WO2023127752A1 - ポリペプチド及びこれを用いたアミノ酸の製造方法 - Google Patents
ポリペプチド及びこれを用いたアミノ酸の製造方法 Download PDFInfo
- Publication number
- WO2023127752A1 WO2023127752A1 PCT/JP2022/047741 JP2022047741W WO2023127752A1 WO 2023127752 A1 WO2023127752 A1 WO 2023127752A1 JP 2022047741 W JP2022047741 W JP 2022047741W WO 2023127752 A1 WO2023127752 A1 WO 2023127752A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- group
- residue
- amino acid
- represented
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/04—Alpha- or beta- amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0012—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
- C12N9/0014—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on the CH-NH2 group of donors (1.4)
- C12N9/0016—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on the CH-NH2 group of donors (1.4) with NAD or NADP as acceptor (1.4.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0012—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7)
- C12N9/0026—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on CH-NH groups of donors (1.5)
- C12N9/0028—Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on CH-NH groups of donors (1.5) with NAD or NADP as acceptor (1.5.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y105/00—Oxidoreductases acting on the CH-NH group of donors (1.5)
- C12Y105/01—Oxidoreductases acting on the CH-NH group of donors (1.5) with NAD+ or NADP+ as acceptor (1.5.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y104/00—Oxidoreductases acting on the CH-NH2 group of donors (1.4)
- C12Y104/01—Oxidoreductases acting on the CH-NH2 group of donors (1.4) with NAD+ or NADP+ as acceptor (1.4.1)
Definitions
- the present invention relates to polypeptides and methods for producing amino acids using the same.
- N-alkylamino acids are known to exist as part of the structure of various natural physiologically active substances. It is also known that some N-methylamino acids, which are a type of N-alkylamino acids, are naturally occurring amino acids (Non-Patent Document 1).
- NMADH N-methylamino acid dehydrogenase
- the same purified enzyme synthesizes corresponding N-alkylamino acids from various ⁇ -keto acids (pyruvic acid, phenylpyruvic acid, hydroxypyruvic acid, etc.) and alkylamines (methylamine, ethylamine, propylamine, etc.). had the activity to
- Non-Patent Document 5 The residues contained in the substrate binding site in the crystal structure of NMADH derived from Syringae (Non-Patent Document 5) are those of P. It is also conserved in Putida KT2440 strain-derived NMADH. By introducing mutations into these amino acid residues, the specific activity was improved when glyoxylic acid and methylamine or glyoxylic acid and ethylamine were used as substrates. Mutant F117L of NMADH derived from Putida KT2440 strain has been found (Non-Patent Document 6).
- non-patent documents 2 and 3 show that it does not show any activity against ammonia, and that ⁇ -ketoisocaproic acid and ⁇ -keto- ⁇ -methyl methyl It has also been shown to show no activity against herbal acid.
- the purpose of the present invention is to provide a new polypeptide that can be used as an enzyme that catalyzes reductive amination reactions.
- Another object of the present invention is to provide a method for producing an amino acid using the polypeptide.
- the present invention relates to, for example, the following inventions.
- the catalytic activity of any one or more compounds B or a salt thereof for intramolecular reductive amination reaction is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under at least one reaction condition. high, polypeptide.
- R 2 each independently represents a hydrogen atom, an alkyl group, an alkenyl group, an alkynyl group, a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, which groups may be substituted; 1 or R 2 any one or more of is a hydrogen atom.
- X represents a carbon atom
- Y represents a hydrogen atom, a group represented by the above formula (1′) or a group represented by the above formula (3)
- n represents an integer of 0 or more and 2 or less, R.
- 6 is a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 to 6 carbon atoms, an optionally substituted aryl group having 5 to 12 carbon atoms, optionally substituted a heteroaryl group having 5 or more and 12 or less ring-constituting atoms, a group containing a nitrogen atom, or a group containing an oxygen atom,
- formula (1') indicates the point of attachment to X, R.
- R in formula (1) 1 is a group obtained by removing a hydrogen atom from the group represented by, not a hydrogen atom,
- formula (3) indicates the point of attachment to X
- m represents an integer from 0 to 6
- p is 0 or 1
- q is 0 or 1
- r is 0 or 1
- Z. 1 represents an optionally substituted alkylene group or an ether bond-containing group having 1 to 6 carbon atoms, and when m is 2 or more, a plurality of Z 1 may be the same or different
- Z. 2 indicates a carbon atom, R.
- R 4 and R 5 are each independently a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 or more and 6 or less carbon atoms, an optionally substituted aryl group having 5 or more and 12 or less carbon atoms, a substituted a heteroaryl group, a group containing a nitrogen atom, or a group containing an oxygen atom, in which the number of atoms constituting the ring that may be present is 5 or more and 12 or less, R.
- any two or more of are combined with each other to Z 2 may form a ring structure together, and these ring structures may be a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, and these groups may be substituted, R.
- R 3 , R 4 , and R 5 is Z 2 may form a double bond or triple bond with R 3 , R 4 , and R 5 any one of Z by a double bond or a triple bond 2 any one or more of p, q or r is 0 when bound to
- R 1 and R 2 is a methyl group and the other is a hydrogen atom
- Y is a group represented by the above formula (3)
- m is 0, and R 3 thru R 5 are not hydrogen atoms.
- the catalytic activity of any one or more compounds B or a salt thereof for intramolecular reductive amination reaction is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under at least one reaction condition. high, polypeptide.
- R 2 each independently represents a hydrogen atom, an alkyl group, an alkenyl group, an alkynyl group, a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, which groups may be substituted; 1 or R 2 any one or more of is a hydrogen atom.
- X represents a carbon atom
- Y represents a hydrogen atom, a group represented by the above formula (1′) or a group represented by the above formula (3)
- n represents an integer of 0 or more and 2 or less, R.
- 6 is a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 to 6 carbon atoms, an optionally substituted aryl group having 5 to 12 carbon atoms, optionally substituted a heteroaryl group having 5 or more and 12 or less ring-constituting atoms, a group containing a nitrogen atom, or a group containing an oxygen atom,
- formula (1') indicates the point of attachment to X, R.
- R in formula (1) 1 is a group obtained by removing a hydrogen atom from the group represented by, not a hydrogen atom,
- formula (3) indicates the point of attachment to X
- m represents an integer from 0 to 6
- p is 0 or 1
- q is 0 or 1
- r is 0 or 1
- Z. 1 represents an optionally substituted alkylene group or an ether bond-containing group having 1 to 6 carbon atoms, and when m is 2 or more, a plurality of Z 1 may be the same or different
- Z. 2 indicates a carbon atom, R.
- R 4 and R 5 are each independently a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 or more and 6 or less carbon atoms, an optionally substituted aryl group having 5 or more and 12 or less carbon atoms, a substituted a heteroaryl group, a group containing a nitrogen atom, or a group containing an oxygen atom, in which the number of atoms constituting the ring that may be present is 5 or more and 12 or less, R.
- any two or more of are combined with each other to Z 2 may form a ring structure together, and these ring structures may be a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, and these groups may be substituted, R.
- R 3 , R 4 , and R 5 is Z 2 may form a double bond or triple bond with R 3 , R 4 , and R 5 any one of Z by a double bond or a triple bond 2 any one or more of p, q or r is 0 when bound to
- R 1 and R 2 is a methyl group and the other is a hydrogen atom
- Y is a group represented by the above formula (3)
- m is 0, and R 3 thru R 5 are not hydrogen atoms.
- the catalytic activity of any one or more compounds B or a salt thereof for intramolecular reductive amination reaction is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under at least one reaction condition.
- the polypeptide of [1] which is high. [In formula (1), R.
- R 2 each independently represents a hydrogen atom, an alkyl group, an alkenyl group, an alkynyl group, a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, which groups may be substituted; 1 or R 2 any one or more of is a hydrogen atom.
- X represents a carbon atom
- Y represents a hydrogen atom, a group represented by the above formula (1′) or a group represented by the above formula (3)
- n represents an integer of 0 or more and 2 or less, R.
- 6 is a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 to 6 carbon atoms, an optionally substituted aryl group having 5 to 12 carbon atoms, optionally substituted a heteroaryl group having 5 or more and 12 or less ring-constituting atoms, a group containing a nitrogen atom, or a group containing an oxygen atom,
- formula (1') indicates the point of attachment to X, R.
- 1a is R in formula (1) 1 is a group obtained by removing a hydrogen atom from the group represented by, not a hydrogen atom,
- formula (3) indicates the point of attachment with X
- m represents an integer from 0 to 6
- p is 0 or 1
- q is 0 or 1
- r is 0 or 1
- Z. 1 represents an optionally substituted alkylene group or an ether bond-containing group having 1 to 6 carbon atoms, and when m is 2 or more, a plurality of Z 1 may be the same or different
- Z. 2 indicates a carbon atom, R.
- R 4 and R 5 are each independently a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 or more and 6 or less carbon atoms, an optionally substituted aryl group having 5 or more and 12 or less carbon atoms, a substituted a heteroaryl group, a group containing a nitrogen atom, or a group containing an oxygen atom, in which the number of atoms constituting the ring that may be present is 5 or more and 12 or less, R.
- any two or more of are combined with each other to Z 2 may form a ring structure together, and these ring structures may be a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, and these groups may be substituted, R.
- R 3 , R 4 , and R 5 is Z 2 may form a double bond or triple bond with R 3 , R 4 , and R 5 any one of Z by a double bond or a triple bond 2 any one or more of p, q or r is 0 when bound to
- R 1 and R 2 is a methyl group and the other is a hydrogen atom
- Y is a group represented by the above formula (3)
- m is 0, and R 3 thru R 5 are not hydrogen atoms.
- the catalytic activity of any one or more compounds B or a salt thereof for intramolecular reductive amination reaction is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under at least one reaction condition. high, polypeptide.
- R 2 each independently represents a hydrogen atom, an alkyl group, an alkenyl group, an alkynyl group, a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, which groups may be substituted; 1 or R 2 any one or more of is a hydrogen atom.
- X represents a carbon atom
- Y represents a hydrogen atom, a group represented by the above formula (1′) or a group represented by the above formula (3)
- n represents an integer of 0 or more and 2 or less, R.
- 6 is a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 to 6 carbon atoms, an optionally substituted aryl group having 5 to 12 carbon atoms, optionally substituted a heteroaryl group having 5 or more and 12 or less ring-constituting atoms, a group containing a nitrogen atom, or a group containing an oxygen atom,
- formula (1') indicates the point of attachment to X, R.
- R in formula (1) 1 is a group obtained by removing a hydrogen atom from the group represented by, not a hydrogen atom,
- formula (3) indicates the point of attachment to X
- m represents an integer from 0 to 6
- p is 0 or 1
- q is 0 or 1
- r is 0 or 1
- Z. 1 represents an optionally substituted alkylene group or an ether bond-containing group having 1 to 6 carbon atoms, and when m is 2 or more, a plurality of Z 1 may be the same or different
- Z. 2 indicates a carbon atom, R.
- R 4 and R 5 are each independently a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 or more and 6 or less carbon atoms, an optionally substituted aryl group having 5 or more and 12 or less carbon atoms, a substituted a heteroaryl group, a group containing a nitrogen atom, or a group containing an oxygen atom, in which the number of atoms constituting the ring that may be present is 5 or more and 12 or less, R.
- any two or more of are combined with each other to Z 2 may form a ring structure together, and these ring structures may be a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, and these groups may be substituted, R.
- R 3 , R 4 , and R 5 is Z 2 may form a double bond or triple bond with R 3 , R 4 , and R 5 any one of Z by a double bond or a triple bond 2 any one or more of p, q or r is 0 when bound to
- R 1 and R 2 is a methyl group and the other is a hydrogen atom
- Y is a group represented by the above formula (3)
- m is 0, and R 3 thru R 5 are not hydrogen atoms.
- R 2 each independently represents a hydrogen atom, an alkyl group, an alkenyl group, an alkynyl group, a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, which groups may be substituted; 1 or R 2 any one or more of is a hydrogen atom.
- X represents a carbon atom
- Y represents a hydrogen atom, a group represented by the above formula (1′) or a group represented by the above formula (3)
- n represents an integer of 0 or more and 2 or less, R.
- 6 is a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 to 6 carbon atoms, an optionally substituted aryl group having 5 to 12 carbon atoms, optionally substituted a heteroaryl group having 5 or more and 12 or less ring-constituting atoms, a group containing a nitrogen atom, or a group containing an oxygen atom,
- formula (1') indicates the point of attachment to X, R.
- R in formula (1) 1 is a group obtained by removing a hydrogen atom from the group represented by, not a hydrogen atom,
- formula (3) indicates the point of attachment to X
- m represents an integer from 0 to 6
- p is 0 or 1
- q is 0 or 1
- r is 0 or 1
- Z. 1 represents an optionally substituted alkylene group or an ether bond-containing group having 1 to 6 carbon atoms, and when m is 2 or more, a plurality of Z 1 may be the same or different
- Z. 2 indicates a carbon atom, R.
- R 4 and R 5 are each independently a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 or more and 6 or less carbon atoms, an optionally substituted aryl group having 5 or more and 12 or less carbon atoms, a substituted a heteroaryl group, a group containing a nitrogen atom, or a group containing an oxygen atom, in which the number of atoms constituting the ring that may be present is 5 or more and 12 or less, R.
- any two or more of are combined with each other to Z 2 may form a ring structure together, and these ring structures may be a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, and these groups may be substituted, R.
- R 3 , R 4 , and R 5 is Z 2 may form a double bond or triple bond with R 3 , R 4 , and R 5 any one of Z by a double bond or a triple bond 2 any one or more of p, q or r is 0 when bound to
- R 1 and R 2 is a methyl group and the other is a hydrogen atom
- Y is a group represented by the above formula (3)
- m is 0, and R 3 thru R 5 are not hydrogen atoms.
- Y' is C 3 ⁇ C 8 a cycloalkyl group, or C 6 ⁇ C 9 represents an aralkyl group, the aralkyl group being C 1 ⁇ C 3 It may be substituted with an alkyl group or a halogen atom.
- Y' is C 3 ⁇ C 8 a cycloalkyl group, or C 6 ⁇ C 9 represents an aralkyl group, the aralkyl group being C 1 ⁇ C 3 It may be substituted with an alkyl group or a halogen atom.
- [8] A sequence having a sequence identity of 90% or more with a sequence in which two amino acid residues in the amino acid sequence represented by SEQ ID NO: 1 are modified, and an alkylamine or a salt thereof, and the following formula (2')
- the catalytic activity of the polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 1 against the reductive amination reaction with any one or more of the compounds represented or salts thereof under at least one reaction condition The polypeptide of [6], which is higher.
- Y' is C 3 ⁇ C 8 a cycloalkyl group, or C 6 ⁇ C 9 represents an aralkyl group, the aralkyl group being C 1 ⁇ C 3 It may be substituted with an alkyl group or a halogen atom.
- Y' is C 3 ⁇ C 8 a cycloalkyl group, or C 6 ⁇ C 9 represents an aralkyl group, the aralkyl group being C 1 ⁇ C 3 It may be substituted with an alkyl group or a halogen atom.
- the catalytic activity of the polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 1 against the reductive amination reaction with any one or more of the compounds represented or salts thereof under at least one reaction condition The polypeptide of [6], which is higher.
- Y' is C 3 ⁇ C 8 a cycloalkyl group, or C 6 ⁇ C 9 represents an aralkyl group, the aralkyl group being C 1 ⁇ C 3 It may be substituted with an alkyl group or a halogen atom.
- the polypeptide according to any one of [1] to [11] comprising a sequence having 90% or more sequence identity with a sequence in which two amino acid residues in the amino acid sequence represented by SEQ ID NO: 17 are modified.
- polypeptide according to any one of [1] to [12], comprising a sequence having 90% or more sequence identity with a sequence in which three amino acid residues in the amino acid sequence represented by SEQ ID NO: 17 are modified.
- [16] One or more amino acids selected from the group consisting of a methionine residue at position 141, a histidine residue at position 182, a tryptophan residue at position 253, and a lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1
- amino acid residue is modified as the first modification site
- a polypeptide comprising a sequence in which an amino acid residue located at a site corresponding to one amino acid residue different from the residue is modified as the second modification site.
- amino acid residue Located at a site corresponding to one amino acid residue selected from the group consisting of a methionine residue at position 141, a histidine residue at position 182, and a tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 an amino acid residue is modified as the first modification site, An amino acid selected from the group consisting of a histidine residue at position 182, a tryptophan residue at position 253, and a lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1, and modified as the first modification site.
- polypeptide according to any one of [1] to [16], which comprises a sequence in which an amino acid residue located at a site corresponding to one amino acid residue different from the residue is modified as the second modification site.
- an amino acid residue located at a position corresponding to one amino acid residue selected from the group consisting of a methionine residue at position 141 and a histidine residue at position 182 is the first modification.
- amino acid residues selected from the group consisting of a histidine residue at position 182 and a tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1, and modified as the first modification site The amino acid residue located at the site corresponding to the amino acid residue is modified as the second modification site, Amino acid residues selected from the group consisting of a tryptophan residue at position 253 and a lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 and modified as the first modification site and the second modification site
- a polypeptide comprising a sequence in which an amino acid residue located at a site corresponding to one amino acid residue different from the group is modified as the third modification site.
- amino acid residue located at a position corresponding to one amino acid residue selected from the group consisting of a methionine residue at position 141 and a histidine residue at position 182 is the first modification.
- amino acid residues selected from the group consisting of a histidine residue at position 182 and a tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1, and modified as the first modification site The amino acid residue located at the site corresponding to the amino acid residue is modified as the second modification site, Amino acid residues selected from the group consisting of a tryptophan residue at position 253 and a lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 and modified as the first modification site and the second modification site
- the polypeptide according to any one of [1] to [16], comprising a sequence in which an amino acid residue located at a site corresponding to one amino acid residue different from the group is modified as the third modification site.
- [21] At a site corresponding to one or more amino acid residues selected from the group consisting of a methionine residue at position 141, a tryptophan residue at position 253, and a lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1
- [22] The polypeptide according to any one of [1], [6], [11], [14] to [16] and [21], wherein the amino acid sequence represented by SEQ ID NO: 1 is modified at one site .
- amino acid residue located at the position corresponding to the methionine residue at position 141 is a tyrosine residue, a tryptophan residue, a valine residue, a threonine residue, a serine residue, and an arginine residue.
- amino acid residue located at the position corresponding to the methionine residue at position 141 is a tyrosine residue, a tryptophan residue, a valine residue, a threonine residue, a serine residue, and an arginine residue.
- the polypeptide according to any one of [6], [11], [14]-[16] and [21]-[24].
- the amino acid residue located at the position corresponding to the methionine residue at position 141 in the amino acid sequence represented by SEQ ID NO: 1 is a tyrosine residue, a tryptophan residue, a valine residue, a lysine residue, an isoleucine residue, and a phenylalanine residue.
- amino acid residue located at the site corresponding to the threonine residue at position 156 in the amino acid sequence represented by SEQ ID NO: 1 is replaced with a serine residue , [14] to [16] and [21] to [26].
- the amino acid residue located at the position corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1 is a tyrosine residue, a glutamine residue, a methionine residue, a leucine residue, a glycine residue, and a phenylalanine residue.
- [1], [6], [11], [14]-[16] and [21]- comprising a sequence substituted by one or more amino acid residues selected from the group consisting of groups and alanine residues
- the polypeptide according to any one of [27].
- amino acid residue located at the position corresponding to the glutamine residue at position 186 is replaced with one or more amino acid residues selected from the group consisting of methionine residues and glutamic acid residues.
- amino acid residue located at the position corresponding to the tryptophan residue at position 253 is a tyrosine residue, a valine residue, a threonine residue, a serine residue, an arginine residue, and a glutamine residue.
- amino acid residues selected from the group consisting of a group, a proline residue, an asparagine residue, a methionine residue, a leucine residue, a lysine residue, an isoleucine residue, a histidine residue, a phenylalanine residue and an alanine residue
- the amino acid residue located at the position corresponding to the lysine residue at position 260 is a tyrosine residue, a tryptophan residue, a threonine residue, a serine residue, an arginine residue, and a glutamine residue.
- polypeptide any one of [1], [6], [11], [14]-[16] and [21]-[33], comprising the sequence.
- [35] one selected from the group consisting of a glutamine residue, a methionine residue, a glutamic acid residue and an asparagine residue, in the amino acid sequence represented by SEQ ID NO: 1, wherein the amino acid residue located at the position corresponding to the lysine residue at position 260 is The polypeptide of any one of [1], [6], [11], [14]-[16] and [21]-[34], comprising a sequence substituted by one or more amino acid residues.
- amino acid sequence represented by SEQ ID NO: 6 The sequence in which one amino acid residue in the amino acid sequence represented by SEQ ID NO: 1 is modified is represented by SEQ ID NO: 6, and the amino acid sequence (M141V) in which X is a valine residue, represented by SEQ ID NO: 6,
- amino acid sequence (M141Y) in which X is a tyrosine residue an amino acid sequence (H182L) in which X is a leucine residue, represented by SEQ ID NO: 8
- amino acid sequence (H182L) in which X is a leucine residue an amino acid sequence (H182L) in which X is a histidine residue ( W253H)
- amino acid sequence (K260E) represented by SEQ ID NO: 12 where X is a glutamic acid residue [1], [6], [11], [14]-[16] and [21]-
- the polypeptide according to any one of [35].
- amino acid sequence (M141Y) represented by SEQ ID NO: 6, where X is a tyrosine residue and the amino acid sequence (M141Y) represented by SEQ ID NO: 8, where X is leucine (H182Y), the amino acid sequence represented by SEQ ID NO: 11, where X is a histidine residue (W253H), or the amino acid sequence represented by SEQ ID NO: 12, where X is a glutamic acid residue (K260E) [1], [6], [11], [14] to [16] and [21] to [36], comprising a sequence having 90% or more sequence identity with the sequence Polypeptide.
- K260E glutamic acid residue
- amino acid sequence (M141Y) represented by SEQ ID NO: 6, where X is a tyrosine residue and the amino acid sequence (M141Y) represented by SEQ ID NO: 8, where X is leucine (H182Y), the amino acid sequence represented by SEQ ID NO: 11, where X is a histidine residue (W253H), or the amino acid sequence represented by SEQ ID NO: 12, where X is a glutamic acid residue (K260E)
- the polypeptide according to any one of [1], [6], [11], [14]-[16] and [21]-[37], comprising [39] [1], [6], [11], [14] to [16] and [ 21] to [38].
- amino acid residue located at the position corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1 is selected from the group consisting of a tyrosine residue, a methionine residue, a leucine residue, and a phenylalanine residue. [2], [3], [7], [8], [12], [17], [18], and [40]-[45], including sequences substituted by one amino acid residue A polypeptide according to any of the preceding claims.
- amino acid residue located at the position corresponding to the histidine residue at position 182 was replaced with one amino acid residue selected from the group consisting of methionine residues and leucine residues.
