4248678
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK110174A DK147318C (da) | 1973-03-02 | 1974-03-01 | Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf |
Country Status (24)
| Country | Link |
|---|---|
| US (1) | US4210655A (Direct) |
| JP (2) | JPS599557B2 (Direct) |
| AR (4) | AR205619A1 (Direct) |
| AT (1) | AT336014B (Direct) |
| BE (1) | BE811767A (Direct) |
| CA (1) | CA1045139A (Direct) |
| CH (1) | CH592656A5 (Direct) |
| CS (5) | CS176266B2 (Direct) |
| DD (1) | DD113007A5 (Direct) |
| DE (1) | DE2408476A1 (Direct) |
| DK (1) | DK147318C (Direct) |
| ES (1) | ES423711A1 (Direct) |
| FR (1) | FR2219781B1 (Direct) |
| GB (1) | GB1465581A (Direct) |
| HU (1) | HU172464B (Direct) |
| IE (1) | IE38907B1 (Direct) |
| IL (1) | IL44237A (Direct) |
| LU (1) | LU69510A1 (Direct) |
| MX (1) | MX3765E (Direct) |
| NL (1) | NL179206C (Direct) |
| SE (1) | SE410856B (Direct) |
| SU (6) | SU560531A3 (Direct) |
| YU (2) | YU52374A (Direct) |
| ZA (1) | ZA741362B (Direct) |
Families Citing this family (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CH609054A5 (en) * | 1975-11-26 | 1979-02-15 | Ciba Geigy Ag | Process for the preparation of a novel piperidine derivative |
| EP0006524A1 (de) * | 1978-06-22 | 1980-01-09 | Ciba-Geigy Ag | Neue Tetrahydropyridin- und Piperidinderivate und deren Säureadditionssalze, Verfahren zu deren Herstellung und solche enthaltende pharmazeutische Zusammensetzungen |
| US4284638A (en) * | 1978-11-21 | 1981-08-18 | Ciba-Geigy Corporation | Pharmaceutical compositions with central depressant and antipsychotic activity having a butyrophenone derivative which is substituted in the 4-position and a C-(2-benzofuranyl)-piperidine or C-(2-benzofuranyl)-tetrahydro-pyridine |
| US5045551A (en) * | 1989-09-19 | 1991-09-03 | Allergan, Inc. | Acetylenes disubstituted with a heteroaromatic group and a 2-substituted chromanyl, thiochromanyl or 1,2,3,4-tetrahydroquinolinyl group having retinoid-like activity |
| US5455254A (en) * | 1991-02-15 | 1995-10-03 | Mondadori; Cesare | Substituted benzofuranylpiperidine as a nootropic agent |
| RU2095339C1 (ru) * | 1991-10-17 | 1997-11-10 | Циба-Гейги АГ | Производные гидрохинона в свободном виде или в виде соли, способы их получения, производные пиперидина и способы их получения |
| CA2117430A1 (en) * | 1992-02-21 | 1993-09-02 | Richard Katz | Brofaromine as an agent for treating post-traumatic stress |
| US5693807A (en) * | 1992-10-14 | 1997-12-02 | Ciba-Geigy Corporation | Substituted hydroquinone derivatives |
| DK0637586T3 (da) * | 1993-08-05 | 1999-12-06 | Hoechst Marion Roussel Inc | 2-(Piperidin-4-yl, pyridin-4-yl og tetrahydropyridin-4-yl)-benzofuran-7-carbamatderivater, deres fremstilling og anvendelse |
| GB9605065D0 (en) * | 1996-03-11 | 1996-05-08 | Merck Sharp & Dohme | Therapeutic agents |
| AU5319700A (en) | 1999-06-02 | 2000-12-18 | S. Mbua Ngale Efange | Nicotine receptor ligands |
| WO2011162364A1 (ja) | 2010-06-23 | 2011-12-29 | 住友化学株式会社 | 有害節足動物防除組成物および複素環化合物 |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB1041525A (en) * | 1964-11-11 | 1966-09-07 | Belge Produits Chimiques Sa | Benzofuran derivatives and processes for preparing the same |