- the amino acid residue located at the position corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 is a tyrosine residue, a threonine residue, a serine residue, an asparagine residue, a methionine residue, and a histidine residue.
- the amino acid residue located at the position corresponding to the lysine residue at position 260 is a serine residue, a glutamine residue, an asparagine residue, a leucine residue, an isoleucine residue, and a histidine residue.
- amino acid residue located at the position corresponding to the lysine residue at position 260 was replaced with one amino acid residue selected from the group consisting of glutamine and glutamic acid residues.
- a sequence in which two amino acid residues in the amino acid sequence represented by SEQ ID NO: 1 are modified An amino acid sequence represented by SEQ ID NO: 25, wherein X located at the position corresponding to the amino acid residue at position 141 is an alanine residue, and X located at the position corresponding to the amino acid residue at position 260 is a glutamic acid residue (M141A_K260E), An amino acid sequence represented by SEQ ID NO: 25, wherein X located at the position corresponding to the amino acid residue at position 141 is an alanine residue, and X located at the position corresponding to the amino acid residue at position 260 is a glutamine residue (M141A_K260Q), An amino acid sequence represented by SEQ ID NO: 25, wherein X located at the position corresponding to the amino acid residue at position 141 is a tyrosine residue, and X located at the position corresponding to the amino acid residue at position 260 is a glutamic acid residue (M141Y_K260E), An amino acid sequence represented by SEQ
- amino acid sequence represented by SEQ ID NO: 1 is modified in three places
- [62] There are three modified sites in the amino acid sequence represented by SEQ ID NO: 1, and one amino acid residue selected from the group consisting of a methionine residue, a leucine residue and a phenylalanine residue, the amino acid residue located at a position corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1 any of [4], [5], [9], [10], [13], [19], [20], and [56]-[61], comprising the sequence replaced by Polypeptide.
- amino acid residue located at the position corresponding to the histidine residue at position 182 was replaced with one amino acid residue selected from the group consisting of methionine residues and leucine residues.
- amino acid residue located at the position corresponding to the tryptophan residue at position 253 is a valine residue, a threonine residue, a serine residue, a glutamine residue, a methionine residue, and a leucine residue.
- amino acid residue located at the position corresponding to the tryptophan residue at position 253 is a valine residue, a threonine residue, a serine residue, a glutamine residue, a methionine residue, and a leucine residue.
- amino acid residue located at the site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 is selected from the group consisting of a glutamine residue, a methionine residue, a leucine residue and a histidine residue. any of [4], [5], [9], [10], [13], [19], [20], and [56]-[64], including sequences substituted by one amino acid residue the polypeptide of claim 1.
- amino acid residue located at the position corresponding to the lysine residue at position 260 was replaced with one amino acid residue selected from the group consisting of glutamine and glutamic acid residues.
- X located at the site corresponding to the amino acid residue at position 141 is a tyrosine residue
- X located at the site corresponding to the amino acid residue at position 182 is a methionine residue
- X located at the site corresponding to the amino acid residue at position 141 is a valine residue
- X located at the site corresponding to the amino acid residue at position 253 is a methionine residue
- X located at the site corresponding to the amino acid residue at position 182 is a leucine
- X located at the site corresponding to the amino acid residue at position 141 is a tyrosine residue
- X located at the site corresponding to the amino acid residue at position 182 is a methionine residue
- X located at the site corresponding to the amino acid residue at position 141 is a valine residue
- X located at the site corresponding to the amino acid residue at position 253 is a methionine residue
- X located at the site corresponding to the amino acid residue at position 182 is a leucine
- the catalytic activity of any one or more compounds B or a salt thereof for intramolecular reductive amination reaction is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 17 under at least one reaction condition.
- [74] The compound represented by the formula (2′) or a salt thereof, the group consisting of phenylpyruvic acid, 2-oxo-3-(p-tolyl)propanoic acid, 2-cyclopentyl-2-oxo-acetic acid and salts thereof
- the catalytic activity for the reductive amination reaction between ethylamine or a salt thereof and phenylpyruvic acid or a salt thereof is higher than the catalytic activity of the polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 17 under at least one reaction condition.
- the catalytic activity against the reductive amination reaction of methylamine or its salt and 2-cyclopentyl-2-oxo-acetic acid or its salt under at least one reaction condition consists of the amino acid sequence represented by SEQ ID NO: 17
- [83] 1 wherein the natural amino acid is selected from the group consisting of glycine, alanine, serine, threonine, valine, leucine, isoleucine, phenylalanine, tyrosine, tryptophan, histidine, glutamine, asparagine, glutamic acid, aspartic acid, methionine, lysine, arginine and proline
- the polypeptide of [82] which is one or more.
- polypeptide according to any one of [1] to [84] which has 300 or more and 400 or less amino acid residues when present as a monomer.
- the polypeptide according to any one of [1] to [86] wherein the pH at which the catalytic activity is higher than that of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 is in the range of 7 or more and 11 or less.
- amino acid sequence represented by SEQ ID NO: 1 at least at one point in the range of 100 mM to 3000 mM in total concentration of the compound A and a salt thereof at the start of the reaction in the total volume of the reaction solution during the reductive amination reaction.
- the ratio of the total number of moles of the compound A and its salt to the total number of moles of the compound B and its salt at the start of the reaction in the total amount of the reaction solution when performing the reductive amination reaction is 1 or more.
- the yield of the amino acid produced by the reductive amination reaction is determined.
- R 1 is a hydrogen atom
- R 2 is C 1 ⁇ C 6
- the polypeptide according to any one of [1] to [5] and [88] to [90] which is an alkyl group.
- R 1 is a hydrogen atom
- R 2 is an ethyl group, the polypeptide according to any one of [1] to [5], [88] to [90] and [96].
- R 1 is a hydrogen atom
- R 2 is a methyl group, [1] to [5], [88] to [90] and [96].
- R 1 and R 2 is a hydrogen atom, the polypeptide according to any one of [1] to [5] and [88] to [90].
- Y is C 3 ⁇ C 8 cycloalkyl group or C 6 ⁇ C 9 an aralkyl group, wherein the aralkyl group is C 1 ⁇ C 3
- Y is C 3 ⁇ C 8 The polypeptide according to any one of [1] to [5], [88] to [90] and [96] to [100], which is a cycloalkyl group.
- Y is C 6 ⁇ C 9 an aralkyl group, wherein the aralkyl group is C 1 ⁇ C 3
- the polypeptide according to any one of [1] to [5], [88] to [90] and [96] to [100], which may be substituted with an alkyl group or halogen atom of [103]
- R 1 is a hydrogen atom
- R 2 is an ethyl group
- both n and m are 0,
- Y is a group represented by formula (3)
- R 3 is a phenyl group
- R 4 , R 5 and R 6 are all hydrogen atoms
- p, q, and r are all 1, [1] to [5] and [88] to [90].
- R 1 is a hydrogen atom
- R 2 is an ethyl group
- both n and m are 0,
- Y is a group represented by formula (3)
- R 3 is a p-tolyl group
- R 4 , R 5 and R 6 are all hydrogen atoms
- p, q, and r are all 1, [1] to [5] and [88] to [90].
- R 1 is a hydrogen atom
- R 2 is a methyl group
- both n and m are 0,
- Y is a group represented by formula (3)
- R 3 and R 4 are linked to each other to form a cyclopentane ring
- R 5 and R 6 are all hydrogen atoms
- p, q, and r are all 1, [1] to [5] and [88] to [90].
- [106] An isolated nucleic acid encoding the polypeptide of any one of [1] to [105].
- a vector comprising the nucleic acid of [106].
- a method of producing a polypeptide comprising culturing the transformant of [108] such that the polypeptide is produced. [110] The method of [109], further comprising recovering said polypeptide.
- a reductive aminating agent comprising the polypeptide according to any one of [1] to [105].
- the amine or amine analogue is represented by the above formula (1), and R in the formula (1) 1 and R 2 is R described in formula (1) of [1] 1 and R 2
- the keto acid or keto acid analog is represented by the above formula (2), and the formula (1′), formula (3), X, Y, Z in the formula (2) 1 , Z 2 , R 1a , R 3 , R 4 , R 5 , R 6 , m, n, p, q and r are the formula (1′) formula (3), X, Y, Z described in formula (2) of [1] 1 , Z 2 , R 1a , R 3 , R 4 , R 5 , R 6 , m, n, p, q, and r, respectively.
- v and w each independently represent 0 or 1, any one or more of v and w represents 1, T represents a carbon atom, a phosphorus atom, or a sulfur atom, and the following Formula (4a)
- the functional group represented by O, -ORd or a hydroxy group
- the two functional groups represented by formula (4a) present in plurality may be the same or different
- Ra, Rb and Rc are each independently a hydrogen atom, C 1 ⁇ C 3 alkyl group, alkylamino group or -CH 2 - represents ORd
- Any two or more of Ra, Rb, and Rc may be linked together with T to form a ring structure
- Rd is C 1 ⁇ C 3 represents an alkyl group
- d, e and f each independently represent 0 or 1; any one or more of d, e and f represents 1; when v and w are both 1, at least one of Ra, Rb and Rc is a methyl group
- T is a phosphorus atom or a sulfur atom
- the functional group represented by formula (4a) O
- Ra, Rb and Rc are all methyl groups [119]
- the production method of [119] or [120] which is one or more compounds.
- Step (A) to the object to be purified, which is a mixture of the object to be purified (i) below and the impurity (ii) below, obtained by the method according to any one of [112] to [122] contacting the lithium-containing substance; (i) the amino acid having a protecting group at the N-terminus; (ii) a compound other than the purification target, Step (B): a step of precipitating the lithium salt of the purification target.
- a method for producing a peptide compound comprising the steps of: (1) A step of producing an amino acid by the method according to any one of [112] to [122]; and (2) A step of linking the amino acid with one or more selected from the group consisting of other amino acids and peptides to produce a peptide compound.
- polypeptides that can be used as enzymes that catalyze reductive amination reactions.
- a method for producing an amino acid using the polypeptide it is possible to provide new polypeptides that can be used as enzymes that catalyze reductive amination reactions.
- FIG. 1 shows the compound (2S,3S)-2-amino-3-phenyl-butanoic acid (I) obtained by the reaction in the example, and the purchased standard compound (2S,3R)-2-amino-3-
- FIG. 1 shows 1 H-NMR measurement spectra of phenyl-butanoic acid hydrochloride (II) and (2S,3S)-2-amino-3-phenyl-butanoic acid hydrochloride (III).
- FIG. 2 shows the compound (2S,3S)-2-amino-3-phenyl-butanoic acid (I) obtained by the reaction in the example, and the purchased standard compounds (III) and (IV)
- One or more as used herein means one or two or more numbers. When “one or more” is used in the context of substituents on a group, the term means from one to the maximum number of substituents allowed by the group. “One or more” specifically includes, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and/or more.
- to indicating a range includes values at both ends thereof, for example, "A to B” means a range of A or more and B or less.
- the term "about” when used in combination with a numerical value means a value range of +10% and -10% of that numerical value.
- A, B and/or C includes the following seven variations; (i) A, (ii) B, (iii) C, (iv) A and B , (v) A and C, (vi) B and C, (vii) A, B and C.
- alkyl group refers to a monovalent group derived from an aliphatic hydrocarbon by removing any one hydrogen atom, and heteroatoms (atoms other than carbon atoms and hydrogen atoms in the skeleton). or a subset of hydrocarbyl or hydrocarbon radical structures that contain hydrogen and carbon atoms without containing unsaturated carbon-carbon bonds. Alkyl groups include not only straight-chain ones but also branched-chain ones. Specifically, the alkyl group is an alkyl group having 1 to 20 carbon atoms (C 1 to C 20 , hereinafter “C p to C q ” means having p to q carbon atoms).
- alkyl groups include methyl group, ethyl group, n-propyl group, i-propyl group, n-butyl group, s-butyl group, t-butyl group, isobutyl (2-methylpropyl) group, n -pentyl group, s-pentyl (1-methylbutyl) group, t-pentyl (1,1-dimethylpropyl) group, neopentyl (2,2-dimethylpropyl) group, isopentyl (3-methylbutyl) group, 3-pentyl ( 1-ethylpropyl) group, 1,2-dimethylpropyl group, 2-methylbutyl group, n-hexyl group, 1,1,2-trimethylpropyl group, 1,2,2-trimethylpropyl group, 1,1,2 , 2-tetra
- an "alkenyl group” is a monovalent group having at least one double bond (two adjacent SP 2 carbon atoms). Depending on the configuration of the double bond and substituents (if any), the geometry of the double bond can be in the
- E E
- Z cis or trans configuration.
- Alkenyl groups include not only straight-chain but also branched-chain ones.
- the alkenyl group preferably includes a C 2 to C 10 alkenyl group, more preferably a C 2 to C 6 alkenyl group.
- Specific examples include vinyl group, allyl group, 1-propenyl group, 2-propenyl group, 1-butenyl group, 2-butenyl group (including cis and trans), 3-butenyl group, pentenyl group, 3-methyl-2-butenyl group, hexenyl group and the like.
- an "alkynyl group” is a monovalent group having at least one triple bond (two adjacent SP carbon atoms). Alkynyl groups include not only straight-chain ones but also branched-chain ones.
- the alkynyl group preferably includes a C 2 to C 10 alkynyl group, more preferably a C 2 to C 6 alkynyl group, and specific examples include ethynyl, 1-propynyl, propargyl, 3-butynyl, pentynyl group, hexynyl group, 3-phenyl-2-propynyl group, 3-(2'-fluorophenyl)-2-propynyl group, 2-hydroxy-2-propynyl group, 3-(3-fluorophenyl)-2- Propynyl group, 3-methyl-(5-phenyl)-4-pentynyl group and the like.
- cycloalkyl group means a saturated or partially saturated cyclic monovalent aliphatic hydrocarbon group, including monocyclic, bicyclic and spirocyclic rings.
- Preferred cycloalkyl groups include C 3 to C 8 cycloalkyl groups, and specific examples include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, bicyclo[2. 2.1]heptyl group, spiro[3.3]heptyl group and the like.
- aryl group means a monovalent aromatic hydrocarbon ring, preferably a C 6 -C 10 aryl group.
- aryl groups include phenyl groups and naphthyl (eg, 1-naphthyl, 2-naphthyl) groups.
- heterocyclyl group means a non-aromatic cyclic monovalent group containing 1 to 5 heteroatoms in addition to carbon atoms.
- a heterocyclyl group may have double and/or triple bonds in the ring, a carbon atom in the ring may be oxidized to form a carbonyl, and may be single or fused rings.
- the number of atoms constituting the ring is preferably 4-10 (4- to 10-membered heterocyclyl group), more preferably 4-7 (4- to 7-membered heterocyclyl group).
- heterocyclyl groups include azetidinyl, oxiranyl, oxetanyl, dihydrofuryl, tetrahydrofuryl, dihydropyranyl, tetrahydropyranyl, tetrahydropyridyl, tetrahydropyrimidyl, and morpholinyl groups.
- thiomorpholinyl group pyrrolidinyl group, piperidinyl group, piperazinyl group, pyrazolidinyl group, imidazolinyl group, imidazolidinyl group, oxazolidinyl group, isoxazolidinyl group, thiazolidinyl group, isothiazolidinyl group, 1,2-thiazinane group, thiadiazo lysinyl group, oxazolidone group, benzodioxanyl group, benzoxazolyl group, dioxolanyl group, dioxanyl group, tetrahydropyrrolo[1,2-c]imidazole group, thietanyl group, 3,6-diazabicyclo[3.1.
- protected heterocyclyl group means a group in which one or more functional groups included in the "heterocyclyl group” defined above, such as an amino group, are protected with an arbitrary protecting group. , and preferably protected 4- to 7-membered heterocyclyl groups.
- protecting groups include Boc, Fmoc, Cbz, Troc, and Alloc
- specific examples of protected heterocyclyl groups include Boc-protected azetidine groups.
- heterocycloalkylidene group refers to two hydrogen atoms, the free valences of which are part of the double bond, generated by removing two hydrogen atoms from one carbon atom of the “heterocyclyl group” defined above. means a valence group.
- the heterocycloalkylidene group preferably includes a 4- to 7-membered heterocycloalkylidene group, and specific examples thereof include a tetrahydropyran-4-ylidene group and an azetidin-3-ylidene group.
- protected heterocycloalkylidene group refers to one or more functional groups contained in the "heterocycloalkylidene group” defined above, such as an amino group protected with any protecting group. and preferably includes a protected 4- to 7-membered heterocycloalkylidene group.
- protecting groups include Boc, Fmoc, Cbz, Troc, and Alloc
- protected heterocycloalkylidene groups include Boc-protected azetidin-3-ylidene groups.
- heteroaryl group means an aromatic cyclic monovalent group containing 1 to 5 heteroatoms in addition to carbon atoms.
- the ring may be monocyclic, condensed with another ring, or partially saturated.
- the number of atoms constituting the ring may be 5 to 12 (5- to 12-membered heteroaryl), 6 to 10 (6- to 10-membered heteroaryl), 6-7 (6- to 7-membered heteroaryl) ).
- heteroaryl groups include furyl, thienyl, pyrrolyl, imidazolyl, pyrazolyl, thiazolyl, isothiazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyridyl group, pyrimidyl group, pyridazinyl group, pyrazinyl group, triazinyl group, benzofuranyl group, benzothienyl group, benzothiadiazolyl group, benzothiazolyl group, benzoxazolyl group, benzoxadiazolyl group, benzimidazolyl group, indolyl group, isoindolyl group, indazolyl group, quinolyl group, isoquinolyl group, cinnolinyl group, quinazolinyl group, quinoxalinyl group, benzodi
- alkoxy group means an oxy group to which the above-defined "alkyl group” is bonded, preferably a C 1 -C 6 alkoxy group.
- Specific examples of the alkoxy group include, for example, methoxy group, ethoxy group, 1-propoxy group, 2-propoxy group, n-butoxy group, i-butoxy group, s-butoxy group, t-butoxy group, pentyloxy group, 3-methylbutoxy group and the like.
- alkylthio group means a thiol group to which the above-defined "alkyl group” is bonded, preferably a C 1 -C 6 alkylthio group.
- alkylthio groups include methylthio, ethylthio, 1-propylthio, 2-propylthio, n-butylthio, i-butylthio, s-butylthio and t-butylthio groups.
- an "alkenyloxy group” means an oxy group to which the above-defined “alkenyl group” is bonded, preferably a C 2 -C 6 alkenyloxy group.
- alkenyloxy groups include vinyloxy, allyloxy, 1-propenyloxy, 2-propenyloxy, 1-butenyloxy, 2-butenyloxy (including cis and trans), and 3-butenyloxy groups. , pentenyloxy group, hexenyloxy group and the like.
- cycloalkoxy group means an oxy group to which the above-defined “cycloalkyl group” is bonded, preferably a C 3 -C 8 cycloalkoxy group.
- Specific examples of cycloalkoxy groups include cyclopropoxy, cyclobutoxy, and cyclopentyloxy groups.
- aryloxy group means an oxy group to which the above-defined “aryl group” is bonded, preferably a C 6 -C 10 aryloxy group.
- Specific examples of the aryloxy group include a phenoxy group, a 1-naphthyloxy group, a 2-naphthyloxy group and the like.
- amino group means -NH2 in a narrow sense and -NRR' in a broad sense, where R and R' are independently a hydrogen atom, an alkyl group, an alkenyl group , an alkynyl group, a cycloalkyl group, a heterocyclyl group, an aryl group, or a heteroaryl group, or R and R' together with the nitrogen atom to which they are attached form a ring.
- Preferred amino groups include -NH 2 , mono-C 1 -C 6 alkylamino groups, di-C 1 -C 6 alkylamino groups, 4- to 8-membered cyclic amino groups and the like.
- the term "monoalkylamino group” means a group in which R is a hydrogen atom and R' is an "alkyl group” as defined above in the above-defined "amino group", preferably , and mono C 1 -C 6 alkylamino groups.
- monoalkylamino groups include methylamino, ethylamino, n-propylamino, i-propylamino, n-butylamino, s-butylamino and t-butylamino groups. are mentioned.
- dialkylamino group means a group in which R and R′ are independently the “alkyl group” defined above in the “amino group” defined above, preferably di-C 1 ⁇ C6 alkylamino groups.
- Specific examples of the dialkylamino group include a dimethylamino group and a diethylamino group.
- cyclic amino group means a group in which R and R' form a ring together with the nitrogen atom to which they are attached in the above-defined "amino group”, preferably includes a 4- to 8-membered cyclic amino group.
- Specific examples of the cyclic amino group include, for example, 1-azetidyl group, 1-pyrrolidyl group, 1-piperidyl group, 1-piperazyl group, 4-morpholinyl group, 3-oxazolidyl group, 1,1-dioxidethiomorphol nyl-4-yl group, 3-oxa-8-azabicyclo[3.2.1]octan-8-yl group and the like.
- protected amino group means an amino group protected with any protecting group.
- protected amino include amino groups protected with a protecting group such as Boc, Fmoc, Cbz, Troc and Alloc.
- aminocarbonyl group means a carbonyl group to which the above-defined “amino group” is bonded, preferably -CONH 2 , mono C 1 -C 6 alkylaminocarbonyl group, di-C 1 - C6 alkylaminocarbonyl groups and 4- to 8-membered cyclic aminocarbonyl groups can be mentioned.
- Specific examples of the aminocarbonyl group include -CONH 2 , dimethylaminocarbonyl group, 1-azetidinylcarbonyl group, 1-pyrrolidinylcarbonyl group, 1-piperidinylcarbonyl group and 1-piperazinylcarbonyl group.
- alkenyloxycarbonyl group means a carbonyl group to which the above-defined “alkenyloxy group” is bonded, preferably a C 2 -C 6 alkenyloxycarbonyl group.
- alkenyloxycarbonyl groups include vinyloxycarbonyl, allyloxycarbonyl, 1-propenyloxycarbonyl, 2-propenyloxycarbonyl, 1-butenyloxycarbonyl and 2-butenyloxycarbonyl groups. groups (including cis and trans), 3-butenyloxycarbonyl groups, pentenyloxycarbonyl groups, hexenyloxycarbonyl groups and the like.
- alkylsulfonyl group means a sulfonyl group to which the above-defined “alkyl group” is bonded, preferably a C 1 -C 6 alkylsulfonyl group.
- alkylsulfonyl groups include methylsulfonyl groups.
- hydroxyalkyl group means a group in which one or more hydrogen atoms of the “alkyl group” defined above are substituted with hydroxyl groups, and C 1 to C 6 hydroxyalkyl groups are preferred.
- Specific examples of hydroxyalkyl groups include hydroxymethyl group, 1-hydroxyethyl group, 2-hydroxyethyl group, 2-hydroxy-2-methylpropyl group and 5-hydroxypentyl group.
- haloalkyl group means a group in which one or more hydrogen atoms of the “alkyl group” defined above is substituted with a halogen atom, preferably a C 1 to C 6 haloalkyl group, and a C 1 ⁇ C6 fluoroalkyl groups are more preferred.
- haloalkyl groups include difluoromethyl group, trifluoromethyl group, 2,2-difluoroethyl group, 2,2,2-trifluoroethyl group, 3,3-difluoropropyl group, 4,4- difluorobutyl group, 5,5-difluoropentyl group and the like.
- cyanoalkyl group used herein means a group in which one or more hydrogen atoms of the “alkyl group” defined above is replaced with a cyano group, preferably a C 1 -C 6 cyanoalkyl group.
- cyanoalkyl groups include cyanomethyl groups and 2-cyanoethyl groups.
- aminoalkyl group means a group in which one or more hydrogen atoms of the "alkyl group” defined above are replaced with the “amino group” defined above, and C 1 to C 6 amino Alkyl groups are preferred.
- Specific examples of aminoalkyl groups include 1-pyridylmethyl group, 2-(1-piperidyl)ethyl group, 3-(1-piperidyl)propyl group, 4-aminobutyl group and the like.
- the “carboxyalkyl group” used herein means a group in which one or more hydrogen atoms of the “alkyl group” defined above is replaced with a carboxy group, preferably a C 2 -C 6 carboxyalkyl group. Specific examples of the carboxyalkyl group include a carboxymethyl group.
- alkenyloxycarbonylalkyl group means a group in which one or more hydrogen atoms of the "alkyl group” defined above are substituted with the "alkenyloxycarbonyl group” defined above, and C 2 -C 6 alkenyloxycarbonyl C 1 -C 6 alkyl groups are preferred, and C 2 -C 6 alkenyloxycarbonyl C 1 -C 2 alkyl groups are more preferred.
- alkenyloxycarbonylalkyl groups include allyloxycarbonylmethyl groups and 2-(allyloxycarbonyl)ethyl groups.
- alkoxyalkyl group used herein means a group in which one or more hydrogen atoms of the “alkyl group” defined above are replaced with the “alkoxy group” defined above, and C 1 to C 6 alkoxy C 1 -C 6 alkyl groups are preferred, and C 1 -C 6 alkoxy C 1 -C 2 alkyl groups are more preferred.
- alkoxyalkyl groups include, for example, methoxymethyl group, ethoxymethyl group, 1-propoxymethyl group, 2-propoxymethyl group, n-butoxymethyl group, i-butoxymethyl group, s-butoxymethyl group, t -butoxymethyl group, pentyloxymethyl group, 3-methylbutoxymethyl group, 1-methoxyethyl group, 2-methoxyethyl group, 2-ethoxyethyl group and the like.
- alkylthioalkyl group used herein means a group in which one or more hydrogen atoms of the “alkyl group” defined above are replaced with the “alkylthio group” defined above, and C 1 to C 6 alkylthio C 1 -C 6 alkyl groups are preferred, and C 1 -C 6 alkylthio C 1 -C 2 alkyl groups are more preferred.
- alkylthioalkyl groups include methylthiomethyl group, ethylthiomethyl group, 1-propylthiomethyl group, 2-propylthiomethyl group, n-butylthiomethyl group, i-butylthiomethyl group, s- butylthiomethyl group, t-butylthiomethyl group and the like.
- alkenyloxyalkyl group means a group in which one or more hydrogen atoms of the "alkyl group” defined above are replaced with the "alkenyloxy group” defined above. 6 alkenyloxy C 1 -C 6 alkyl groups are preferred, and C 1 -C 6 alkenyloxy C 1 -C 2 alkyl groups are more preferred. Specific examples of alkenyloxyalkyl groups include vinyloxymethyl groups and allyloxymethyl groups.
- cycloalkylalkyl group means a group in which one or more hydrogen atoms of the "alkyl group” defined above is replaced with the "cycloalkyl group” defined above. 8 cycloalkyl C 1 -C 6 alkyl groups are preferred, and C 3 -C 6 cycloalkyl C 1 -C 2 alkyl groups are more preferred. Specific examples of cycloalkylalkyl groups include a cyclopropylmethyl group, a cyclobutylmethyl group, a cyclopentylmethyl group, a cyclohexylmethyl group and the like.
- cycloalkoxyalkyl group means a group in which one or more hydrogen atoms of the "alkyl group” defined above is replaced with the "cycloalkoxy group” defined above, and 8 Cycloalkoxy C 1 -C 6 alkyl groups are preferred, and C 3 -C 6 cycloalkoxy C 1 -C 2 alkyl groups are more preferred.
- Specific examples of cycloalkoxyalkyl groups include a cyclopropoxymethyl group and a cyclobutoxymethyl group.
- heterocyclylalkyl group means a group in which one or more hydrogen atoms of the "alkyl group” defined above are substituted with the "heterocyclyl group” defined above, and a 4- to 7-membered heterocyclyl C Preferred are 1 - C6 alkyl groups, more preferred are 4- to 7-membered heterocyclyl C1 - C2 alkyl groups.
- Specific examples of heterocyclylalkyl groups include 2-(tetrahydro-2H-pyran-4-yl)ethyl group and 2-(azetidin-3-yl)ethyl group.
- alkylsulfonylalkyl group used herein means a group in which one or more hydrogen atoms of the “alkyl group” defined above are substituted with the “alkylsulfonyl group” defined above, and C 1 to C 6 alkylsulfonyl C 1 -C 6 alkyl groups are preferred, and C 1 -C 6 alkylsulfonyl C 1 -C 2 alkyl groups are more preferred.
- Specific examples of alkylsulfonylalkyl groups include a methylsulfonylmethyl group and a 2-(methylsulfonyl)ethyl group.
- aminocarbonylalkyl group means a group in which one or more hydrogen atoms of the "alkyl group” defined above is replaced with the “aminocarbonyl group” defined above, and aminocarbonyl C 1 -C6 alkyl groups are preferred, and aminocarbonyl C1 - C4 alkyl groups are more preferred.
- aminocarbonylalkyl group examples include, for example, a methylaminocarbonylmethyl group, a dimethylaminocarbonylmethyl group, a t-butylaminocarbonylmethyl group, a 1-azetidinylcarbonylmethyl group, a 1-pyrrolidinylcarbonylmethyl group, 1-piperidinylcarbonylmethyl group, 4-morpholinylcarbonylmethyl group, 2-(methylaminocarbonyl)ethyl group, 2-(dimethylaminocarbonyl)ethyl group, 2-(1-azetidinylcarbonyl)ethyl group , 2-(1-pyrrolidinylcarbonyl)ethyl group, 2-(4-morpholinylcarbonyl)ethyl group, 3-(dimethylaminocarbonyl)propyl group, 4-(dimethylaminocarbonyl)butyl group and the like. .
- aryloxyalkyl group means a group in which one or more hydrogen atoms of the “alkyl group” defined above is replaced with the “aryloxy group” defined above.
- 10 aryloxy C 1 -C 6 alkyl groups are preferred, and C 6 -C 10 aryloxy C 1 -C 2 alkyl groups are more preferred.
- Specific examples of aryloxyalkyl groups include a phenoxymethyl group and a 2-phenoxyethyl group.
- aralkyl (arylalkyl) group means a group in which at least one hydrogen atom of the “alkyl group” defined above is substituted with the “aryl group” defined above, and has C 7 to C 14 Aralkyl groups are preferred, and C 7 -C 10 aralkyl groups are more preferred.
- Specific examples of aralkyl groups include benzyl, phenethyl and 3-phenylpropyl groups.
- aralkoxy group means an oxy group to which the above-defined “aralkyl group” is bonded, preferably a C 7 -C 14 aralkoxy group, more preferably a C 7 -C 10 aralkoxy group.
- aralkoxy groups include benzyloxy, phenethyloxy, and 3-phenylpropoxy groups.
- aralkoxyalkyl group means a group in which one or more hydrogen atoms of the “alkyl group” defined above is replaced with the “aralkoxy group” defined above, and Preferred are 14 aralkoxy C 1 -C 6 alkyl groups, more preferred are C 7 -C 14 aralkoxy C 1 -C 2 alkyl groups.
- Specific examples of aralkoxyalkyl groups include a benzyloxymethyl group and a 1-(benzyloxy)ethyl group.
- heteroarylalkyl group means a group in which at least one hydrogen atom of the “alkyl group” defined above is replaced with the “heteroaryl group” defined above, and a 5- to 10-membered heteroaryl Preferred are C 1 -C 6 alkyl groups, more preferred are 5- to 10-membered heteroaryl C 1 -C 2 alkyl groups.
- Specific examples of heteroarylalkyl groups include, for example, 3-thienylmethyl group, 4-thiazolylmethyl group, 2-pyridylmethyl group, 3-pyridylmethyl group, 4-pyridylmethyl group and 2-(2-pyridyl)ethyl group.
- heteroarylalkoxy group means an oxy group to which the above-defined “heteroarylalkyl group” is bonded, and is preferably a 5- to 10-membered heteroaryl C 1 to C 6 alkoxy group, with 5 to 10 More preferred are membered heteroaryl C 1 -C 2 alkoxy groups.
- Specific examples of heteroarylalkoxy groups include 3-thienylmethoxy and 3-pyridylmethoxy groups.
- heteroarylalkoxyalkyl group means a group in which one or more hydrogen atoms of the "alkyl group” defined above are substituted with the "heteroarylalkoxy group” defined above.
- Preferred are 10-membered heteroaryl C 1 -C 6 alkoxy C 1 -C 6 alkyl groups, more preferred are 5-10 membered heteroaryl C 1 -C 2 alkoxy C 1 -C 2 alkyl groups.
- Specific examples of heteroarylalkoxyalkyl groups include 3-pyridylmethoxymethyl groups.
- heterocycloalkylidenealkyl group as used herein means a group in which one or more hydrogen atoms of the "alkyl group” defined above are substituted with the "heterocycloalkylidene group” defined above.
- 7-membered heterocycloalkylidene C 1 -C 6 alkyl groups are preferred, and 4- to 7-membered heterocycloalkylidene C 1 -C 2 alkyl groups are more preferred.
- Specific examples of heterocycloalkylidenealkyl groups include a tetrahydro-4H-pyran-4-ylidenemethyl group and an azetidin-3-ylidenemethyl group.
- alkoxyalkenyl group means a group in which one or more hydrogen atoms of the "alkenyl group” defined above are replaced with the "alkoxy group” defined above, and C 1 to C 6 alkoxy C 2 -C 6 alkenyl groups are preferred.
- alkoxyalkenyl groups include (E)-4-methoxybut-2-en-1-yl groups and the like.
- aminocarbonylalkenyl group means a group in which one or more hydrogen atoms of the "alkenyl group” defined above is replaced with the “aminocarbonyl group” defined above, and aminocarbonyl C 2 ⁇ C6 alkenyl groups are preferred.
- Specific examples of aminocarbonylalkenyl groups include (E)-3-(dimethylaminocarbonylcarbonyl)-prop-2-en-1-yl groups and the like.
- haloalkoxy group means a group in which one or more hydrogen atoms of the above-defined “alkoxy group” are substituted with halogen atoms, preferably a C 1 -C 6 haloalkoxy group.
- haloalkoxy groups include difluoromethoxy, trifluoromethoxy, 2,2-difluoroethoxy and 2,2,2-trifluoroethoxy groups.
- alkylene group refers to a divalent group derived from the aforementioned "alkyl group” by further removing one hydrogen atom, and is preferably a C4 - C8 alkylene group.
- alkylene groups include -CH 2 -, -(CH 2 ) 2 -, -(CH 2 ) 3 -, -CH(CH 3 )CH 2 -, -C(CH 3 ) 2 -, -( CH 2 ) 4 -, -CH(CH 3 )CH 2 CH 2 -, -C(CH 3 ) 2 CH 2 -, -CH 2 CH(CH 3 )CH 2 -, -CH 2 C(CH 3 ) 2 -, -CH 2 CH 2 CH(CH 3 )-, -(CH 2 ) 5 -, -(CH 2 ) 6 -, -(CH 2 ) 7 -, -(CH 2 ) 8 - and the like.
- cycloalkylene group means a divalent group derived from the above-mentioned “cycloalkyl group” by further removing one hydrogen atom, and is preferably a C3 - C8 cycloalkylene group.
- Specific examples of the cycloalkylene group include cyclopropane-1,2-diyl group, cyclobutane-1,2-diyl group, cyclopentane-1,2-diyl group, cyclohexane-1,2-diyl group and the like. .
- an "alkenylene group” means a divalent group derived from the above “alkenyl group” by further removing one hydrogen atom.
- the alkenylene group includes linear or branched ones, preferably a C 2 -C 10 alkenylene group, more preferably a C 2 -C 6 alkenylene group.
- alkynylene group means a divalent group derived from the aforementioned “alkynyl group” by further removing one hydrogen atom.
- the alkynylene group includes linear or branched ones, preferably a C 2 -C 10 alkynylene group, more preferably a C 2 -C 6 alkynylene group.
- arylene group means a divalent group derived by further removing one hydrogen atom from the above-mentioned "aryl group”.
- An arylene group may be monocyclic or condensed. Although the number of atoms constituting the ring is not particularly limited, it is preferably 6-10 (C 6 -C 10 arylene group).
- Specific examples of arylene groups include 1,2-phenylene group, 1,3-phenylene group, 1,4-phenylene group, 1,2-naphthylene group, 1,3-naphthylene group and 1,4-naphthylene group. and the like.
- a "spirocycloalkyl group” means a group formed by sharing one carbon atom constituting a cycloalkane ring with a carbon atom in a group to which it is bonded.
- Preferable spirocycloalkyl groups include C 3 to C 8 spirocycloalkyl groups, and specific examples include spirocyclopropyl, spirocyclobutyl, spirocyclopentyl, spirocyclohexyl, spirocycloheptyl, spiro A cyclooctyl group and the like can be mentioned.
- spiroheterocyclyl group means a group in which one or more carbon atoms in the above “spirocycloalkyl group” are replaced with heteroatoms.
- the spiroheterocyclyl group is preferably a 4- to 10-membered spiroheterocyclyl group.
- Alicyclic ring as used herein means a non-aromatic hydrocarbon ring.
- the alicyclic ring may have an unsaturated bond in the ring, or may be a polycyclic ring having two or more rings. A carbon atom constituting the ring may be oxidized to form a carbonyl group.
- the alicyclic ring preferably includes a 3- to 8-membered alicyclic ring, and specific examples thereof include cyclopropane ring, cyclobutane ring, cyclopentane ring, cyclohexane ring, cycloheptane ring, cyclooctane ring, bicyclo[ 2.2.1] heptane ring and the like.
- heterocyclic ring as used herein means a non-aromatic heterocyclic ring containing preferably 1 to 5, more preferably 1 to 3 heteroatoms in the ring-constituting atoms. Heterocycles may have double and/or triple bonds in the ring, carbon atoms in the ring may be oxidized to form carbonyls, and may be monocyclic, fused, or spirocyclic.
- the number of atoms constituting the ring is preferably 3 to 12 (3- to 12-membered heterocyclic ring), more preferably 4 to 8 (4- to 8-membered heterocyclic ring).
- heterocyclic rings include azetidine ring, oxetane ring, tetrahydrofuran ring, tetrahydropyran ring, morpholine ring, thiomorpholine ring, pyrrolidine ring, 4-oxopyrrolidine ring, piperidine ring, 4-oxopiperidine ring, and piperazine.
- saturated heterocycle means a non-aromatic heterocycle containing 1 to 5 heteroatoms in addition to carbon atoms and no double and/or triple bonds in the ring. do.
- the saturated heterocyclic ring may be monocyclic, or may form a condensed ring with another ring such as an aromatic ring such as a benzene ring.
- the saturated heterocyclic ring When the saturated heterocyclic ring forms a condensed ring, the saturated heterocyclic ring preferably includes a 4- to 7-membered saturated heterocyclic ring, and specific examples thereof include an azetidine ring, an oxetane ring, a tetrahydrofuran ring, a tetrahydropyran ring, and a morpholine ring.
- thiomorpholine ring pyrrolidine ring, 4-oxopyrrolidine ring, piperidine ring, 4-oxopiperidine ring, piperazine ring, pyrazolidine ring, imidazolidine ring, oxazolidine ring, isoxazolidine ring, thiazolidine ring, isothiazolidine ring, thiadiazolidine ring, oxazolidone ring, dioxolane ring, dioxane ring, thietane ring, octahydroindole ring, indoline ring, azepane ring and the like.
- amino acid includes natural amino acids and non-natural amino acids.
- natural amino acids include Gly, Ala, Ser, Thr, Val, Leu, Ile, Phe, Tyr, Trp, His, Glu, Asp, Gln, Asn, Cys, Met, Lys, Arg, Pro point to Non-natural amino acids are not particularly limited, but are exemplified by ⁇ -amino acids, ⁇ -amino acids, D-amino acids, N-substituted amino acids, ⁇ , ⁇ -disubstituted amino acids, amino acids whose side chains are different from natural ones, and hydroxycarboxylic acids.
- unnatural N-substituted amino acids refer to N-substituted amino acids other than Pro. Any configuration is acceptable for the amino acids herein.
- the side chains of amino acids are not particularly limited, but may be selected freely from, for example, alkyl groups, alkenyl groups, alkynyl groups, aryl groups, heteroaryl groups, aralkyl groups, and cycloalkyl groups in addition to hydrogen atoms.
- One or two non-adjacent methylene groups in the group may be substituted with an oxygen atom, a carbonyl group (--CO--), or a sulfonyl group ( --SO.sub.2-- ).
- each may be provided with a substituent, and those substituents are not limited.
- substituents are not limited.
- One or two or more may be freely selected independently from among. Examples include optionally substituted alkyl groups, alkenyl groups, alkynyl groups, aryl groups, heteroaryl groups, aralkyl groups, cycloalkyl groups and the like.
- the amino acid herein may be a compound having a carboxy group and an amino group in the same molecule (even in this case, imino acids such as proline and hydroxyproline are also amino acids). included).
- the main chain amino group of an amino acid may be unsubstituted ( NH2 group) or optionally substituted (i.e. -NHR group: R is an optionally substituted alkyl group, alkenyl group, alkynyl group , an aryl group, a heteroaryl group, an aralkyl group, a cycloalkyl group, and one or two non-adjacent methylene groups in these groups are an oxygen atom, a carbonyl group (—CO—), or a sulfonyl group (—SO 2- ), or the carbon chain bonded to the N atom and the carbon atom at the ⁇ -position may form a ring like proline).
- R is an optionally substituted alkyl group, alkenyl group, alkynyl group , an aryl group, a heteroaryl group, an aralkyl group, a cycloalkyl group, and one or two non-adjacent methylene groups in these
- the substituents for R are selected in the same manner as the substituents in the amino acid side chains described above.
- the aforementioned R when the main chain amino group is substituted is included in the "side chain of amino acid" in the present specification.
- Amino acids in which such backbone amino groups are substituted are referred to herein as "N-substituted amino acids.”
- the "N-substituted amino acid” in the present specification is preferably exemplified by N-alkylamino acid, N-C 1 -C 6 alkylamino acid, N-C 1 -C 4 alkylamino acid and N-methylamino acid. is not limited to
- amino acid as used herein includes all corresponding isotopes.
- An “amino acid” isotope is one in which at least one atom has been replaced with an atom having the same atomic number (proton number) but a different mass number (proton plus neutron number).
- isotopes included in “amino acid” herein include hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, chlorine atoms, and the like, respectively, 2H , 3 H, 13 C, 14 C, 15 N, 17 O, 18 O, 31 P, 32 P, 35 S, 18 F, 36 Cl and the like are included.
- Examples of the substituent containing a halogen atom in the present specification include an alkyl group, a cycloalkyl group, an alkenyl group, an alkynyl group, an aryl group, a heteroaryl group, an aralkyl group and the like having a halogen as a substituent, and more specifically is exemplified by a fluoroalkyl group, a difluoroalkyl group, a trifluoroalkyl group and the like.
- Examples of oxy groups include alkoxy groups, cycloalkoxy groups, alkenyloxy groups, alkynyloxy groups, aryloxy groups, heteroaryloxy groups, aralkyloxy groups, and the like.
- alkoxy group a C 1 -C 4 alkoxy group and a C 1 -C 2 alkoxy group are preferable, and a methoxy group or an ethoxy group is particularly preferable.
- Examples of oxycarbonyl group include alkyloxycarbonyl group, cycloalkyloxycarbonyl group, alkenyloxycarbonyl group, alkynyloxycarbonyl group, aryloxycarbonyl group, heteroaryloxycarbonyl group, An aralkyloxycarbonyl group and the like can be mentioned.
- carbonyloxy groups examples include alkylcarbonyloxy groups, cycloalkylcarbonyloxy groups, alkenylcarbonyloxy groups, alkynylcarbonyloxy groups, arylcarbonyloxy groups, heteroarylcarbonyloxy groups. groups, aralkylcarbonyloxy groups, and the like.
- thiocarbonyl group examples include alkylthiocarbonyl group, cycloalkylthiocarbonyl group, alkenylthiocarbonyl group, alkynylthiocarbonyl group, arylthiocarbonyl group, heteroarylthiocarbonyl group, aralkylthio A carbonyl group and the like can be mentioned.
- carbonylthio groups examples include alkylcarbonylthio groups, cycloalkylcarbonylthio groups, alkenylcarbonylthio groups, alkynylcarbonylthio groups, arylcarbonylthio groups, heteroarylcarbonylthio groups. groups, aralkylcarbonylthio groups, and the like.
- aminocarbonyl groups examples include alkylaminocarbonyl groups (eg, C 1 -C 6 or C 1 -C 4 alkylaminocarbonyl groups, especially ethylaminocarbonyl groups, methylaminocarbonyl groups, carbonyl groups, etc.), cycloalkylaminocarbonyl groups, alkenylaminocarbonyl groups, alkynylaminocarbonyl groups, arylaminocarbonyl groups, heteroarylaminocarbonyl groups, aralkylaminocarbonyl groups, and the like.
- alkylaminocarbonyl groups eg, C 1 -C 6 or C 1 -C 4 alkylaminocarbonyl groups, especially ethylaminocarbonyl groups, methylaminocarbonyl groups, carbonyl groups, etc.
- cycloalkylaminocarbonyl groups alkenylaminocarbonyl groups, alkynylaminocarbonyl groups, aryla
- Examples of carbonylamino group include alkylcarbonylamino group, cycloalkylcarbonylamino group, alkenylcarbonylamino group, alkynylcarbonylamino group, arylcarbonylamino group, heteroarylcarbonylamino group. groups, aralkylcarbonylamino groups, and the like.
- Examples of oxycarbonylamino group include alkoxycarbonylamino group, cycloalkoxycarbonylamino group, alkenyloxycarbonylamino group, alkynyloxycarbonylamino group, aryloxycarbonylamino group, heteroaryloxycarbonylamino group, aralkyloxycarbonylamino group and the like.