| FR1461633A (fr) * | 1964-11-11 | 1966-02-25 | Belge Produits Chimiques Sa | Nouveaux dérivés benzofuranniques, leurs sels et procédés de préparation de cesdérivés et de leurs sels |
| IE39264B1 (en) * | 1973-05-25 | 1978-08-30 | Ciba Geigy Ag | New pharmaceutical preparations |
-
1973
- 1973-03-02 CH CH310373A patent/CH592656A5/xx not_active IP Right Cessation
-
1974
- 1974-01-01 AR AR252581A patent/AR205619A1/es active
- 1974-02-19 IL IL44237A patent/IL44237A/en unknown
- 1974-02-20 IE IE00340/74A patent/IE38907B1/xx unknown
- 1974-02-21 SE SE7402294A patent/SE410856B/xx not_active IP Right Cessation
- 1974-02-22 DE DE19742408476 patent/DE2408476A1/de active Granted
- 1974-02-25 CA CA193,450A patent/CA1045139A/en not_active Expired
- 1974-02-28 NL NLAANVRAGE7402755,A patent/NL179206C/xx not_active IP Right Cessation
- 1974-02-28 ES ES423711A patent/ES423711A1/es not_active Expired
- 1974-02-28 LU LU69510*A patent/LU69510A1/xx unknown
- 1974-02-28 CS CS1495A patent/CS176266B2/cs unknown
- 1974-02-28 FR FR7406834A patent/FR2219781B1/fr not_active Expired
- 1974-02-28 YU YU00523/74A patent/YU52374A/xx unknown
- 1974-02-28 SU SU2000455A patent/SU560531A3/ru active
- 1974-02-28 CS CS8940A patent/CS176299B2/cs unknown
- 1974-02-28 HU HU74CI00001456A patent/HU172464B/hu unknown
- 1974-02-28 DD DD176867A patent/DD113007A5/xx unknown
- 1974-02-28 CS CS8939A patent/CS176298B2/cs unknown
- 1974-02-28 CS CS8938A patent/CS176297B2/cs unknown
- 1974-02-28 CS CS8937A patent/CS176296B2/cs unknown
- 1974-03-01 ZA ZA00741362A patent/ZA741362B/xx unknown
- 1974-03-01 AT AT170674A patent/AT336014B/de not_active IP Right Cessation
- 1974-03-01 BE BE141551A patent/BE811767A/xx not_active IP Right Cessation
- 1974-03-01 DK DK110174A patent/DK147318C/da not_active IP Right Cessation
- 1974-03-01 MX MX745143U patent/MX3765E/es unknown
- 1974-03-01 GB GB927974A patent/GB1465581A/en not_active Expired
- 1974-03-02 JP JP49024715A patent/JPS599557B2/ja not_active Expired
-
1975
- 1975-06-30 AR AR259413A patent/AR208554A1/es active
- 1975-06-30 AR AR259412A patent/AR210858A1/es active
-
1976
- 1976-05-05 AR AR263204A patent/AR211860A1/es active
- 1976-09-24 SU SU762404754A patent/SU612630A3/ru active
- 1976-09-24 SU SU762402851A patent/SU651702A3/ru active
- 1976-09-28 SU SU762404895A patent/SU646911A4/ru active
- 1976-11-02 SU SU762415644A patent/SU649321A3/ru active
-
1977
- 1977-08-24 SU SU772514703A patent/SU651703A3/ru active
-
1978
- 1978-04-05 US US05/893,104 patent/US4210655A/en not_active Expired - Lifetime
-
1980
- 1980-08-25 YU YU02123/80A patent/YU212380A/xx unknown
-
1982
- 1982-06-16 JP JP57102323A patent/JPS6046115B2/ja not_active Expired
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK136904B (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive 2-(heteroarylmethyl)-5,9beta-dialkyl-6,7-benzomorphaner eller syreadditionssalte deraf | |
| DK142750C (da) | Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive dopaminderivater eller syreadditionssalte deraf | |
| DK143128C (da) | Analogifremgangsmaade til fremstilling af 1-aryloxy-2-hydroxy-3-alkynylaminopropaner eller deres fysiologisk acceptable syreadditionssalte | |
| DK140281B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive 1-phenoxy-2-hydroxy-3-cycloalkylaminopropaner eller syreadditionssalte heraf. | |