- sulfonylamino groups include alkylsulfonylamino groups, cycloalkylsulfonylamino groups, alkenylsulfonylamino groups, alkynylsulfonylamino groups, arylsulfonylamino groups, heteroarylsulfonylamino groups, aralkyl A sulfonylamino group and the like can be mentioned.
- the H atom bonded to the N atom in —NH—SO 2 —R is further substituted with an alkyl group, cycloalkyl group, alkenyl group, alkynyl group, aryl group, heteroaryl group, or aralkyl group. is mentioned.
- aminosulfonyl groups include alkylaminosulfonyl groups, cycloalkylaminosulfonyl groups, alkenylaminosulfonyl groups, alkynylaminosulfonyl groups, arylaminosulfonyl groups, heteroarylaminosulfonyl groups, and aralkylaminosulfonyl groups. and the like.
- sulfamoylamino groups include alkylsulfamoylamino groups, cycloalkylsulfamoylamino groups, alkenylsulfamoylamino groups, alkynylsulfamoylamino groups, arylsulfamoylamino groups. famoylamino group, heteroarylsulfamoylamino group, aralkylsulfamoylamino group and the like.
- the two H atoms attached to the N atom in —NH—SO 2 —NHR are independent from the group consisting of alkyl groups, cycloalkyl groups, alkenyl groups, alkynyl groups, aryl groups, heteroaryl groups, and aralkyl groups. may be substituted with a substituent selected by , and these two substituents may form a ring.
- Groups such as (--SO 3 H) can be mentioned.
- thio groups are selected from alkylthio groups, cycloalkylthio groups, alkenylthio groups, alkynylthio groups, arylthio groups, heteroarylthio groups, aralkylthio groups and the like.
- sulfonyl groups include alkylsulfonyl groups, cycloalkylsulfonyl groups, alkenylsulfonyl groups, alkynylsulfonyl groups, arylsulfonyl groups, heteroarylsulfonyl groups, aralkylsulfonyl groups, and the like.
- secondary amino groups include alkylamino groups, cycloalkylamino groups, alkenylamino groups, alkynylamino groups, arylamino groups, heteroarylamino groups, aralkylamino groups, and the like. mentioned.
- tertiary amino groups examples include alkyl (aralkyl)amino groups, alkyl groups, cycloalkyl groups, alkenyl groups, alkynyl groups, aryl groups, and heteroaryl groups. , an aralkyl group, etc., and an amino group having any two substituents, and these two arbitrary substituents may form a ring.
- Specific examples include dialkylamino groups, particularly C 1 -C 6 dialkylamino groups, C 1 -C 4 dialkylamino groups, dimethylamino groups and diethylamino groups.
- C p -C q dialkylamino group refers to a group in which an amino group is substituted with two C p -C q alkyl groups, and both C p -C q alkyl groups are the same. may also be different.
- substituted amidino groups are those in which the three substituents R, R' and R'' on the N atom are alkyl, cycloalkyl, alkenyl, alkynyl groups independently selected from groups, aryl groups, heteroaryl groups, and aralkyl groups, such as alkyl(aralkyl)(aryl)amidino groups, and the like.
- substituted guanidino groups are those in which R, R', R'' and R'' are an alkyl group, a cycloalkyl group and an alkenyl group. , an alkynyl group, an aryl group, a heteroaryl group and an aralkyl group, or a group formed by forming a ring thereof.
- aminocarbonylamino groups are those in which R, R' and R'' are a hydrogen atom, an alkyl group, a cycloalkyl group, an alkenyl group, an alkynyl group, an aryl group, a hetero A group independently selected from an aryl group and an aralkyl group, or a group in which these form a ring, and the like can be mentioned.
- peptide residue and “amino acid residue” are sometimes simply referred to as “peptide” and “amino acid”, respectively.
- a site corresponding to in the present specification can be used to characterize an amino acid residue in the amino acid sequence of the polypeptide according to this embodiment with reference to the amino acid sequence represented by SEQ ID NO:1. Alignment to determine corresponding sites can be performed by various methods within the skill in the art, such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR) software, or GENETYX® (Genetics Inc.). ) using publicly available computer software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the entire length of the sequences being compared.
- a polypeptide according to one embodiment includes a sequence having 90% or more sequence identity with a sequence in which one amino acid residue in the amino acid sequence represented by SEQ ID NO: 1 is modified, and the following formula (1 ) Reductive amination reaction of any one or more of compound A represented by or a salt thereof and any one or more of compound B represented by formula (2) described later or a salt thereof, or the compound
- the catalytic activity of any one or more of B or a salt thereof for intramolecular reductive amination reaction is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under at least one reaction condition. .
- a polypeptide according to one embodiment includes a sequence having 90% or more sequence identity with a sequence in which two amino acid residues in the amino acid sequence represented by SEQ ID NO: 1 are modified, and the following formula (1 ) Reductive amination reaction of any one or more of compound A represented by or a salt thereof and any one or more of compound B represented by formula (2) described later or a salt thereof, or the compound
- the catalytic activity of any one or more of B or a salt thereof for intramolecular reductive amination reaction is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under at least one reaction condition. .
- a polypeptide according to one embodiment includes a sequence having 90% or more sequence identity with a sequence in which three amino acid residues are modified in the amino acid sequence represented by SEQ ID NO: 1, and the following formula (1 ) Reductive amination reaction of any one or more of compound A represented by or a salt thereof and any one or more of compound B represented by formula (2) described later or a salt thereof, or the compound
- the catalytic activity of any one or more of B or a salt thereof for intramolecular reductive amination reaction is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under at least one reaction condition. .
- a polypeptide according to one embodiment may be an enzyme that catalyzes a reductive amination reaction.
- the polypeptide according to this embodiment reacts under at least one reaction condition with a reductive amination reaction of compound A or a salt thereof and a compound B or a salt thereof, or an intramolecular reductive amination reaction of compound B or a salt thereof. It may have catalytic activity.
- compound A or a salt thereof may be collectively referred to as compound A
- compound B or a salt thereof may be collectively referred to as compound B.
- the polypeptide according to one embodiment has catalytic activity for reductive amination reaction, and is therefore suitable for the production of amino acids.
- the polypeptide according to one embodiment has high synthetic activity even in the production of amino acids, which have low synthetic activity with conventional enzymes that catalyze reductive amination reactions.
- P. P.
- an amino acid hereinafter referred to as "N-Et Also referred to as the above N-substituted amino acids”
- amino acids having a branched structure at the ⁇ -position to the amino group hereinafter also referred to as “ ⁇ -branch type amino acids” had low synthetic activity.
- a polypeptide according to one embodiment has a higher activity for N-substituted amino acids higher than N-Et and/or ⁇ -branch amino acids compared to the wild-type enzyme. Furthermore, according to the polypeptide of this embodiment, the target amino acid can be produced with high stereoselectivity.
- amino acid sequence represented by SEQ ID NO: 1 is a known amino acid sequence described in Non-Patent Document 4.
- Sequence identity of amino acid sequences is measured after aligning the sequences to obtain the maximum percent sequence identity and introducing gaps if necessary, and any conservative substitutions are considered part of the sequence identity. It is defined as the percentage of amino acid residues in a candidate sequence that are identical to amino acid residues in the reference polypeptide sequence, given that . Alignments for the purpose of determining sequence identity of amino acid sequences can be performed by various methods within the skill in the art, such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR) software, or GENETYX® ( This can be accomplished by using publicly available computer software such as Genetics, Inc. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the entire length of the sequences being compared.
- sequence identity of amino acid sequences can be determined by the algorithm BLAST by Karlin and Altschul (Proc. Natl. Acad. Sci. USA (1993) 90:5873-7). Based on this algorithm, a program called BLASTN or BLASTX has been developed (Altschul et al., J. Mol. Biol. (1990) 215:403-10).
- BLASTN Altschul et al., J. Mol. Biol. (1990) 215:403-10.
- BLAST and Gapped BLAST programs use the default parameters of each program. For specific methods of these analysis methods, reference can be made to information on the BLAST (Basic Local Alignment Search Tool) website of the NCBI (National Center for Biotechnology Information).
- the ALIGN-2 sequence comparison computer program is the work of Genentech, Inc. and its source code has been submitted to the U.S. Copyright Office, Washington D.C., 20559, along with user documentation, under U.S. Copyright Registration No. TXU510087. Registered.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from source code.
- ALIGN-2 programs are compiled for use on UNIX operating systems, including Digital UNIX V4.0D. All sequence comparison parameters were set by the ALIGN-2 program and do not vary.
- the % amino acid sequence identity of a given amino acid sequence A to, with, or to a given amino acid sequence B is calculated as follows: Hundredfold. where X is the number of amino acid residues scored as identical matches in the alignment of A and B by the sequence alignment program ALIGN-2, and Y is the total number of amino acid residues in B. . It is understood that the % amino acid sequence identity of A to B is not equal to the % amino acid sequence identity of B to A if the length of amino acid sequence A is not equal to the length of amino acid sequence B. deaf. Unless otherwise specified, all % amino acid sequence identity values used herein are obtained using the ALIGN-2 computer program as described in the immediately preceding paragraph.
- the catalytic activity is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1
- the catalytic activity of the polypeptide is higher than the catalytic activity of the polypeptide under at least one reaction condition. Means higher than activity.
- the catalytic activity is higher than the catalytic activity of the polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 17” means that the catalytic activity is higher than the catalytic activity of the polypeptide under at least one reaction condition. do.
- the reaction conditions described in the Examples can be used to assess the catalytic activity of a polypeptide.
- the concentration of each compound at the start of the reaction is 50 mM in total for compound B and its salts, 100 mM in D(+)-glucose, 500 mM in total for compound A and its salts, and 500 mM in phosphate buffer.
- the concentration of the solution can be 100 mM
- the concentration of ⁇ -NADPH can be 0.89 mM
- the concentration of the GDH solution can be 0.002 units/ ⁇ L
- the concentration of the polypeptide to be evaluated can be 2.5 ⁇ M.
- the same reaction can be performed by adding a polypeptide to be evaluated for catalytic activity to a premix described later.
- the premix is compound B and / or a salt thereof, D (+)-glucose in an aqueous solution of compound A and / or a salt thereof adjusted to pH 7.5 to 8.5 with hydrochloric acid, and a mixed solvent of phosphate buffer Dissolve, adjust the pH to 8.0 using an aqueous sodium hydroxide solution, and dilute with ultrapure water. and GDH solution (dissolved in 1 ⁇ TNG) can be added and prepared.
- the evaluation of catalytic activity comprises phenylpyruvate, 2-oxo-3-(p-tolyl)propanoate, or 2-cyclopentyl-2-oxo-acetic acid at 50 mM, D(+)-glucose at 100 mM, 500 mM methylamine or ethylamine, 100 mM phosphate buffer, 0.89 mM ⁇ -NADPH, 0.002 unit/ ⁇ L GDH solution, 2.5 ⁇ M concentration of the polypeptide to be evaluated, and 37° C., pH 8 can be evaluated by determining the yield of the amino acid produced by the reductive amination reaction after starting the reaction under the conditions of 19 hours.
- the catalytic activity is calculated based on the amount of amino acids produced by the reductive amination reaction (hereinafter sometimes referred to as the "target product").
- the amount of the target product produced can be measured using a liquid chromatograph mass spectrometer (LCMS). Specifically, it can be measured under the conditions described in the examples below.
- LCMS liquid chromatograph mass spectrometer
- the catalytic activity of the polypeptide according to this embodiment is 1.2 times or more, 1.5 times or more, 2 times or more, 3 times or more that of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1, It may be 4 times or more, 5 times or more, 6 times or more, 7 times or more, or 8 times or more. How many times the catalytic activity of the polypeptide according to this embodiment is the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 can be determined by comparing both peptides at 19 hours after the start of the reaction. It can be obtained by calculating the yield ratio of the target product when used.
- reaction start point refers to compound A represented by formula (1) or a salt thereof and compound B represented by formula (2) or a salt thereof in the system, the enzyme disclosed herein, and the point at which the reducing agent is added, whichever is later.
- the yield at 19 hours after the start of the reaction is calculated by the method shown below.
- the reaction solution and a separately prepared calibration curve sample (compound having the same structure as the target product or a structure showing the same UV absorption wavelength) are subjected to LCMS analysis, and for each, a UV chart or extracted ions Get the chromatogram.
- the UV peak area or MS peak area derived from the target product is obtained from the UV chart or extracted ion chromatogram obtained from the reaction solution, respectively.
- the UV peak area or MS peak area of the standard is also obtained from the calibration curve sample.
- the concentration of the target product contained in the reaction solution is calculated as the UV peak area or MS peak Calculated from the area.
- the concentration of the desired product in the reaction solution is equal to the total concentration of compound B and its salt in the reaction solution at the start of the reaction. Conceivable.
- the yield is calculated by dividing the concentration of the target product actually contained in the reaction solution by the total concentration of compound B and its salt in the reaction solution at the start of the reaction.
- Compound A is a compound represented by the following formula (1).
- R 1 and R 2 each independently represent a hydrogen atom, an alkyl group, an alkenyl group, an alkynyl group, a cycloalkyl group, an aryl group, a heterocyclyl group, or a heteroaryl group, and these groups are , optionally substituted, and any one or more of R 1 or R 2 is a hydrogen atom.
- R 1 may be a hydrogen atom and R 2 may be a C 1 -C 6 alkyl group.
- Compound A may be an amine or amine analogue.
- Compound A may be an alkylamine in which one of R 1 and R 2 is an alkyl group and the other is a hydrogen atom in formula (1).
- the alkylamine or salt thereof may be one or more selected from the group consisting of methylamine, ethylamine and salts thereof.
- Compound A may be ammonia.
- Compound A may be one or more selected from the group consisting of ammonia, methylamine, ethylamine and salts thereof.
- Compound B is a compound represented by the following formula (2).
- X represents a carbon atom
- Y represents a hydrogen atom, the group represented by formula (1′) above, or the group represented by formula (3) above.
- Y represents a C 3 to C 8 cycloalkyl group or a C 6 to C 9 aralkyl group, and the aralkyl group is substituted with a C 1 to C 3 alkyl group or a halogen atom. good too.
- n represents an integer of 0 or more and 2 or less. n may be 0 or 1, and may be 0;
- R 6 is a hydrogen atom, an optionally substituted aliphatic hydrocarbon group having 1 to 6 carbon atoms, an optionally substituted aryl group having 5 to 12 carbon atoms, a substituted heteroaryl group having 5 or more and 12 or less atoms constituting a ring, a group containing a nitrogen atom, or a group containing an oxygen atom.
- Specific examples of the group represented by R6 are as described above.
- formula (1′) indicates the point of attachment to X.
- R 1a is a group obtained by removing a hydrogen atom from the group represented by R 1 in formula (1), and is not a hydrogen atom.
- m indicates an integer of 0 or more and 6 or less.
- the lower limit of m is 0 or more, and may be 1 or more, 2 or more, 3 or more, 4 or more, or 5 or more.
- the upper limit of m is 6 or less, and may be 5 or less, 4 or less, 3 or less, 2 or less, or 1 or less.
- p is 0 or 1;
- q is 0 or 1;
- r is 0 or 1;
- Z 1 represents an optionally substituted alkylene group or an ether bond-containing group having 1 to 6 carbon atoms. When m is 2 or more, multiple Z 1 may be the same or different.
- the "ether bond-containing group” include an alkyl group substituted with an alkoxy group, an allyloxy group, or the like. Specific examples of ether bond-containing groups having 1 to 6 carbon atoms include methoxymethyl group, ethoxymethyl group, allyloxymethyl group, allyloxyethyl group and allyloxypropyl group.
- Z2 represents a carbon atom.
- R 3 , R 4 and R 5 each independently represent a hydrogen atom, an aliphatic hydrocarbon group having 1 to 6 optionally substituted carbon atoms, or an optionally substituted carbon number of 5 or more.
- R 3 , R 4 and R 5 may combine with each other to form a ring together with Z 2 , and these ring structures may be cycloalkyl, aryl, heterocyclyl, or heteroaryl. , these groups may be substituted.
- R 3 , R 4 and R 5 may form a double bond or triple bond with Z 2 , and any one of R 3 , R 4 and R 5 may form a double bond or triple bond to Z When bound to 2 , any one or more of p, q or r is 0.
- R 3 to R 5 When any two of R 3 to R 5 are hydrogen atoms, the group other than the hydrogen atom is an optionally substituted aliphatic hydrocarbon group having 1 or more and 6 or less carbon atoms, or an optionally substituted An aryl group having 5 or more and 12 or less carbon atoms, or a heteroaryl group having 5 or more and 12 or less atoms constituting an optionally substituted ring, and the number of optionally substituted carbon atoms is It may be an aryl group of 5 or more and 12 or less, and may be a phenyl group or a p-tolyl group.
- R 1 may be a hydrogen atom and R 2 may be an ethyl group.
- R 1 may be a hydrogen atom and R 2 may be a methyl group.
- R 1 and R 2 may be hydrogen atoms.
- Compound B may be a ketoacid or ketoacid analogue.
- Compound B may be a compound represented by the following formula (2').
- Y′ represents a C 3 to C 8 cycloalkyl group or a C 6 to C 9 aralkyl group, and the aralkyl group may be substituted with a C 1 to C 3 alkyl group or a halogen atom. good.
- the compound represented by formula (2′) or a salt thereof is selected from the group consisting of phenylpyruvic acid, 2-oxo-3-(p-tolyl)propanoic acid, 2-cyclopentyl-2-oxo-acetic acid and salts thereof. There may be one or more selected.
- compound A and compound B is a compound A (ethylamine) in which R 1 is a hydrogen atom and R 2 is an ethyl group in formula (1), and a compound A (ethylamine) in formula (2) in which both n and m are 0, Y is a group represented by formula (3), R 3 is a phenyl group, R 4 , R 5 and R 6 are all hydrogen atoms, and p, q and r are all It may be a combination with compound B (phenylpyruvic acid) which is 1, and in formula (1), compound A (ethylamine) in which R 1 is a hydrogen atom and R 2 is an ethyl group, and formula (2) in which n and m are both 0, Y is a group represented by formula (3), R 3 is a p-tolyl group, and R 4 , R 5 and R 6 are all hydrogen atoms; and may be a combination with compound B (2-oxo-3-(p-tolyl)propa
- a combination of ethylamine as compound A and sodium phenylpyruvate as compound B can be used.
- H-EtPhe-OH synthesis activity is used as an index to evaluate the catalytic activity of the polypeptide. be able to.
- a combination in which compound A is ethylamine and compound B is 2-oxo-3-(p-tolyl)propanoic acid sodium salt can be used.
- H-EtPhe The catalytic activity of a polypeptide can be evaluated using the 4-Me)-OH synthesis activity as an index.
- a combination in which compound A is methylamine and compound B is 2-cyclopentyl-2-oxo-acetic acid can be used, in which case H-MeGly(cPent)-OH synthesis
- the catalytic activity of a polypeptide can be evaluated using the activity as an index.
- a polypeptide according to an embodiment of the present invention may be a polypeptide in which one or more amino acid residues in the amino acid sequence represented by SEQ ID NO: 1 are modified, and 1 to 20, 1 to 15, 1-10, 1-7 or 1-5 amino acid residues may be altered.
- the number of modified amino acid residues may be 3 or less, 2 or less, or 1.
- the number of modified amino acid residues in the amino acid sequence represented by SEQ ID NO: 1 is exemplified as 1 to 5, preferably 1, Two or more are more preferred, and two or three are most preferred.
- the modification may be one or more selected from the group consisting of substitution, deletion and insertion, and may be a substitution. Modifications may be conservative modifications. Conservative modification means modification of amino acid residues that does not reduce the desired catalytic activity compared to the polypeptide before modification.
- the modification may be a substitution with a natural amino acid different from the amino acid residue before modification.
- natural amino acids used for said substitution include glycine, alanine, serine, threonine, valine, leucine, isoleucine, phenylalanine, tyrosine, tryptophan, histidine, glutamine, asparagine, glutamic acid, aspartic acid, methionine, lysine, arginine, cysteine and It may be one or more selected from the group consisting of proline.
- the polypeptide according to one embodiment of the present invention is a histidine residue at position 44, a phenylalanine residue at position 117, a methionine residue at position 141, a threonine residue at position 156 in the amino acid sequence represented by SEQ ID NO: 1, 182-position histidine residue, 186-position glutamine residue, 253-position tryptophan residue, and 260-position lysine residue at a position corresponding to one or more amino acid residues selected from the group.
- It may be a polypeptide containing a sequence in which the groups are modified, and since the catalytic activity for reductive amination reaction is further improved, a methionine residue at position 141, a histidine residue at position 182, and a tryptophan residue at position 253 and one or more amino acid residues selected from the group consisting of a lysine residue at position 260 and a sequence in which the amino acid residue located at a site corresponding to the lysine residue at position 141 is modified. methionine residue, tryptophan residue at position 253, and lysine residue at position 260. It may be a peptide.
- a polypeptide according to one embodiment of the present invention is a sequence in which an amino acid residue located at a position corresponding to histidine residue at position 44 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an amino acid residue other than histidine.
- the polypeptide may be a polypeptide comprising the amino acid sequence represented by SEQ ID NO:2.
- Amino acid residues represented by X in SEQ ID NO: 2 are alanine residues, aspartic acid residues, glutamic acid residues, phenylalanine residues, glycine residues, isoleucine residues, lysine residues, leucine residues, and methionine residues.
- an asparagine residue an asparagine residue, a proline residue, a glutamine residue, an arginine residue, a serine residue, a threonine residue, a valine residue, a tryptophan residue or a tyrosine residue.
- the catalytic activity for the reductive amination reaction may contain a sequence in which the amino acid residue located at the site corresponding to the histidine residue at position 44 is substituted with a methionine residue. That is, the polypeptide according to this embodiment has an amino acid sequence (H44M) in which the amino acid residue located at the position corresponding to the histidine residue at position 44 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with a methionine residue. may contain.
- the catalytic activity for the reductive amination reaction between ethylamine and 2-oxo-3-(p-tolyl)propanoic acid is further improved.
- the amino acid residue located at the site corresponding to the phenylalanine residue at position 117 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an amino acid residue other than the phenylalanine residue.
- the polypeptide may be a polypeptide comprising the amino acid sequence represented by SEQ ID NO:4.
- Amino acid residues represented by X in SEQ ID NO: 4 are alanine residues, aspartic acid residues, glutamic acid residues, glycine residues, histidine residues, isoleucine residues, lysine residues, leucine residues, and methionine residues.
- an asparagine residue an asparagine residue, a proline residue, a glutamine residue, an arginine residue, a serine residue, a threonine residue, a valine residue, a tryptophan residue or a tyrosine residue.
- the catalytic activity for the reductive amination reaction may contain a sequence in which the amino acid residue located at the site corresponding to the phenylalanine residue at position 117 is substituted with a leucine residue. That is, the polypeptide according to this embodiment has an amino acid sequence (F117L) in which the amino acid residue located at the site corresponding to the phenylalanine residue at position 117 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with a leucine residue. may contain.