| DK136527B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive p-alkoxyfenoxypropanolaminer eller syreadditionssalte deraf. | |
| DK147318C (da) | Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive c-(2-benzofuranyl)-tetrahydropyridiner eller -piperidiner eller syreadditionssalte deraf | |
| DK125021B (da) | Analogifremgangsmåde til fremstilling af 1,2,3,4-tetrahydro-4-phenyl-isoquinolinderivater eller syreadditionssalte deraf eller de tilsvarende optisk aktive forbindelser. | |
| DK137234B (da) | Analogifremgangsmåde til fremstilling af racemisk eller optisk aktiv 1-isopropylamino-3-(4-(2-isopropylkarbamoylaminoætyl)-fenoxy)-propanol-2 eller syreadditionssalte deraf. | |
| DK144094C (da) | Analogifremgangsmaade til fremstilling af n-substituerede 3-hydroxy-8-oxamorphinaner eller syreadditionssalte deraf | |
| DK153157C (da) | Analogifremgangsmaade til fremstilling af 7-alfa-aminoacyl-3-halogen-cephalosporinderivater eller farmaceutisk acceptable syreadditionssalte deraf | |
| DK129127B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive 2-(furylmethyl)-6,7-benzomorphaner eller deres syreadditionssalte. | |
| DK143445C (da) | Analogifremgangsmaade til fremstilling af racemiske eller optisk aktive substituerede 1,1-diphenyl-3-amino-propanol-forbindelser | |
| DK145574C (da) | Analogifremgangsmaade til fremstilling af substituerede cyclopropylalkylaminer eller syreadditionssalte deraf | |
| DK141875C (da) | Analogifremgangsmaade til fremstilling af normorphinonderivater eller syreadditionssalte deraf | |
| DK125639B (da) | Analogifremgangsmåde til fremstilling af racemisk eller optisk aktivt 1-(2-nitrilophenoxy)-2-hydroxy-3-ethylaminopropan eller syreadditionssalte heraf. | |
| DK139582B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive benzocycloheptaisoquinolin-forbindelser eller syreadditionssalte deraf. | |
| DK138491B (da) | Analogifremgangsmåde til fremstilling af N-(1-cyclohexyl-3-pyrrolidinyl)-benzamider eller syreadditionssalte deraf. | |
| DK137085B (da) | Analogifremgangsmåde til fremstilling af cycloalkyl-alkyl-estere af vincaminsyrederivater eller syreadditionssalte deraf. | |
| DK133980C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive diphenylalkyllactamimidderivater eller syreadditionssalte deraf | |
| DK130958B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive 1-phenoxy-2-hydroxy-3-hydroxyalkylaminopropaner eller fysiologisk tålelige syreadditionssalte heraf. | |
| DK145576C (da) | Analogifremgangsmaade til fremstilling af 6-fluor-substituerede thioxanthener eller syreadditionssalte deraf | |
| DK143197C (da) | Analogifremgangsmaade til fremstilling af 5,7-dihydroxy-tetrahydroisoquinoliner eller farmaceutisk acceptable syreadditionssalte deraf | |
| DK133555C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive n-thienylmethyl-heterocycliske forbindelser eller syreadditionssalte deraf | |
| DK135942C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive 1-(m-acyloxyphenyl)-1-hydroxy-2-n-alkylaminoethanereller syreadditionssalte deraf | |
| DK123102B (da) | Analogifremgangsmåde til fremstilling af racemiske eller optisk aktive benzo[b]thiopheneddikesyreforbindelser eller carboxylatsalte deraf. |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUP | Patent expired |