- the catalytic activity for the reductive amination reaction between methylamine and 2-cyclopentyl-2-oxo-acetic acid is further improved.
- the amino acid residue located at the site corresponding to the methionine residue at position 141 in the amino acid sequence represented by SEQ ID NO: 1 is replaced with an amino acid residue other than methionine. It may be a polypeptide comprising the sequence.
- the polypeptide may be a polypeptide comprising the amino acid sequence represented by SEQ ID NO:6.
- Amino acid residues represented by X in SEQ ID NO: 6 are alanine residues, aspartic acid residues, glutamic acid residues, phenylalanine residues, glycine residues, histidine residues, isoleucine residues, lysine residues, and leucine residues.
- an asparagine residue an asparagine residue, a proline residue, a glutamine residue, an arginine residue, a serine residue, a threonine residue, a valine residue, a tryptophan residue or a tyrosine residue.
- the amino acid residue located at the site corresponding to the methionine residue at position 141 is tyrosine residue, tryptophan residue, valine residue, threonine residue,
- a sequence substituted with one or more amino acid residues selected from the group consisting of serine residues, arginine residues, leucine residues, lysine residues, isoleucine residues, histidine residues, phenylalanine residues and alanine residues may contain.
- the amino acid residue located at the site corresponding to the methionine residue at position 141 in the amino acid sequence represented by SEQ ID NO: 1 is a tyrosine residue, a tryptophan residue, a valine residue, Amino acid sequences substituted with threonine residues, serine residues, arginine residues, leucine residues, lysine residues, isoleucine residues, histidine residues, phenylalanine residues, or alanine residues (M141Y, M141W, M141V, M141T, M141S, M141R, M141L, M141K, M141I, M141H, M141F, M141A).
- amino acid residue located at the site corresponding to the methionine residue at position 141 is the group consisting of tyrosine residue, tryptophan residue, valine residue, lysine residue, isoleucine residue, phenylalanine residue and alanine residue. It may contain a sequence substituted with one or more amino acid residues selected from.
- the amino acid residue located at the site corresponding to the methionine residue at position 141 in the amino acid sequence represented by SEQ ID NO: 1 is a tyrosine residue, a tryptophan residue, a valine residue, It may contain an amino acid sequence (M141Y, M141W, M141V, M141K, M141I, M141H, M141F, M141A) substituted with a lysine residue, an isoleucine residue, a histidine residue, a phenylalanine residue, or an alanine residue.
- the amino acid residue located at the site corresponding to the methionine residue at position 141 in the amino acid sequence represented by SEQ ID NO: 1 was substituted with an alanine residue, a lysine residue, a valine residue, a tryptophan residue, or a tyrosine residue.
- the reductive amination reaction between methylamine and 2-cyclopentyl-2-oxo-acetic acid, and the reductive amination reaction between ethylamine and phenylpyruvate, ethylamine and 2-oxo-3 The catalytic activity for the reductive amination reaction with -(p-tolyl)propanoic acid is further improved.
- a polypeptide comprising an amino acid sequence in which the amino acid residue located at the position corresponding to the methionine residue at position 141 in the amino acid sequence represented by SEQ ID NO: 1 is replaced with an arginine residue, a leucine residue, or a serine residue, Catalytic activity for the reductive amination reaction between methylamine and 2-cyclopentyl-2-oxo-acetic acid and for the reductive amination reaction between ethylamine and phenylpyruvic acid is further improved.
- Ethylamine and phenylpyruvine in a polypeptide comprising an amino acid sequence in which the amino acid residue located at the position corresponding to the methionine residue at position 141 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an isoleucine residue or a threonine residue
- Catalytic activity for reductive amination reaction with acid and reductive amination reaction between ethylamine and 2-oxo-3-(p-tolyl)propanoic acid is further improved.
- a polypeptide according to one embodiment of the present invention is a sequence in which an amino acid residue located at a position corresponding to the threonine residue at position 156 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an amino acid residue other than threonine.
- the polypeptide may be a polypeptide comprising the amino acid sequence represented by SEQ ID NO:7.
- Amino acid residues represented by X in SEQ ID NO: 7 are alanine residues, aspartic acid residues, glutamic acid residues, phenylalanine residues, glycine residues, histidine residues, isoleucine residues, lysine residues, and leucine residues.
- an asparagine residue an asparagine residue, a proline residue, a glutamine residue, an arginine residue, a serine residue, a threonine residue, a valine residue, a tryptophan residue or a tyrosine residue.
- the catalytic activity for reductive amination reaction may contain a sequence in which the amino acid residue located at the site corresponding to the threonine residue at position 156 is replaced with a serine residue. That is, the polypeptide according to this embodiment has an amino acid sequence (T156S) in which the amino acid residue located at the site corresponding to the threonine residue at position 156 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with a serine residue. may contain.
- T156S amino acid sequence in which the amino acid residue located at the site corresponding to the threonine residue at position 156 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with a serine residue.
- the catalytic activity for the reductive amination reaction between ethylamine and 2-oxo-3-(p-tolyl)propanoic acid is further improved.
- a polypeptide according to one embodiment of the present invention is a sequence in which an amino acid residue located at a position corresponding to histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an amino acid residue other than histidine.
- the polypeptide may be a polypeptide comprising the amino acid sequence represented by SEQ ID NO:8.
- Amino acid residues represented by X in SEQ ID NO: 8 are alanine residues, aspartic acid residues, glutamic acid residues, phenylalanine residues, glycine residues, isoleucine residues, lysine residues, leucine residues, and methionine residues.
- an asparagine residue an asparagine residue, a proline residue, a glutamine residue, an arginine residue, a serine residue, a threonine residue, a valine residue, a tryptophan residue or a tyrosine residue.
- the amino acid residue located at the site corresponding to the histidine residue at position 182 is a tyrosine residue, a glutamine residue, a methionine residue, a leucine residue, It may contain a sequence substituted with one or more amino acid residues selected from the group consisting of glycine residues, phenylalanine residues and alanine residues. That is, in the polypeptide according to this embodiment, the amino acid residue located at the position corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1 is a tyrosine residue, a glutamine residue, a methionine residue.
- a leucine residue, a glycine residue, a phenylalanine residue, or an amino acid sequence substituted with an alanine residue H182Y, H182Q, H182M, H182L, H182G, H182F, H182A.
- the amino acid residue located at the position corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1 is a methionine residue, a leucine residue, or a phenylalanine residue. It may contain amino acid sequences (H182M, H182L, H182F) substituted for groups.
- amino acid residue located at the position corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1 was substituted with an alanine residue, a phenylalanine residue, a leucine residue, a methionine residue, or a tyrosine residue.
- a polypeptide containing an amino acid sequence has improved catalytic activity for the reductive amination reaction between ethylamine and phenylpyruvic acid and the reductive amination reaction between ethylamine and 2-oxo-3-(p-tolyl)propanoic acid. .
- the amino acid residue located at the site corresponding to the glutamine residue at position 186 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an amino acid residue other than a glutamine residue.
- Amino acid residues represented by X in SEQ ID NO: 10 are alanine residues, aspartic acid residues, glutamic acid residues, phenylalanine residues, glycine residues, histidine residues, isoleucine residues, lysine residues, and leucine residues.
- a methionine residue an asparagine residue, a proline residue, an arginine residue, a serine residue, a threonine residue, a valine residue, a tryptophan residue, or a tyrosine residue.
- the amino acid residue located at the site corresponding to the glutamine residue at position 186 in the amino acid sequence represented by SEQ ID NO: 1 is a methionine residue and a glutamic acid residue. It may contain a sequence substituted with one or more amino acid residues selected from the group consisting of groups. That is, in the polypeptide according to this embodiment, the amino acid residue located at the site corresponding to the glutamine residue at position 186 in the amino acid sequence represented by SEQ ID NO: 1 is replaced with a methionine residue or a glutamic acid residue. It may contain the sequences (Q186M, Q186E).
- polypeptide containing an amino acid sequence in which the amino acid residue located at the site corresponding to the glutamine residue at position 186 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with a glutamic acid residue ethylamine and 2-oxo-3- Catalytic activity for the reductive amination reaction with (p-tolyl)propanoic acid and the reductive amination reaction between ethylamine and phenylpyruvic acid is further improved.
- an amino acid residue located at a site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an amino acid residue other than a tryptophan residue.
- Amino acid residues represented by X in SEQ ID NO: 11 are alanine residues, aspartic acid residues, glutamic acid residues, phenylalanine residues, glycine residues, histidine residues, isoleucine residues, lysine residues, and leucine residues.
- a methionine residue an asparagine residue, a proline residue, a glutamine residue, an arginine residue, a serine residue, a threonine residue, a valine residue, or a tyrosine residue.
- the amino acid residue located at the site corresponding to the tryptophan residue at position 253 is a tyrosine residue, a valine residue, a threonine residue, a serine residue,
- the amino acid residue located at the site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 is a tyrosine residue, a valine residue, a threonine residue.
- the substituted amino acid sequence (W253Y, W253V, W253T, W253S, W253R, W253Q, W253P, W253N, W253M, W253L, W253K, W253I, W253H, W253F, W253A) may be included.
- a sequence in which the amino acid residue located at the site corresponding to the tryptophan residue at position 253 is replaced with one or more amino acid residues selected from the group consisting of leucine residues, isoleucine residues and histidine residues It may contain, preferably containing sequences substituted by histidine residues. That is, in the polypeptide according to this embodiment, the amino acid residue located at the site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 is a leucine residue, an isoleucine residue, or a histidine residue. may contain an amino acid sequence (W253L, W253I, W253H) substituted for , and preferably contains an amino acid sequence (W253H) substituted for a histidine residue.
- the amino acid residue located at the site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 is an alanine residue, a phenylalanine residue, an isoleucine residue, a leucine residue, a methionine residue, and a proline residue.
- a reductive amination reaction of methylamine with 2-cyclopentyl-2-oxo-acetic acid and , the catalytic activity for the reductive amination reaction between ethylamine and phenylpyruvic acid is further improved.
- a polypeptide comprising an amino acid sequence in which the amino acid residue located at the position corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with a lysine residue, an arginine residue, or a serine residue , the catalytic activity for the reductive amination reaction between methylamine and 2-cyclopentyl-2-oxo-acetic acid is further improved.
- Reduction of ethylamine and phenylpyruvic acid in a polypeptide containing an amino acid sequence in which an amino acid residue located at a site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an asparagine residue Catalytic activity for selective amination reaction is further improved.
- the amino acid residue located at the position corresponding to the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with an amino acid residue other than the lysine residue.
- Amino acid residues represented by X in SEQ ID NO: 12 are alanine residues, aspartic acid residues, glutamic acid residues, phenylalanine residues, glycine residues, histidine residues, isoleucine residues, leucine residues, and methionine residues.
- an asparagine residue an asparagine residue, a proline residue, a glutamine residue, an arginine residue, a serine residue, a threonine residue, a valine residue, a tryptophan residue or a tyrosine residue.
- the amino acid residue located at the site corresponding to the lysine residue at position 260 is a tyrosine residue, a tryptophan residue, a threonine residue, a serine residue, one or more amino acids selected from the group consisting of arginine residues, glutamine residues, asparagine residues, methionine residues, leucine residues, histidine residues, glycine residues, phenylalanine residues, glutamic acid residues and alanine residues It may contain sequences that are substituted by residues.
- the amino acid residue located at the site corresponding to the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 is a tyrosine residue, a tryptophan residue, a threonine residue.
- amino acid residue located at the site corresponding to the lysine residue at position 260 is substituted with one or more amino acid residues selected from the group consisting of glutamine residue, methionine residue, glutamic acid residue and asparagine residue.
- the amino acid residue located at the site corresponding to the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 is a glutamine residue, a methionine residue, a glutamic acid residue.
- it may have an amino acid sequence (K260Q, K260M, K260E, K260N) substituted with an asparagine residue.
- polypeptide containing an amino acid sequence in which the amino acid residue located at the position corresponding to the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 is substituted with a glutamic acid residue or a serine residue methylamine and 2 - reductive amination reaction with cyclopentyl-2-oxo-acetic acid, reductive amination reaction with ethylamine and phenylpyruvic acid, and reductive amino reaction with ethylamine and 2-oxo-3-(p-tolyl)propanoic acid.
- the catalytic activity for the chemical reaction is further improved.
- the amino acid residue located at the site corresponding to the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 is a phenylalanine residue, a leucine residue, a methionine residue, a glutamine residue, a threonine residue, or a tyrosine residue.
- the reductive amination reaction between ethylamine and phenylpyruvic acid and the reductive amination reaction between ethylamine and 2-oxo-3-(p-tolyl)propanoic acid Catalytic activity is further improved.
- amino acid residue located at the position corresponding to the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 is an alanine residue, a glycine residue, a histidine residue, an asparagine residue, an arginine residue, or tryptophan.
- Polypeptides containing amino acid sequences with substituted residues have improved catalytic activity for the reductive amination reaction between ethylamine and phenylpyruvate.
- the polypeptide according to this embodiment is represented by SEQ ID NO: 6, amino acid sequence a1 (mutation: M141V) in which the amino acid residue represented by X is a valine residue, represented by SEQ ID NO: 6, represented by X Amino acid sequence a2 (mutation: M141Y) in which the amino acid residue is a tyrosine residue, amino acid sequence a3 (mutation: H182L) in which the amino acid residue represented by X is a leucine residue represented by SEQ ID NO: 8, sequence Amino acid sequence a4 (mutation: W253H) represented by number 11, in which the amino acid residue represented by X is a histidine residue, or represented by SEQ ID NO: 12, in which the amino acid residue represented by X is a glutamic acid residue It can contain an amino acid sequence a5 (mutation: K260E).
- a polypeptide according to this embodiment can contain a sequence having 90% or more sequence identity with the amino acid sequence a1, a2, a3, a4 or a5.
- the sequence identity may be 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more, and at 100% It's okay.
- the polypeptide according to this embodiment may be a polypeptide comprising a sequence in which one or more amino acid residues in the amino acid sequence a1, a2, a3, a4 or a5 are modified, and 1 to 20, 1 to 15 1, 1-10, 1-7 or 1-5 amino acid residues may be modified.
- the number of modified amino acid residues may be 3 or less, 2 or less, or 1.
- the amino acid sequence represented by SEQ ID NO: 1 may have two or more alteration sites, or may have two alteration sites. Preferred embodiments of the polypeptide having two or more modified sites will be described below.
- the polypeptide corresponds to one amino acid residue selected from the group consisting of a methionine residue at position 141, a histidine residue at position 182, and a tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1.
- the amino acid residue located at the site is modified as the first modification site, and the histidine residue at position 182, the tryptophan residue at position 253 and the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1
- a sequence in which an amino acid residue located at a site corresponding to one amino acid residue that is selected from the group and is different from the amino acid residue modified as the first modification site is modified as the second modification site preferably included.
- the polypeptide has the amino acid sequence represented by SEQ ID NO: 1, A sequence in which the amino acid residues located at positions corresponding to the methionine residue at position 141 and the histidine residue at position 182 are modified, A sequence in which the amino acid residues located at positions corresponding to the methionine residue at position 141 and the tryptophan residue at position 253 are modified, A sequence in which the amino acid residues located at positions corresponding to the methionine residue at position 141 and the lysine residue at position 260 are modified, A sequence in which the amino acid residues located at positions corresponding to the histidine residue at position 182 and the tryptophan residue at position 253 are modified, A sequence in which the amino acid residues located at the positions corresponding to the histidine residue at position 182 and the lysine residue at position 260 are modified, or at the positions corresponding to the tryptophan residue at position 253 and the lysine residue at position 260 sequences with altered amino acid residues; preferably containing In the amino
- the polypeptide has a tyrosine residue, tryptophan residue, valine residue, threonine residue, arginine It preferably contains a sequence substituted with one amino acid residue selected from the group consisting of lysine, isoleucine, and alanine residues, consisting of tyrosine, valine and alanine residues. More preferably, it contains a sequence substituted with one amino acid residue selected from the group.
- the polypeptide comprises a tyrosine residue, a methionine residue, a leucine residue, and a phenylalanine residue at the position corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1. It preferably contains a sequence substituted with one amino acid residue selected from the group consisting of, more preferably contains a sequence substituted with one amino acid residue selected from the group consisting of methionine residues and leucine residues .
- the polypeptide has a tyrosine residue, a threonine residue, a serine residue, an asparagine residue, and a methionine residue at a site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: It preferably contains a sequence substituted with one amino acid residue selected from the group consisting of a residue, a histidine residue and an alanine residue, and more preferably contains a sequence substituted with a histidine residue.
- the polypeptide has a serine residue, a glutamine residue, an asparagine residue, a leucine residue, and an isoleucine residue located at a position corresponding to the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1.
- a sequence substituted by one amino acid residue selected from the group consisting of residues, histidine residues, glycine residues, phenylalanine residues, glutamic acid residues and alanine residues, and glutamine residues and glutamic acid residues More preferably, it contains a sequence substituted with one amino acid residue selected from the group consisting of:
- amino acid residue X 1 at position m 1 an amino acid residue located at a site corresponding to amino acid residue X 1 at position m 1 is replaced with an amino acid residue x 1 other than X 1
- amino acid residue x 1 other than X 1 The sequence in which the amino acid residue located at the site corresponding to the amino acid residue X2 at the m2 position is replaced with an amino acid residue x2 other than X2 is designated as X1m1x1_X2m2x2 . write.
- amino acid residues located at positions corresponding to amino acid residues at positions 141 and 182 are substituted with other amino acid residues X, so M141X_H182X is written as Specifically, represented by SEQ ID NO: 23, X located at the site corresponding to the amino acid residue at position 141 is a tyrosine residue, and X located at the site corresponding to the amino acid residue at position 182 is a methionine residue.
- the underlying amino acid sequence is designated M141Y_H182M.
- the amino acid sequences represented by SEQ ID NOS: 24-30 are also represented in the same way.
- sequence in which two amino acid residues in the amino acid sequence represented by SEQ ID NO: 1 are modified may be, for example, an amino acid sequence selected from the group consisting of groups a1 to group a4 consisting of the amino acid sequences shown below, It is preferably an amino acid sequence selected from the group consisting of groups a1 to group a3, more preferably an amino acid sequence selected from the group consisting of group a1 and group a2, and an amino acid sequence selected from group a1. Most preferably there is.
- Group a1 M141Y_K260E, H182L_K260Q, M141A_K260E, H182M_K260Q, M141A_K260Q, H182M_K260E, M141V_K260E, W253H_K260E, and H182L_K260E.
- Group a2 M141V_K260Q, W253H_K260Q, W253M_K260E, M141Y_H182M, M141Y_K260Q, H182F_K260Q, M141V_K260F, M141V_H182L, M141V_K260L, M141Y_K260G, H 182L_W253H, H182F_K260E, and M141T_K260Q Group a3: M141Y_H182L, W253M_K260Q, M141V_W253M, M141V_K260S, M141V_K260A, M141A_K260F, M141A_K260H, W253A_K260E, M141V_W253A, M141V_W253H, M 141K_K260L, M141V_K260G, and M141A_K260L.
- Group a4 M141W_K260A, M141V_W253Y, M141K_K260G, M141A_K260G, M141A_K260S, M141A_K260N, M141Y_W253H, M141A_K260A, M141K_K260S, W253A_K260Q, M 141V_H182M, M141A_K260I, M141T_K260G, W253M_K260L, M141I_W253A, W253T_K260L, M141R_K260G, W253A_K260L, M141K_W253S, M141A_H182L, W253 N_K260L, M141K_K260A, M141K_W253M, H182Y_W253A, H182M_W253H, M141R_K260A, H182M_W253A and M141K_W253A.
- the polypeptide may comprise, for example, a sequence having 90% or more sequence identity with an amino acid sequence selected from the group consisting of groups a1 to a4, and selected from the group consisting of groups a1 to a3 It preferably contains a sequence having 90% or more sequence identity with the amino acid sequence, and more preferably contains a sequence having 90% or more sequence identity with the amino acid sequence selected from the group consisting of group a1 and group a2. Most preferably, it comprises a sequence having 90% or more sequence identity with an amino acid sequence selected from group a1.
- the polypeptide may contain an amino acid sequence selected from the group consisting of groups a1 to group a4, preferably contains an amino acid sequence selected from the group consisting of groups a1 to group a3, and group a1 and group a2. More preferably, it contains an amino acid sequence selected from the group consisting of, and most preferably contains an amino acid sequence selected from group a1.
- the amino acid sequence represented by SEQ ID NO: 1 may have 3 or more alteration sites, or may have 3 alteration sites. Preferred embodiments of the polypeptide having three or more modified sites will be described below.
- the polypeptide has an amino acid residue located at a site corresponding to one amino acid residue selected from the group consisting of a methionine residue at position 141 and a histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1. is modified as the first modification, One different amino acid residue selected from the group consisting of a histidine residue at position 182 and a tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1, and modified as the first modification site The amino acid residue located at the site corresponding to the amino acid residue is modified as the second modification site, Amino acid residues selected from the group consisting of a tryptophan residue at position 253 and a lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1 and modified as the first modification site and the second modification site It is preferable to include a sequence in which an amino acid residue located at a site corresponding to one amino acid residue different from the group is modified as the third modification site.
- the polypeptide has the amino acid sequence represented by SEQ ID NO: 1, A sequence in which amino acid residues located at positions corresponding to methionine residue at position 141, histidine residue at position 182 and tryptophan residue at position 253 are modified, A sequence in which the amino acid residues located at positions corresponding to the methionine residue at position 141, the histidine residue at position 182 and the lysine residue at position 260 are modified, A sequence in which amino acid residues located at positions corresponding to methionine residue at position 141, tryptophan residue at position 253 and lysine residue at position 260 are modified, A sequence in which the amino acid residues located at positions corresponding to histidine residue at position 182, tryptophan residue at position 253 and lysine residue at position 260 are modified, preferably containing In the amino acid sequence represented by SEQ ID NO: 1, A sequence in which the amino acid residues located at positions corresponding to the methionine residue at position 141, the histidine residue at position 182
- the polypeptide has three modified sites in the amino acid sequence represented by SEQ ID NO: 1, and an amino acid located at a site corresponding to the methionine residue at position 141 in the amino acid sequence represented by SEQ ID NO: 1.
- the residue is replaced with one amino acid residue selected from the group consisting of tyrosine, valine, threonine, serine, leucine, lysine, isoleucine, and alanine residues
- the polypeptide has three modified sites in the amino acid sequence represented by SEQ ID NO: 1, and an amino acid located at a site corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1. It preferably contains a sequence in which a residue is substituted with one amino acid residue selected from the group consisting of a methionine residue, a leucine residue and a phenylalanine residue, and the amino acid sequence represented by SEQ ID NO: 1 has three modified sites.
- amino acid residue located at the position corresponding to the histidine residue at position 182 in the amino acid sequence represented by SEQ ID NO: 1 is selected from the group consisting of a methionine residue and a leucine residue It is more preferred to include sequences that are substituted by residues.
- the polypeptide has three modified sites in the amino acid sequence represented by SEQ ID NO: 1, and an amino acid located at a site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1.
- the residue is substituted with one amino acid residue selected from the group consisting of valine residue, threonine residue, serine residue, glutamine residue, methionine residue, leucine residue, histidine residue, phenylalanine residue and glutamic acid
- It preferably contains a sequence that has three modified sites in the amino acid sequence represented by SEQ ID NO: 1, and at the site corresponding to the tryptophan residue at position 253 in the amino acid sequence represented by SEQ ID NO: 1
- the polypeptide has three modified sites in the amino acid sequence represented by SEQ ID NO: 1, and an amino acid located at a site corresponding to the lysine residue at position 260 in the amino acid sequence represented by SEQ ID NO: 1. It preferably comprises a sequence in which residues are replaced by one amino acid residue selected from the group consisting of glutamine and glutamic acid residues.
- the amino acid residue located at the site corresponding to the amino acid residue X1 at the m1 position is replaced with an amino acid residue x1 other than X1
- m2 The amino acid residue located at the site corresponding to amino acid residue X2 at position m is replaced by another amino acid residue x2 other than X2
- the site corresponding to amino acid residue X3 at position m3 X 1 m 1 x 1 _X 2 m 2 x 2 _X 3 m 3 x 3 represents a sequence in which the corresponding amino acid residue is replaced by another amino acid residue x 3 other than X 3 .
- amino acid residues at positions corresponding to amino acid residues at positions 141, 253 and 260 are substituted with other amino acid residues X.
- X located at the site corresponding to the amino acid residue at position 141 is a valine residue
- X located at the site corresponding to the amino acid residue at position 253 is a methionine residue
- X located at the position corresponding to amino acid residue 260 is a glutamic acid residue is denoted as M141V_W253M_K260E.
- the amino acid sequences represented by SEQ ID NOs: 32-35 are also represented in the same way.
- the sequence in which three amino acid residues in the amino acid sequence represented by SEQ ID NO: 1 are modified may be an amino acid sequence selected from the group consisting of groups b1 to b4 consisting of the amino acid sequences shown below, It is preferably an amino acid sequence selected from the group consisting of groups b1 to b3, more preferably an amino acid sequence selected from the group consisting of groups b1 and b2, and an amino acid sequence selected from group b1. Most preferably there is.
- Group b1 M141Y_H182M_K260E, M141V_W253M_K260E, H182L_W253H_K260E, M141Y_H182M_K260Q, M141V_H182M_K260E, M141V_H182L_K260Q, M141Y_H182L_K 260Q, M141V_W253Q_K260E, H182L_W253Q_K260E, M141I_W253H_K260E, M141V_H182L_K260E, M141Y_H182L_K260E, H182L_W253M_K260E, M141V_W253 Q_K260Q, M141V_W253H_K260Q, M141V_W253L_K260Q, M141I_W253H_K260Q, and M141V_W253M_K260Q.
- H182M_W253H_K260E H182M_W253H_K260E, M141V_W253V_K260Q, H182L_W253H_K260Q, M141V_W253H_K260E, H182L_W253Q_K260Q, M141L_W253H_K260E, H182M_W253Q_K 260E, M141V_W253F_K260Q, M141V_W253L_K260E, M141V_W253T_K260Q, M141Y_H182F_K260E, H182M_W253M_K260E, H182L_W253M_K260Q, M141Y_W253 H_K260E, M141Y_W253Q_K260E, M141V_H182M_K260Q, H182M_W253L_K260E, H182F_W253H_K260
- Group b3 H182L_W253T_K260Q, M141Y_W253S_K260E, M141V_H182F_K260E, M141A_H182M_K260E, M141T_H182L_K260Q, M141Y_W253T_K260E, H182M_W253L_K 260Q, M141V_H182F_K260Q, M141S_W253H_K260E, M141T_W253H_K260E, H182M_W253H_K260Q, M141A_H182L_K260Q, H182M_W253F_K260Q, M141A_H182 M_K260Q, M141A_W253Q_K260E, M141A_H182L_K260E, M141A_W253Q_K260E, M141A_H182L_K260E, M141A_W253H_K260
- the polypeptide may comprise, for example, a sequence having 90% or more sequence identity with an amino acid sequence selected from the group consisting of groups b1 to b4, and is selected from the group consisting of groups b1 to b3. It preferably contains a sequence having 90% or more sequence identity with the amino acid sequence, and more preferably contains a sequence having 90% or more sequence identity with the amino acid sequence selected from the group consisting of group b1 and group b2. Most preferably, it comprises a sequence having 90% or more sequence identity with an amino acid sequence selected from group b1.
- the polypeptide may contain an amino acid sequence selected from the group consisting of groups b1 to b4, preferably contains an amino acid sequence selected from the group consisting of groups b1 to b3, and groups b1 and b2. It more preferably comprises an amino acid sequence selected from the group consisting of and most preferably comprises an amino acid sequence selected from group b1.
- the polypeptide according to this embodiment includes any one or more of compound A represented by the above formula (1) or a salt thereof and any one or more of compound B represented by the above formula (2). or a salt thereof, or catalytic activity for an intramolecular reductive amination reaction of any one or more of the compounds B or a salt thereof under at least one reaction condition, SEQ ID NO: 1 higher than said catalytic activity of a polypeptide having the indicated amino acid sequence.
- the polypeptide according to this embodiment has a catalytic activity higher than that of the polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 17 under at least one reaction condition.
- the polypeptide according to this embodiment has a catalytic activity against a reductive amination reaction between ethylamine or a salt thereof and phenylpyruvic acid or a salt thereof under at least one reaction condition, represented by SEQ ID NO: 17. higher than a polypeptide consisting of the amino acid sequence
- the polypeptide according to the present embodiment has catalytic activity for a reductive amination reaction between ethylamine or a salt thereof and 2-oxo-3-(p-tolyl)propanoic acid or a salt thereof having at least one It is higher than the polypeptide consisting of the amino acid sequence represented by SEQ ID NO: 17 under reaction conditions.
- the polypeptide according to this embodiment has catalytic activity for a reductive amination reaction between methylamine or a salt thereof and 2-cyclopentyl-2-oxo-acetic acid or a salt thereof under at least one reaction condition is higher than the polypeptide consisting of the amino acid sequence represented by SEQ ID NO:17.
- the polypeptide according to this embodiment has catalytic activity for the reductive amination reaction between ammonia or its salt and phenylpyruvic acid or its salt under at least one reaction condition.
- polypeptide according to this embodiment may be fused with other polypeptides or proteins. That is, the polypeptide according to this embodiment has a sequence in which one amino acid residue in the amino acid sequence represented by SEQ ID NO: 1 is modified at either or both of the N-terminus and C-terminus, and 90% or more of the sequence It may have an amino acid sequence (another amino acid sequence) other than the sequence with identity. Said other amino acid sequence may be, for example, a tag sequence.
- Polypeptides or proteins having other amino acid sequences include, for example, a His tag (6XHis, 10XHis, etc.), which is a tag consisting of several (eg, 6, 10, etc.) His (histidine) residues, and streptavidin.
- streptavidin-binding peptide tag SBP tag
- GST Glutathione S-transferase
- HA influenza agglutinin
- immunoglobulin constant region B-galactosidase
- MBP maltose binding protein
- FLAG Hopp, TP et al., BioTechnology (1988) 6, 1204-1210), human c-myc fragment, VSV-GP fragment, p18HIV fragment, T7-tag , HSV-tag, E-tag, SV40 T antigen fragment, Ick tag, ⁇ -tubulin fragment, B-tag, Protein C fragment, Stag, StrepTag, HaloTag and the like.
- the His-tag may be, for example, the amino acid sequence represented by SEQ ID NO:14.
- the SBP tag may be, for example, the amino acid sequence represented by SEQ ID NO:15.
- the polypeptide according to this embodiment may contain one or more selected from the group consisting of a streptavidin-binding peptide tag sequence and a His tag sequence at either or both of the N-terminus and C-terminus, and A streptavidin binding peptide tag sequence and a His tag sequence may be included.
- the linker sequence may have, for example, an amino acid sequence designated GGSS or GGS.
- An example of an amino acid sequence containing a streptavidin-binding peptide tag sequence, a linker sequence and a His tag sequence is the amino acid sequence represented by SEQ ID NO:16.
- the polypeptide according to this embodiment can have the above amino acid sequence a1, a2, a3, a4 or a5 and a tag sequence.
- the polypeptide according to this embodiment links the amino acid sequence a1, a2, a3, a4 or a5 and the tag sequence, and also the amino acid sequence a1, a2, a3, a4 or a5 and the tag sequence. It may have a linker sequence.
- a polypeptide according to one embodiment is The amino acid sequence a1 (mutation: M141V) represented by SEQ ID NO: 6, in which the amino acid residue represented by X is a valine residue, and the amino acid sequence represented by SEQ ID NO: 16 linked to the C-terminus of the amino acid sequence a1.
- amino acid sequence represented by SEQ ID NO: 19 having The amino acid sequence a3 (mutation: H182L) represented by SEQ ID NO: 8, in which the amino acid residue represented by X is a leucine residue, and the amino acid sequence represented by SEQ ID NO: 16 linked to the C-terminus of the amino acid sequence a3.
- amino acid sequence represented by SEQ ID NO: 20 having The amino acid sequence a4 represented by SEQ ID NO: 11, in which the amino acid residue represented by X is a histidine residue (mutation: W253H), and the amino acid sequence represented by SEQ ID NO: 16 linked to the C-terminus of the amino acid sequence a4.
- One or more amino acid residues in the amino acid sequences represented by SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, or SEQ ID NO: 22 may be modified, 1 to 20, 1 to 15 , 1-10, 1-7 or 1-5 amino acid residues may be modified.
- the number of modified amino acid residues may be 3 or less, and 2 or less. Well, it can be one.
- a polypeptide according to one embodiment preferably has an amino acid sequence represented by any of SEQ ID NOS: 36-44.
- a polypeptide according to one embodiment preferably has an amino acid sequence represented by any of SEQ ID NOS: 45-62.
- the polypeptide according to this embodiment may be used as a mixture with other polypeptides, or may be used in an isolated/purified state.
- the target amino acid can be obtained through the process of isolating and producing the target product.
- the number of amino acid residues may be 300 or more, 310 or more, 320 or more, or 325 or more, and may be 330.
- the number of amino acid residues when the polypeptide according to this embodiment exists as a monomer may be 400 or less, 390 or less, 380 or less, or 375 or less.
- the number of amino acid residues of the polypeptide according to this embodiment is 300 or more, 310 or more, 320 or more, or 325 or more. There may be, and it may be 330. Further, when the other amino acid sequence is not added to either the N-terminus or the C-terminus, the number of amino acid residues of the polypeptide according to this embodiment is 360 or less, 350 or less, 340 or less, or 335 or less. It's okay.
- the number of amino acid residues of the polypeptide according to this embodiment is 340 or more, 350 or more, 360 or more, or It may be 370 or more, and may be 374. Further, when the other amino acid sequence is added to either one or both of the N-terminus and C-terminus, the number of amino acid residues of the polypeptide according to this embodiment is 400 or less, 390 or less, 380 or less, or It may be 375 or less.
- polypeptide according to the present embodiment may be used as a monomer, or may be used in a form in which two or more monomers are associated with each other. Furthermore, the polypeptide according to this embodiment may be a homodimer.
- the number of amino acid residues is double that when it exists as a monomer.
- the catalytic activity under at least one reaction condition is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO:1.
- the temperature at which the catalytic activity is higher than that of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 is in the range of 0°C or higher and 50°C or lower.
- the polypeptide according to the present embodiment can be any one or more of compound A or a salt thereof and any one or more of compound B or a salt thereof at at least one point under reaction conditions of 0 ° C. or higher and 50 ° C. or lower. It may have catalytic activity for a reductive amination reaction or an intramolecular reductive amination reaction of any one or more of the compounds B or salts thereof.
- the lower limit of the temperature may be 0° C. or higher, 10° C. or higher, 20° C. or higher, or 30° C. or higher.
- the upper limit of the reaction temperature may be 50° C. or lower, 40° C. or lower, or 30° C. or lower.
- the reaction temperature may be, for example, 0° C.
- the temperature may be 25°C or 37°C.
- the reaction temperature may be changed stepwise or continuously.
- the polypeptide according to this embodiment has a pH in the range of 7 or more and 11 or less, at which the catalytic activity is higher than that of the polypeptide having the amino acid sequence represented by SEQ ID NO:1.
- the polypeptide according to this embodiment may have catalytic activity at least at one point under reaction conditions of pH 7 or higher and 11 or lower.
- the lower limit of the pH may be 7 or higher, 7.5 or higher, 8 or higher, or 8.5 or higher.
- the upper pH limit may be 11 or less, 10 or less, 9.5 or less, or 9 or less.
- the pH may be, for example, pH 7 or more and 11 or less, 8 or more and 10 or less, or 8.5 or more and 9.5 or less.
- the pH may be 8 or 9.
- the pH referred to herein is the pH at the start of the reaction, and it is permissible for the pH to fluctuate during the reaction.
- the pH variation during the reaction may be within 2, may be within 1.5, may be within 1.
- the total concentration of the compound A and a salt thereof at the start of the reaction in the total amount of the reaction solution when performing the reductive amination reaction is at least in the range of 100 mM or more and 3000 mM or less.
- the catalytic activity is higher than that of the polypeptide having the amino acid sequence represented by SEQ ID NO:1.
- the polypeptide according to this embodiment has catalytic activity higher than that of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under reaction conditions of 37° C. and pH 8.
- the polypeptide according to this embodiment has catalytic activity higher than that of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 under reaction conditions of 25°C and pH 9.
- the polypeptide according to this embodiment may have catalytic activity under reaction conditions where the total concentration of compound A and its salt is 100 mM or more and 3000 mM or less.
- the lower limit of the total concentration of compound A and its salt may be 100 mM or higher, 300 mM or higher, 500 mM or higher, 700 mM or higher, 900 mM or higher, 1100 mM or higher, 1300 mM or higher, 1500 mM or higher, or 1700 mM or higher.
- the upper limit of the total concentration of Compound A and its salt may be 3000 mM or less, 2500 mM or less, or 2000 mM or less.
- the total concentration of Compound A and its salts may be 100 mM to 3000 mM, or 500 mM to 2000 mM. Also, in one aspect, the total concentration of Compound A and its salt may be 500 mM, and may be 1750 mM.
- the total concentration of the compound A and its salt is the total concentration of the compound A and its salt at the start of the reaction in the total amount of the reaction solution when performing the reductive amination reaction.
- the total concentration of the compound B and a salt thereof at the start of the reaction is in the range of 0.001 mM or more and 1000 mM or less in the total amount of the reaction solution when performing the reductive amination reaction.
- the catalytic activity is higher than that of the polypeptide having the amino acid sequence represented by SEQ ID NO:1.
- the polypeptide according to this embodiment may have catalytic activity under reaction conditions where the total concentration of compound B and its salt is 10 mM or more and 500 mM or less.
- the lower limit of the total concentration of compound B and its salt may be 10 mM or higher, 30 mM or higher, 50 mM or higher, 100 mM or higher, 150 mM or higher, 200 mM or higher, 250 mM or higher, 300 mM or higher, or 330 mM or higher.
- the upper limit of the combined concentration of Compound B and its salts may be 500 mM or less, 450 mM or less, 400 mM or less, or 380 mM or less.
- the total concentration of Compound B and its salts may be 10 mM to 500 mM, or 300 mM to 400 mM. In one aspect, the total concentration of Compound B and its salt can be 50 mM, and can be 350 mM.
- the total concentration of the compound B and its salt is the total concentration of the compound B and its salt at the start of the reaction in the total amount of the reaction solution when performing the reductive amination reaction.
- the polypeptide according to this embodiment is the compound A and its salt relative to the total number of moles of the compound B and its salt at the start of the reaction in the total amount of the reaction solution when performing the reductive amination reaction. is higher than the catalytic activity of the polypeptide having the amino acid sequence represented by SEQ ID NO: 1 at least at one point when the total molar ratio of is 1 or more.
- polypeptide according to this embodiment has a ratio of the total number of moles of compound A and its salt to the total number of moles of compound B and its salt (total number of moles of compound A and its salt / compound B and its total number of moles of salt) may have catalytic activity under the reaction conditions being greater than or equal to one.
- the ratio of the total number of moles of compound A and its salt to the total number of moles of compound B and its salt is 1 3 or more, 5 or more, 8 or more, or 9 or more; 50 or less, 30 or less, 20 or less, or 15 or less;
- the ratio of the total number of moles of compound A and its salt to the total number of moles of compound B and its salt is the total number of moles of compound B and its salt at the start of the reaction in the total amount of the reaction solution when performing the reductive amination reaction. It is the ratio of the total number of moles of compound A and its salt to the total number of moles.
- the polypeptide according to this embodiment can be used in a method for producing amino acids.
- the method for producing the amino acid comprises, in the presence of the above polypeptide and a reducing agent, one or more selected from the group consisting of amines, amine analogs and salts thereof, and a keto acid, keto acid analogs and salts thereof. or a step of intramolecularly reacting a compound selected from the group consisting of keto acids, keto acid analogues and salts thereof.
- the ketoacids and ketoacid analogues may have a primary amino group or a secondary amino group.
- the reaction in the method for producing an amino acid, can be carried out under appropriate conditions.
- the appropriate conditions are the temperature, pH, and total concentration of compound A and its salt in the reaction solution at the time of starting the reaction, compound B and compound B, and It refers to a condition in which the ratio of the total number of moles of compound A and its salt to the total number of moles of compound B and its salt, etc., is appropriately set.
- the reaction may be carried out in a reaction solution containing an amine or amine analogue, a ketoacid or ketoacid analogue, the above polypeptide, and a reducing agent.
- Compound A can be used as the amine or amine analog in one embodiment.
- the amine or amine analogue can be an alkylamine or ammonia, and the alkylamine can be a C 1 -C 6 alkylamine or a C 1 -C 4 alkylamine. More specifically, methylamine, ethylamine, propylamine, and ammonia are exemplified.
- compound B can be used as a ketoacid or ketoacid analogue.
- Y in formula (2) can be C 3 -C 8 cycloalkyl or C 6 -C 9 aralkyl. More specific examples include 2-cyclopentyl-2-oxo-acetic acid, phenylpyruvic acid, and 2-oxo-3-(p-tolyl)propanoic acid.
- the amine or amine analogue and the ketoacid or ketoacid analogue may be added to the reaction solution in the form of a salt.
- the substances used in the reaction may be mixed together or separately in any order.
- the salt can preferably be a chemically or pharmaceutically acceptable salt.
- Hydrobromide hydroiodide; phosphate; phosphonate; sulfate; sulfonate such as methanesulfonate, p-toluenesulfonate; Carboxylate such as acetate, citrate, malate, tartrate, succinate, salicylate; or alkali metal salt such as lithium salt, sodium salt, potassium salt; alkali such as magnesium salt, calcium salt earth metal salts; ammonium salts such as ammonium salts, alkylammonium salts, dialkylammonium salts, trialkylammonium salts and tetraalkylammonium salts;
- reducing agents include reduced nicotinamide adenine dinucleotide phosphate (NADPH), oxidized nicotinamide adenine dinucleotide phosphate (NADP+), reduced nicotinamide adenine dinucleotide (NADH) and oxidized nicotinamide adenine dinucleotide (NADH).
- NADPH reduced nicotinamide adenine dinucleotide phosphate
- NADP+ oxidized nicotinamide adenine dinucleotide phosphate
- NADH reduced nicotinamide adenine dinucleotide
- NADH oxidized nicotinamide adenine dinucleotide
- NADH oxidized nicotinamide adenine dinucleotide
- NADH oxidized nicotinamide adenine dinucleotide
- NADH oxidized nicot
- additives can be added together that reduce NADP+ and NAD+ to NADPH and NADH, respectively, such as glucose dehydrogenase (GDH) and glucose, respectively.
- GDH glucose dehydrogenase
- additives can be added together that reduce NADP+ and NAD+ to NADPH and NADH, respectively, such as glucose dehydrogenase (GDH) and glucose, respectively.
- GDH glucose dehydrogenase
- NADPH glucose dehydrogenase
- a reactant may be used. Examples of the reactant include a combination of glucose and GDH (glucose dehydrogenase).
- GDH glucose dehydrogenase
- the concentration of the reducing agent in the reaction solution at the start of the reaction may be, for example, 0.001 mM to 100 mM, or 0.01 to 10 mM.
- reaction conditions such as temperature, pH, and concentration of each compound may be the conditions described above.
- a reductive amination reaction may be performed in the presence of compound C represented by the following formula (4).
- v and w each independently represent 0 or 1
- one or more of v and w represent 1
- T represents a carbon atom, a phosphorus atom, or a sulfur atom.
- the following formula (4a) The functional group represented by represents ⁇ O, —ORd or a hydroxy group.
- the fact that the functional group represented by formula (4a) is —ORd means that T is bonded to ORd through a single bond. That is, the compound C, in which the functional group represented by formula (4a) is —ORd, has a structure represented by T—ORd.
- That the functional group represented by the formula (4a) is a hydroxy group means that T and the hydroxy group are directly bonded. That is, the compound C, in which the functional group represented by formula (4a) is —OH, has a structure represented by T—OH.
- Ra, Rb and Rc each independently represent a hydrogen atom, a C 1 to C 3 alkyl group, an alkylamino group or —CH 2 —ORd, and any two or more of Ra, Rb and Rc together with T They may be connected to each other to form a ring structure.
- Rd represents a C 1 -C 3 alkyl group.
- d, e and f each independently represent 0 or 1, and at least one of d, e and f represents 1;
- Ra, Rb and Rc are a methylamino group
- none of Ra, Rb and Rc are linked to form a ring structure together with T.
- the functional group represented by formula (4a) is a hydroxy group and T is a carbon atom
- v is 1
- w is 0, d, e and f are all 1
- Ra, Rb and Rc are both hydrogen atoms.
- Compound C may be a compound represented by the following formula (4-1), wherein T in formula (1) is a carbon atom.
- the compound represented by formula (4-1) may be a compound represented by the following formula (4-1a) in which v is 1 and w is 0.
- the compound represented by formula (4-1b) may be a compound in which one of Ra and Rb is a hydrogen atom or a C 1 -C 3 alkyl group and the other is an alkylamino group.
- the alkylamino group may be a monomethylamino group or a dimethylamino group.
- the compound represented by formula (4-1b) can be N,N dimethylformamide, N,N-dimethylacetamide, or N-methylformamide.
- d, e and f are all 1 when the functional group represented by formula (4a) is a hydroxy group.
- the compound represented by formula (4-1a) is represented by formula (4-1c) below, wherein d, e and f are all 1. It may be a compound represented by
- Ra, Rb and Rc may each independently be a hydrogen atom or a C 1 -C 3 alkyl group.
- the compound represented by formula (4-1c) may be methanol in which Ra, Rb and Rc are all hydrogen atoms.
- Compound C may be a compound represented by the following formula (4-2), wherein T in formula (4) is a phosphorus atom.
- Ra, Rb and Rc may all be C 1 -C 3 alkyl groups.
- the compound represented by formula (4-2a) may be trimethylphosphine oxide in which Ra, Rb and Rc are all methyl groups.
- Compound C may be a compound represented by the following formula (4-3), wherein T in formula (4) is a sulfur atom.
- v is 1
- w is 1
- both d and e are 1.
- f is 0, and may be a compound represented by the following formula (4-3a).
- both Ra and Rb may be C 1 to C 3 alkyl groups, and Ra and Rb may be linked to each other to form a ring structure together with a sulfur atom (S). .
- Ra and Rb may each independently be a methyl group or an ethyl group.
- the compound represented by formula (4-3a) may be dimethylsulfoxide in which both Ra and Rb are methyl groups, or diethylsulfoxide in which both Ra and Rb are ethyl groups.
- the compound represented by formula (4-3a) is tetramethylene sulfoxide in which both Ra and Rb are C 1 to C 3 alkyl groups, and the alkyl groups are linked to each other to form a ring structure together with S. There may be.
- At least one of Ra and Rb is a methyl group.
- the compound represented by formula (4-3b) may be dimethylsulfone in which both Ra and Rb are methyl groups.
- compound C can produce amino acids in a higher yield, dimethyl sulfoxide, dimethyl sulfone, trimethylphosphine oxide, dimethoxyethane, N,N-dimethylformamide, N,N-dimethylacetamide, tetramethylene sulfoxide, diethyl sulfoxide, methanol and It may be one or more compounds selected from the group consisting of methylformamide.
- Compound C may be one or more selected from the group consisting of dimethyl sulfoxide, dimethyl sulfone and trimethylphosphine oxide, and may be dimethyl sulfoxide, since the amino acid can be produced with higher yield.
- Compound C may be liquid or solid under conditions of 25°C and 1 atm, and may be liquid under conditions of 25°C and 1 atm because the production efficiency of amino acids is further improved.
- Compound C, which is liquid at 25° C. and 1 atm, includes dimethylsulfoxide, dimethoxyethane, N,N-dimethylformamide, N,N-dimethylacetamide, methanol and N-methylformamide.
- the method for producing an amino acid may include the following steps (A) and (B).
- Step (A) a step of contacting a lithium-containing substance with the object to be purified, which is a mixture of the object to be purified (i) below and the impurity (ii) below, obtained by the above-described method; (i) the amino acid having a protecting group at the N-terminus; (ii) a compound other than the purification target;
- Another embodiment of the present invention is a method for removing impurities from an object to be purified, including the above steps (A) and (B).
- Still another embodiment of the present invention is an amino acid lithium salt or a solvate thereof, wherein the amino acid lithium salt is an amino acid lithium salt represented by the following general formula (5) with a purity of 99 mol% or an apparent purity of 99% or more, lithium of an amino acid or a solvate thereof.
- n5 represents a number of 1 or more and 3 or less, and when there are a plurality of R 5a , R 5a may be the same or different, and R 5a and R 5b are each two or more independently selected from the group consisting of a hydrogen atom, an alkyl group, an alkenyl group, an alkynyl group, a cycloalkyl group, an aryl group, a heterocyclyl group or a heteroaryl group, or these substituents represent a bonded group, These groups may have substituents, these groups may be saturated hydrocarbon groups or unsaturated hydrocarbon groups, A represents a carbon atom, and B represents a hydrogen atom or an amino acid or peptide compound.
- R 5a and R 5b may combine with N and A to form a ring, in which case R 5a and R 5b are hydrogen atoms from the structure of the substituent when not involved in ring formation is a substituent of a structure with one pulled out, and n5 is 2, at least one of R 5b and two R 5a is not a hydrogen atom.
- the object to be purified is used as a raw material for synthesis of peptide compounds, proteins, and the like.
- Obtaining high-purity peptide compounds and proteins is important for suppressing side effects caused by impurities when they are pharmaceuticals. That is, it is important to purify the raw materials that constitute them with high purity.
- a purification object can be purified to a high degree of purity by converting it into a lithium salt. The usefulness in peptide compound and protein synthesis has been further improved.
- Amino acid salts or solvates thereof, more preferably amino acid salts, and still more preferably amino acid lithium salts in the present invention are obtained by treating the substance to be purified through steps (A) and (B). be done.
- the object to be purified in the present specification is a mixture of the object to be purified and the impurities.
- the target product for purification as used herein refers to the aforementioned amino acid having a protecting group at the N-terminus. Examples of the target product for purification include amino acids represented by the general formula (5).
- impurity refers to a compound other than the object to be purified, which is contained in the object to be purified.
- the impurities include semi-specific impurities (amino acids other than the product to be purified, having a protecting group at the N-terminus). More specifically, ⁇ -alanine or its derivatives are exemplified.
- derivative refers to a compound in which a certain organic compound is considered as a base, and modifications such as introduction of functional groups, oxidation, reduction, and substitution of atoms are made to such an extent that the structure and properties of the base are not significantly changed.
- Specific impurities ⁇ -alanine having a protecting group at the N-terminus
- ⁇ -alanine derivatives are exemplified as ⁇ -alanine derivatives.
- the step (A) is a step of contacting the object to be purified with a lithium-containing substance.
- the step (A) may form a lithium salt of the purification target, and may form a lithium salt of the impurity.
- Step (B) is a step of precipitating the lithium salt of the purification target.
- part of the step (A) and part of the step (B) may overlap in terms of time.
- the object to be purified may be purified by a method other than the present invention. For example, it is possible to purify by precipitating the purification target in a free state without forming a lithium salt of the purification target.
- At least one of step (A) and step (B) can be carried out in the presence of a solvent, and the term "precipitation" as used herein refers to the generation of a solid from the solvent.
- the protecting group of the purification target may be a carbamate group.
- a carbamate group refers to a fluorenylmethoxycarbonyl group, a tert-butoxycarbonyl group, a benzyloxycarbonyl group, an allyloxycarbonyl group, a 2,2,2-trichloroethoxycarbonyl group or a 2-(trimethylsilyl)ethoxycarbonyl group; may be a nylmethoxycarbonyl group, a tert-butoxycarbonyl group or a benzyloxycarbonyl group; may be a fluorenylmethoxycarbonyl group or a benzyloxycarbonyl group; may be a fluorenylmethoxycarbonyl group; can be a base.
- the impurity-protecting group may be a carbamate group.
- a carbamate group refers to a fluorenylmethoxycarbonyl group, a tert-butoxycarbonyl group, a benzyloxycarbonyl group, an allyloxycarbonyl group, a 2,2,2-trichloroethoxycarbonyl group or a 2-(trimethylsilyl)ethoxycarbonyl group; may be a nylmethoxycarbonyl group, a tert-butoxycarbonyl group or a benzyloxycarbonyl group; may be a fluorenylmethoxycarbonyl group or a benzyloxycarbonyl group; may be a fluorenylmethoxycarbonyl group; can be a base.
- These protective groups may be protective groups that protect the N-terminus of impurities.
- the protecting group of the purification target and the protecting group of the impurity may be different or may be the same. It is preferable that the protecting group of the target product for purification and the protecting group of the impurity are the same.
- the step (A) may be performed in the presence of the first organic solvent.
- the first organic solvent is a solvent capable of dissolving the purification target substance from the viewpoint of efficiently advancing the contact between the purification target substance and the lithium-containing substance.
- the solubility of the purification target substance in the first organic solvent is preferably 20 g/L or more. It is preferable that the solubility of the lithium salt of the purification object in the first organic solvent is 20 g/L or less.
- the impurity has a solubility of 20 g/L or more in the first organic solvent.
- nitriles such as acetonitrile, methanol, ethanol, 1-propanol, 2-propanol, 1-butanol, 2-butanol, 2-methyl-2-propanol, alcohols such as ethylene glycol, tetrahydrofuran , 1,4-dioxane, 2-methyltetrahydrofuran, methyl tert-butyl ether, diisopropyl ether, diethyl ether, ethers such as 1,2-dimethoxyethane, ketones such as acetone, methyl ethyl ketone, methyl isobutyl ketone, dimethylformamide, dimethyl acetamide, amides such as N-methyl-2-pyrrolidone, ureas such as 1,3-dimethyl-2-imidazolidinone, sulfoxides such as dimethylsulfoxide, sulfones such as sulfolane, heptane
- alcohols such
- the step (A) may be performed in the presence of water.
- the step (B) may be performed in the presence of the second organic solvent.
- the second organic solvent is a solvent in which the lithium salt of the object to be purified has low solubility, that is, a solvent that functions as a poor solvent for the lithium salt of the object to be purified.
- the solubility of the lithium salt of the purification object in the second organic solvent is preferably 10 g/L or less.
- nitriles such as acetonitrile, methanol, ethanol, 1-propanol, 2-propanol, 1-butanol, 2-butanol, 2-methyl-2-propanol, alcohols such as ethylene glycol, tetrahydrofuran , 1,4-dioxane, 2-methyltetrahydrofuran, methyl tert-butyl ether, diisopropyl ether, diethyl ether, ethers such as 1,2-dimethoxyethane, ketones such as acetone, methyl ethyl ketone, methyl isobutyl ketone, dimethylformamide, dimethyl acetamide, amides such as N-methyl-2-pyrrolidone, ureas such as 1,3-dimethyl-2-imidazolidinone, sulfoxides such as dimethylsulfoxide, sulfones such as sulfolane, heptane
- alcohols such
- the step (B) may be performed in the presence of water, and is preferably performed in the presence of water from the viewpoint of dissolving the impurity lithium salt.
- the solubility of the impurity lithium salt in water is preferably 10 g/L or more.
- a second organic solvent may be used with the first organic solvent in step (A).
- step (B) the lithium salt of the purification target is deposited.
- the second organic solvent By adding the second organic solvent at the time of precipitation and increasing the ratio thereof, the precipitation of the lithium salt of the purification target can be promoted.
- the second organic solvent may be added to the first organic solvent used in step (A).
- the ratio of the first organic solvent or the ratio of the second organic solvent is the volume calculated by dividing the volume of the first organic solvent or the second organic solvent by the mass of the purification target product. /mass ratio (ml/g, hereinafter also referred to as v/w).
- step (A) when the solubility of the lithium salt of the purification target in the first organic solvent used in step (A) is sufficiently low, the first organic solvent and the second organic solvent are the same solvent. Also good. In this case, it is not necessary to add the second organic solvent in step (B). In this case, when the lithium-containing substance is brought into contact with the purification target in step (A), step (B) is immediately started, and the lithium salt of the purification target is precipitated.
- the lithium salt of the purification target is preferably deposited as a solid.
- the solids referred to here include crystals and amorphous. Further, it is more preferable to deposit (crystallize) as crystals.
- the step (B) can also be said to be a step of crystallizing the lithium salt of the purification target.
- the volume of the first organic solvent with respect to 1 g of the object to be purified may be 1 ml or more, 2 ml or more, or 3 ml or more, and may be 100 ml or less, 80 ml or less, or 60 ml or less throughout the steps (A) and (B). Or it may be 40 ml or less.
- the volume of the first organic solvent per 1 g of the object to be purified is 1 ml or more and 100 ml or less, 1 ml or more and 80 ml or less, 2 ml or more and 60 ml or less, or 3 ml or more and 40 ml or less throughout the steps (A) and (B). you can
- the volume of the first organic solvent (initial concentration of the first organic solvent) relative to 1 g of the material to be purified at the end of step (A) increases the proportion of the second organic solvent in step (B).
- it may be 1 ml or more, 2 ml or more, or 3 ml or more, and may be 50 ml or less, 40 ml or less, 30 ml or less, or 20 ml or less.
- the initial concentration of the first organic solvent may be 1 ml or more and 50 ml or less, 1 ml or more and 40 ml or less, 2 ml or more and 30 ml or less, or 3 ml or more and 20 ml or less.
- the volume of the first organic solvent (initial concentration of the first organic solvent) relative to 1 g of the material to be purified at the end of step (A) does not increase the proportion of the second organic solvent in step (B).
- 1 ml or more, 10 ml or more, 20 ml or more, or 30 ml or more, or 35 ml or more and may be 100 ml or less, 75 ml or less, or 50 ml or less, or 37 ml or less.
- the initial concentration of the first organic solvent may be 1 ml to 100 ml, 10 ml to 75 ml, 20 ml to 50 ml, 30 ml to 37 ml, or 35 ml to 37 ml.
- the volume of the second organic solvent per 1 g of the object to be purified may be 0 ml or more and may be 40 ml or less, 60 ml or less, 80 ml or less, or 100 ml or less throughout steps (A) and (B).
- the volume of the second organic solvent relative to 1 g of the object to be purified may be 0 ml or more and 100 ml or less, 0 ml or more and 80 ml or less, 1 ml or more and 60 ml or less, or 1 ml or more and 40 ml or less throughout steps (A) and (B).
- the volume of the second organic solvent relative to 1 g of the object to be purified at the end of step (B) may be 0 ml or more, and may be 40 ml or less, 60 ml or less, 80 ml or less, or 100 ml or less.
- the volume of the second organic solvent relative to 1 g of the object to be purified at the end of step (B) may be 0 ml or more and 100 ml or less, 0 ml or more and 80 ml or less, 0 ml or more and 60 ml or less, or 0 ml or more and 40 ml or less.
- the volume of the water with respect to 1 g of the object to be purified may be 0.1 ml or more, 0.3 ml or more, or 0.5 ml or more, and may be 50 ml or less, 30 ml or less, or 10 ml through steps (A) and (B). or less or 5 ml or less.
- the volume of water in the solvent throughout steps (A) and (B) is 0.1 ml to 50 ml, 0.1 ml to 30 ml, 0.3 ml to 10 ml, or 0.5 ml to 5 ml. good.
- the volume of the water (initial concentration of water) relative to 1 g of the purification target may be 0.1 ml or more, 0.3 ml or more, or 0.5 ml or more, 50 ml or less, or 30 ml. 10 ml or less, or 4 ml or less.
- the initial concentration of water may be between 0.1 ml and 50 ml, between 0.1 ml and 30 ml, between 0.3 ml and 10 ml, or between 0.5 ml and 4 ml.
- the volume of the water (initial concentration of water) relative to 1 g of the purification target may be 0.1 ml or more, 0.3 ml or more, or 0.5 ml or more, 50 ml or less, or 30 ml. 10 ml or less, or 4 ml or less.
- the initial concentration of water may be between 0.1 ml and 50 ml, between 0.1 ml and 30 ml, between 0.3 ml and 10 ml, or between 0.5 ml and 4 ml.
- Step (A) and step (B) may be performed in the presence of a solvent other than the first organic solvent and the second organic solvent.
- solvents include phosphate buffer, CHES (N-cyclohexyl-2-aminoethanesulfonic acid), Tris (trishydroxymethylaminomethane), bicine (N,N-di(2-hydroxyethyl)glycine), etc. is exemplified.
- the temperature at which step (A) is performed may be -20°C or higher, 0°C or higher, 10°C or higher, or 20°C or higher.
- the temperature at which step (A) is performed may be 100° C. or lower, 80° C. or lower, 60° C. or lower, 40° C. or lower, or 30° C. or lower.
- the temperature at which step (A) is performed may be ⁇ 20 to 100° C., may be 0 to 80° C., may be 10 to 60° C., may be 10 to 40° C., may be 20 to 30 °C.
- the temperature at which step (B) is performed may be ⁇ 20° C. or higher, 0° C. or higher, 10° C. or higher, 20° C. or higher, or 30° C. or higher. may be 35° C. or higher.
- the temperature at which step (B) is performed may be 100° C. or less, 80° C. or less, 60° C. or less, 40° C. or less, or 30° C. or less. .
- the temperature at which step (A) is performed may be ⁇ 20 to 100° C., may be 0 to 80° C., may be 10 to 60° C., may be 10 to 40° C., may be 20 to 30 °C.
- Conditions such as temperatures and concentrations of substances contained in various solutions in steps (A) and (B) may be the same or different. If these conditions are different between the two, conditions selected from the various conditions of step (A) described above may be combined. Further, the amount of the lithium-containing substance at the end of the step (A) is 0.5 equivalents or more, 0.8 equivalents or more, or 1.0 equivalents or more based on the amount of the substance to be purified. It may well be 2.0 equivalents or less, 1.5 equivalents or less, or 1.1 equivalents or less. The amount of the lithium-containing substance based on the amount of the substance to be purified is 0.5 equivalents or more and 2.0 equivalents or less, 0.8 equivalents or more and 1.5 equivalents or less, or 1.0 equivalents or more and 1.1 equivalents. may be:
- lithium-containing substance refers to a lithium-containing substance to be brought into contact with the purification target in step (A).
- Lithium-containing substances used in step (A) include, for example, lithium hydroxide, lithium tert-butoxide, lithium hydroxide, lithium carbonate, lithium hydride, trilithium phosphate, lithium methoxide, lithium ethoxide, lithium isopropoxy.
- lithium tert-butoxide methyllithium, n-butyllithium, sec-butyllithium, tert-butyllithium, lithium amide, lithium diisopropylamide, lithium hexamethyldisilazide, lithium tetramethylpiperidide At least one of the
- the method of contacting the object to be purified with the lithium-containing substance is not limited, but the object to be purified and the lithium-containing substance can be brought into contact in the presence of the first organic solvent.
- the object to be purified, the lithium-containing substance, and the first organic solvent may be mixed in the same container from the beginning.
- the containing substance may be added, or the lithium-containing substance and the first organic solvent may be mixed, and the substance to be purified may be added to the resulting mixed solution.
- the content of the substance to be purified in the substance to be purified which is the basis for determining the amounts of the first organic solvent, the second organic solvent, and the lithium-containing substance, may be a measured value, an estimated value, or a calculated value. It may be measured or calculated, and most preferably measured.
- the amino acid having a protective group at the N-terminus or the amino acid constituting the peptide compound having a protective group at the N-terminus, which is contained in the product to be purified includes the amino acid represented by the above general formula (5) (also referred to as amino acid (1) ), hydrophobic amino acids, aliphatic amino acids, aromatic amino acids, and the like.
- n5 represents a number of 1 or more and 3 or less, and may be an integer of 1 or more and 3 or less. n5 may be 1, 2 or 3. When n5 is 2, any one or more of R 5b and two R 5a are not hydrogen atoms, and two or more of R 5b and two R 5a are not hydrogen atoms. Well, three of R 5b and two R 5a may not be hydrogen atoms.
- R 5a and R 5b are a hydrogen atom, an alkyl group, an alkenyl group, an alkynyl group, a cycloalkyl group, an aryl group, a heterocyclyl group or a heteroaryl group, or a substituent in which two or more of these substituents are bonded. (for example, a benzyl group), these groups may have a substituent, and these groups may be saturated or unsaturated.
- A represents a carbon atom
- B represents a hydrogen atom or a binding point with an amino acid or peptide compound.
- Z5 represents a fluorenylmethoxycarbonyl group, tert-butoxycarbonyl group, benzyloxycarbonyl group, allyloxycarbonyl group, 2,2,2-trichloroethoxycarbonyl group or 2-(trimethylsilyl)ethoxycarbonyl group.
- R 5a and R 5b may combine with N and A to form a ring.
- R 5a and R 5b are substituents having a structure in which one hydrogen atom is removed from the structure of the substituent when it does not involve ring formation.
- the purification product may be precipitated so that the content of semi-specific impurities contained in the precipitate (purification product) obtained in the step (B) is reduced.
- the purified product may be precipitated so that the purity of the purified product is 95 mol % or higher.
- the purity is more preferably 96 mol% or more, further preferably 97 mol% or more, even more preferably 98 mol% or more, particularly preferably 99 mol% or more, and 100 Mole % is most preferred.
- the term "purity” as used herein broadly means the abundance ratio of the target substance contained in the substance whose purity is to be measured, and in a narrow sense, the purification target substance contained in the purification result. means the ratio of the material amount of the lithium salt of the purification target to the total material amount of the lithium salt of the specific impurity and the lithium salt of the specific impurity.
- the purification product may be precipitated so that the content of impurities in the purification product is 5 mol% or less.
- the impurity content is preferably 4 mol% or less, more preferably 3 mol% or less, even more preferably 2 mol% or less, particularly preferably 1 mol% or less, 0 mol % is most preferred.
- the term "impurity content” as used herein refers to the amount of the lithium salt of the specific impurity based on the total amount of the lithium salt of the purification target and the lithium salt of the specific impurity contained in the purification result. means
- Purity or impurity content can be measured, for example, by nuclear magnetic resonance equipment, gas chromatography, or high performance liquid chromatography. When using high performance liquid chromatography, it can be calculated from the area ratio of UV absorption peaks.
- Formula 1a below shows the formula for determining the purity
- Formula 2a below shows the formula for determining the impurity content.
- the amount of substance per unit UV absorption peak area is the value obtained by dividing the UV absorption peak area of the purification target or specific impurity by the amount of substance.
- the purified product may be precipitated so that the apparent purity of the purified product is 95% or more.
- the apparent purity is more preferably 96% or more, further preferably 97% or more, even more preferably 98% or more, particularly preferably 99% or more, and 100%. is most preferred.
- the term "apparent purity” as used herein refers to the sum of the UV absorption peak areas at specific wavelengths of both measured after the purification result is separated into the purification target and specific impurities by high-performance liquid chromatography. It means the ratio of the UV absorption peak area of the object at the specific wavelength.
- the purification result may be precipitated so that the apparent impurity content of the purification result is 5% or less.
- the apparent impurity content is preferably 4% or less, more preferably 3% or less, even more preferably 2% or less, particularly preferably 1% or less, and 0%. is most preferred.
- the term "apparent impurity content" as used herein refers to the sum of the UV absorption peak areas at specific wavelengths of the purified product and the specific impurities, which are measured after separating the purified product by high-performance liquid chromatography. , means the ratio of the UV absorption peak area at the specific impurity specific wavelength.
- the following formula 1b shows the formula for obtaining the apparent purity
- the following formula 2b shows the formula for obtaining the apparent impurity content.
- the specific wavelength in this specification is a wavelength within 10% of the maximum absorption wavelength exhibited by the protective group of the purification target.
- any maximum absorption wavelength may be selected as long as it is a maximum absorption wavelength that exhibits an absorption intensity of 30% or more based on the absorption intensity at the maximum absorption wavelength among them. .
- the influence of noise can be reduced by selecting the longer wavelength side from among a plurality of maximum absorption wavelengths.
- the sample concentration can be adjusted according to the absorption intensity of the selected maximum absorption wavelength. At the time of measurement, the maximum absorption wavelength that is thought to be most preferable from the viewpoints of easiness in adjusting the sample concentration and reduction of noise can be selected.
- UV light of 254 nm for Fmoc group, 197 nm for Boc group, and 210 nm for Cbz group can be used as UV light with a specific wavelength.
- the production method according to one embodiment by obtaining the lithium salt, it is possible to reduce the content of ⁇ -alanine or a derivative thereof in the object to be purified.
- the production method according to this embodiment may comprise a step of reducing the content of ⁇ -alanine or its derivative.
- the manufacturing method according to the present embodiment may further include a step of making a salt other than lithium salt.
- a free-form amino acid or a free-form peptide compound can be obtained by desalting the lithium salt obtained by the production method according to one embodiment. Desalting can be done by known methods.
- salts other than lithium salts can be produced from the resulting free amino acids or peptide compounds.
- Salts other than lithium salts include salts with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid and phosphoric acid; salts with organic acids such as benzoic acid, methanesulfonic acid, ethanesulfonic acid and p-toluenesulfonic acid; salts with alkali metals (sodium or potassium); salts with alkaline earth metals such as calcium and magnesium; ammonium salts etc. can be exemplified.
- inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid and phosphoric acid
- salts with organic acids such as benzoic acid, methanesulfonic acid, ethanesulfonic acid and p-toluenesulfonic acid
- salts with alkali metals (sodium or potassium) salts with alkaline earth metals such as calcium and magnesium
- ammonium salts etc. can be
- the polypeptide according to this embodiment can be used in a method for producing a peptide compound.
- the method for producing the peptide compound can include the following steps. (1) a step of producing an amino acid or an amino acid derivative by the method described above; and (2) a step of linking the amino acid with one or more selected from the group consisting of other amino acids and peptides.
- the step (2) is described in "SOLID PHASE PEPTIDE SYNTHESIS" (https://www.bachem.com/wpfd_file/solid-phase-peptide-synthesis/,2002363 published by Global Marketing, Bachem AG, December 2019). may be carried out under certain conditions.
- the reaction may be carried out in an aqueous medium or a mixture of an aqueous medium and an organic solvent.
- the aqueous medium may be water or a buffer.
- Buffers include phosphate buffer, CHES (N-cyclohexyl-2-aminoethanesulfonic acid), Tris (trishydroxymethylaminomethane), bicine (N,N-di(2-hydroxyethyl)glycine). be done.
- Examples of organic solvents include dimethylsulfoxide.
- a peptide compound obtained by the method for producing a peptide compound according to the present embodiment may be, for example, a peptide compound having a cyclic portion (cyclic peptide compound).
- the number of amino acid residues of the cyclic peptide compound according to this embodiment is 30 or less, 25 or less, 20 or less, 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or less, 7 or less. , 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- the cyclic peptide compound according to the present embodiment is 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 11 or more, 12 or more, 13 or more, 14 or more , or a peptide compound consisting of 15 or more amino acids.
- the number of amino acid residues of the cyclic peptide compound according to this embodiment may be 2 or more and 10 or less, 2 or more and 8 or less, 2 or more and 6 or less, or 2 or more and 4 or less.
- the number of amino acid residues of the cyclic peptide compound according to this embodiment may be 5 or more and 30 or less, 7 or more and 25 or less, 8 or more and 15 or less, 9 or more and 14 or less, 10 or more and 13 or less, or 11.
- the "cyclic portion" of a cyclic peptide compound means a cyclic portion formed by connecting two or more amino acid residues.
- the number of amino acid residues constituting the cyclic portion of the cyclic peptide compound is 5 to 14, 6 to 14, 7 to 14, 8 to 14, 9 to 14, 10 to 14, 5 to 13, 6 to 13, 7 to 13, 8 to 13, 9 to 13, 10 to 13, 5 to 12, 6 to 12, 7 to 12, 8 to 12, 9 to 12, 10 to 12, 5 to 11, 6 to 11, 7 to 11, 8 to 11, 9 to 11, 10 to 11, or 11.
- the cyclic portion is preferably formed via a covalent bond such as an amide bond, a carbon-carbon bond, an S—S bond, a thioether bond, or a triazole bond.
- Cyclization includes cyclization through carbon-nitrogen bonds such as amide bonds, cyclization through carbon-oxygen bonds such as ester bonds and ether bonds, cyclization through carbon-sulfur bonds such as thioether bonds, carbon-carbon bonds. It may be in any form, such as cyclization with , cyclization with a sulfur-sulfur bond, or cyclization with heterocyclic construction.
- cyclization via a covalent bond such as an amide bond and a carbon-carbon bond is preferred, and cyclization via an amide bond via a side chain carboxy group and a main chain amino group is more preferred.
- the position of the carboxy group, amino group, etc. used for cyclization may be on the main chain or on the side chain, and is not particularly limited as long as it is at a position that allows cyclization.
- the cyclic peptide compound according to this embodiment may have 15 or more and 46 or less ring atoms.
- the number of ring atoms means the number of atoms (ring atoms) of a cyclic compound including the innermost portion of the ring, and when the compound has multiple rings, the number of atoms is the largest. Defined as the number of such atoms in the majority ring. When two rings share some atoms, the ring atom number of each ring is calculated using the ring with the smaller number of shared atoms. To further explain the "number of ring atoms" with specific examples, for example, using this method, tetrahydrofuran (THF) has 5 ring atoms and tacrolimus (FK506) has 21 ring atoms.
- THF tetrahydrofuran
- FK506 tacrolimus
- the number of ring atoms of the cyclic peptide compound according to the present embodiment may be, for example, 34 or more and 46 or less, 34 or more and 43 or less, 34 or more and 40 or less, 34 or more and 37 or less, 34 or more and 36 or less, or 34.
- the ring atoms used for calculating the number of ring atoms may be selected from the group consisting of carbon atoms, hydrogen atoms, nitrogen atoms, oxygen atoms, sulfur atoms, phosphorus atoms, and silicon atoms. It may be selected from the group consisting of nitrogen atoms and oxygen atoms.
- the cyclic peptide compound according to this embodiment may have a linear portion in addition to the cyclic portion. Specific aspects of the number of amino acid residues in the cyclic peptide compound are the same as the specific aspects of the number of amino acid residues in the peptide compound described above. When the cyclic peptide compound has a linear portion, the total number of amino acid residues of the cyclic portion and the linear portion is preferably within the same range.
- the number of amino acid residues constituting the cyclic portion is 5 or more and 15 or less, 6 or more and 15 or less, 6 or more and 14 or less, 7 or more and 14 or less, 8 or more and 14 or less, 7 more preferably 13 or less, more preferably 7 or more and 12 or less, more preferably 8 or more and 11 or less, still more preferably 9 or more and 11 or less, particularly preferably 10 or 11, and the number of amino acid residues constituting the linear portion is 1 or more and 8 or less. , 1 or more and 7 or less, 1 or more and 6 or less, 1 or more and 5 or less, 1 or more and 4 or less, and more preferably 1 or more and 3 or less.
- the molecular weight of the cyclic peptide compound according to the present embodiment is not particularly limited. It may be 950 or more, preferably 1000 or more, 1100 or more, 1200 or more, 1300 or more, or 1400 or more. Although the upper limit of the molecular weight of the peptide compound according to this embodiment is not particularly limited, it is preferably 5000 or less, 4000 or less, 3000 or less, 2500 or less, and 2000 or less.
- Molecular weight in the present specification means the total atomic weight of atoms constituting a compound molecule (unit: "g/mol"), and is obtained by calculating the total atomic weight of atoms contained in the molecular structural formula (unit "g/mol"). Molecular weight units may be omitted in this specification.
- the molecular weight of the peptide compound can be measured by liquid chromatography-mass spectrometry (LC/MS) described in Examples.
- Cyclic peptide compounds according to this embodiment may contain one or more N-substituted amino acid residues, preferably at least 3 N-substituted amino acid residues, and at least 4 N-substituted amino acid residues. More preferably, it contains at least 5 N-substituted amino acid residues.
- the N-substituted amino acid residues may be present continuously or discontinuously in the N-substituted cyclic peptide compound.
- the DNA includes, for example, genomic DNA, cDNA, and DNA artificially produced based thereon.
- Genomic DNA contains exons and introns. That is, the genomic DNA may or may not contain introns, and may or may not contain untranslated regions (5'UTR and/or 3'UTR), transcriptional regulatory regions, and the like.
- a cDNA may also include a nucleic acid sequence that encodes an amino acid sequence that is derived from a portion of an intron sequence.
- the DNA also includes degenerate polynucleotides composed of any codons that encode the same amino acid.
- the DNA according to this embodiment may be DNA derived from a desired organism.
- the DNA according to this embodiment may be obtained by any method.
- complementary DNA (cDNA) prepared from mRNA
- DNA prepared from genomic DNA DNA obtained by chemical synthesis
- DNA obtained by amplifying RNA or DNA as a template by PCR and these methods are appropriately used. All DNAs constructed in combination are also included.
- the DNA according to this embodiment can be produced by cloning the DNA from genomic DNA or RNA encoding the above-described polypeptide, introducing mutations, and the like, according to conventional methods.
- any tissue or cell that expresses and produces the above-described polypeptide is cloned according to a routine method.
- An mRNA encoding the polypeptide is prepared. For example, by subjecting total RNA prepared using a method such as the guanidine thiocyanate method, the hot phenol method, or the AGPC (Acid Guanidium-Phenol-Chloroform) method to affinity chromatography using oligo(dT) cellulose, poly U-Sepharose, etc. It can be carried out.
- a known method such as using reverse transcriptase (Mil. Cell. Biol., Vol. 2, p. 161, 1982; Mol. Cell. Biol., Vol. 3, 280, 1983; Gene, Vol.25, p.263, 1983), converting the cDNA into double-stranded cDNA, and inserting this cDNA into a plasmid vector, phage vector, cosmid vector, or the like.
- a cDNA library is generated by integration, transformation of E. coli, or in vitro packaging followed by transfection into E. coli.
- a gene of interest can be obtained by screening using the prepared cDNA library and using the DNA according to this embodiment or a portion thereof as a probe.
- the DNA according to this embodiment or a portion thereof can be used as primers and directly amplified by PCR.
- the sites and lengths of probes and primers may be determined as appropriate.
- One embodiment of the present invention is a recombinant vector having the above DNA.
- the recombinant vector is not particularly limited as long as it can maintain replication or self-propagate in either prokaryotic and/or eukaryotic host, and includes plasmid vectors, phage vectors, virus vectors, and the like. be.
- cloning vectors examples include pUC19, ⁇ gt10, ⁇ gt11, and the like.
- a vector having a promoter capable of expressing the DNA according to this embodiment it is preferable to use a vector having a promoter capable of expressing the DNA according to this embodiment.
- Recombinant vectors are conveniently prepared by ligating DNA encoding the polypeptide according to the present embodiment to recombination vectors (plasmid DNA and bacteriophage DNA) available in the art by a conventional method. can be done.
- Examples of recombination vectors used include E. coli-derived plasmids (pBR322, pBR325, pUC12, pUC13, pUC19, etc.), yeast-derived plasmids (pSH19, pSH15, etc.), and Bacillus subtilis-derived plasmids (pUB110, pTP5, pC194, etc.). exemplified.
- phage examples include bacteriophage such as ⁇ phage, and animal and insect viruses such as retrovirus, vaccinia virus, nuclear polyhedrosis virus, and lentivirus (pVL1393, manufactured by Impitrogen).
- bacteriophage such as ⁇ phage
- animal and insect viruses such as retrovirus, vaccinia virus, nuclear polyhedrosis virus, and lentivirus (pVL1393, manufactured by Impitrogen).
- An expression vector is useful for the purpose of expressing the DNA encoding the polypeptide according to the present embodiment and producing the above-described polypeptide.
- the expression vector is not particularly limited as long as it has the function of expressing the DNA encoding the above-described polypeptide in either prokaryotic and/or eukaryotic host cells and producing these polypeptides.
- pMAL C2 pEF-BOS (Nucleic Acid Research, Vol. 18, 1990, p. 5322, etc.) or pME18S (Experimental Medicine Supplementary Volume "Genetic Engineering Handbook", 1992, etc.) can be mentioned.
- the recombinant vector preferably contains at least a promoter-operator region, an initiation codon, a DNA encoding the above polypeptide, a termination codon, a terminator region and a replicable unit. .
- the recombinant vector preferably contains at least a promoter, an initiation codon, DNA encoding the above-described polypeptide, and a termination codon.
- the recombinant vector contains a DNA encoding a signal peptide, an enhancer sequence, 5' and 3' untranslated regions of the gene encoding the above polypeptide, a splicing junction, a polyadenylation site, a selectable marker region, or a replicable region. Units and the like may be included.
- the recombinant vector may, if necessary, contain a marker gene (gene amplification gene, drug resistance gene, etc.) that enables selection of a host that has undergone gene amplification and transformation.
- a marker gene gene amplification gene, drug resistance gene, etc.
- Marker genes include, for example, dihydrofolate reductase (DHFR) gene, thymidine kinase gene, neomycin resistance gene, glutamate synthase gene, adenosine deaminase gene, ornithine decarboxylase gene, hygromycin-B-phosphotransferase gene, aspartate transcarbase gene.
- DHFR dihydrofolate reductase
- thymidine kinase gene thymidine kinase gene
- neomycin resistance gene glutamate synthase gene
- glutamate synthase gene adenosine deaminase gene
- ornithine decarboxylase gene hygromycin-B-phosphotransferase gene
- aspartate transcarbase gene aspartate transcarbase gene.
- a promoter-operator region for expressing the above polypeptide in bacteria can include a promoter, an operator and a Shine-Dalgarno (SD) sequence (eg, AAGG, etc.).
- SD Shine-Dalgarno
- promoters include Trp promoter, lac promoter, recA promoter, ⁇ PL promoter, lPP promoter, tac promoter and the like.
- Promoters for expressing the above polypeptides in yeast include PH05 promoter, PGK promoter, GAP promoter, and ADH promoter. When the host is Bacillus, SLO1 promoter, SP02 promoter, penP promoter and the like are included.
- promoters include SV40-derived promoters, retrovirus promoters, heat shock promoters, and the like. Preferred is SV40, a retrovirus. However, promoters are not particularly limited to these. The use of enhancers is also an effective method for expression.
- a suitable initiation codon is exemplified by methionine codon (ATG).
- methionine codon examples include common stop codons (eg, TAG-TGA, TM). Commonly used natural or synthetic terminators can be used as the terminator region.
- a replicable unit refers to a DNA capable of replicating its entire DNA sequence in a host cell, including natural plasmids, artificially modified plasmids (DNA fragments prepared from natural plasmids) and Synthetic plasmids and the like are included. Suitable plasmids include E. In E.
- coli the plasmid pBR322 or its artificial modification (DNA fragment obtained by treating pBR322 with an appropriate restriction enzyme), in yeast, the yeast 2 ⁇ plasmid or yeast chromosomal DNA, and in mammalian cells, the plasmid pRSVneo (ATCC 37198), plasmid pSV2dhfr (ATCC 37145), plasmid pdBPV-MMTneo (ATCC 37224), plasmid pSV2neo (ATCC 37149) and the like.
- yeast the yeast 2 ⁇ plasmid or yeast chromosomal DNA
- mammalian cells the plasmid pRSVneo (ATCC 37198), plasmid pSV2dhfr (ATCC 37145), plasmid pdBPV-MMTneo (ATCC 37224), plasmid pSV2neo (ATCC 37149) and the like.
- polyadenylation sites those commonly used by those skilled in the art, such as those derived from SV40, can be used.
- An expression vector can be prepared by continuously and circularly linking at least the aforementioned promoter, initiation codon, DNA encoding the aforementioned polypeptide, termination codon and terminator region to a suitable replicable unit.
- an appropriate DNA fragment eg, linker, other restriction enzyme cleavage site, etc.
- T4 DNA ligase can be used by conventional methods such as digestion with restriction enzymes and ligation using T4 DNA ligase.
- One embodiment of the present invention is a transformant having DNA encoding the above polypeptide.
- the transformant can be obtained as a transformed recombinant cell, for example, by introducing the expression vector described above into a host cell.
- the host cell is not particularly limited as long as it is compatible with the above expression vector and can be transformed.
- Examples include cells such as bacteria (genus Escherichia, Bacillus), yeast (genus Saccharomyces, genus Pichia, etc.), animal cells, insect cells, and the like.
- the host cells are preferably E. coli or animal cells.
- E. coli or animal cells include E. coli (DH5a, TB1, HB101, etc.), mouse-derived cells (Cop, L, C127, Sp2/0, NS-1, NIH3T3, etc.), rat-derived cells (PC12, PC12h), Hamster-derived cells (BHK, CHO, etc.), monkey-derived cells (COS1, COS3, COS7, CV1, Velo, etc.), human-derived cells (Hela, diploid fibroblast-derived cells, myeloma cells, HepG2, etc.), etc. are exemplified.
- Introduction of an expression vector into a host cell can be performed according to a conventional method ([E. coli, Bacillus subtilis, etc.]: Proc. Natl. Acad. Sci. USA., Vol. 69, p.2110, 1972; Mil.Gen.Genet., Vol.168, p.111, 1979; J. Mol.Biol., Vol.56, p.209, 1971; USA., Vol.75, p.1927, 1978; J. Bacteriol., Vol.153, p.163, 1983); 52, p. 456, 1973; [For insect cells]: Mol. Cell. Biol. , Vol. 3, p. 2156-2165, 1983).
- the polypeptide according to the present embodiment is produced, for example, by a method comprising culturing a recombinant cell, which is a transformant, according to a conventional method, and obtaining the desired polypeptide from the culture obtained by culturing. can do.
- isolation and purification methods include methods utilizing solubility such as salting out and solvent precipitation; methods utilizing differences in molecular weight such as dialysis, ultrafiltration, gel filtration, sodium dodecyl sulfate-polyacrylamide gel electrophoresis; Methods utilizing charge such as ion exchange chromatography and hydroxyl apatite chromatography, methods utilizing specific affinity such as affinity chromatography, methods utilizing differences in hydrophobicity such as reversed phase high performance liquid chromatography, isoelectric A method using a difference in isoelectric points such as point electrophoresis can be used.
- the culture is subjected to a conventional method such as filtration or centrifugation to collect the bacterial cells or cells, followed by After suspending in a buffer solution and disrupting cell walls and/or cell membranes of cells by, for example, methods such as ultrasonic waves, lysozyme, and freeze-thaw, fractions containing the polypeptide of interest are separated by methods such as centrifugation and filtration. obtain. The fraction is solubilized using a detergent such as Triton TM -X100 to obtain a crude solution. Then, the target polypeptide can be isolated and purified from the crude solution by using a conventional method as exemplified above.
- a detergent such as Triton TM -X100
- the polypeptide according to this embodiment can be produced using known genetic recombination techniques as described above, and can generally be prepared as follows. First, using a plasmid containing a wild-type polypeptide gene as a template, site-specific mutations are introduced at specific positions and specific amino acids by PCR using the primers. Transform and clone the desired mutagenesis plasmid.
- the prepared DNA is transformed into the Escherichia coli BL21 strain, etc. at the same time as the plasmid pREP4, etc. encoding the lac repressor (Laci). After isolating and culturing the resulting transformant, expression is induced with IPTG. The resulting strain is then disrupted, and the supernatant is passed through an affinity column using a His tag to purify the target polypeptide.
- the desired polypeptide is purified by affinity column using protein expression and various purification tags.
- the method for producing the polypeptide according to the present embodiment is not limited to the above-described methods, and various genetic manipulations such as known point mutation technology, gene synthesis technology, and a method of introducing a modified fragment using a restriction enzyme.
- the technology can be used and expression is not limited to E. coli, animal cells and cell-free translation systems can also be used.
- the purification method is not limited to the affinity column using polyhistidine, and various peptide tags and purification columns can be used.
- Comparative Example 1 Expression and purification of wild-type enzyme A gene was synthesized by adding a Streptavidin-binding peptide tag sequence (GTDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQ) and a His tag sequence (HHHHHH) to the C-terminus of the wild-type enzyme sequence (SEQ ID NO: 1). , was cloned into an E. coli expression vector. This expression vector was introduced into BL21(DE3) Escherichia coli strain (Novagen) and cultured at 18° C. for 2 days using Overnight Express Instant TB Medium (Novagen) to express the target protein.
- GTDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQ a His tag sequence
- the obtained cells were collected by centrifugation and sonicated.
- the lysate was fractionated by centrifugation, and the supernatant fraction was purified by affinity chromatography using Ni Sepharose 6 Fast Flow (Cytiva). Fractions containing the target protein were collected and used as the final preparation (#02-001 (SEQ ID NO: 17)).
- Example 1 Expression and Purification of Modified Enzymes Streptavidin-binding peptide tag sequence (GTDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQ), linker sequence (GGS), and His tag at C-terminus for various modified enzyme sequences (SEQ ID NOS: 2-13 and 23-35)
- GTDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQ linker sequence
- His tag at C-terminus for various modified enzyme sequences
- SEQ ID NOS: 2-13 and 23-35 A gene with the added sequence (HHHHHH) was synthesized and cloned into an E. coli expression vector. This expression vector was introduced into BL21(DE3) Escherichia coli strain (Novagen) and cultured at 18° C. for 2 days using Overnight Express Instant TB Medium (Novagen) to express the target protein.
- the obtained cells were collected by centrifugation and sonicated.
- the lysate was fractionated by centrifugation, and the supernatant fraction was purified by affinity chromatography using Ni Sepharose 6 Fast Flow (Cytiva). Fractions containing the target protein were collected and used as final preparations (#02-002-217, #03-001-130 and #04-001-0072).
- Example 2 Expression and Purification of Modified Enzyme
- the supernatant fraction was purified by affinity chromatography using cOmplete TM His-Tag Purification Resin (Roche) instead of Ni Sepharose 6 Fast Flow (Cytiva), and the purpose Same as Example 1, except that after collecting the protein-containing fraction, the sample was dialyzed against 50 mM Tris-HCl (pH 8.0)/150 mM sodium chloride/10% glycerol to obtain the final preparation. method (#02-169).
- Evaluation Example 1 Example of Modified Enzyme Screening Using H-MeGly(cPent)-OH Synthesis Activity as an Indicator
- premix 1 A substrate-containing solution (hereinafter referred to as premix 1) was prepared for the experiment using OH synthesis activity as an index. Specifically, two compounds, 2-cyclopentyl-2-oxo-acetic acid (purchased from Enamine Ltd.) and D(+)-glucose (purchased from Fujifilm Wako Pure Chemical Industries, Ltd.), were added to an aqueous solution of methylamine (Fujifilm Wako An aqueous solution purchased from Kojunyaku Co., Ltd.
- the concentration of each compound at the time of premix 1 is 55.6 mM for 2-cyclopentyl-2-oxo-acetic acid, 111 mM for D (+)-glucose, 556 mM for methylamine, 111 mM for phosphate buffer, ⁇ -NADPH is 0.99 mM, and GDH solution is 0.0022 unit/ ⁇ L.
- any one of #02-001 to 217 was added to the prepared premix 1 to carry out the H-MeGly(cPent)-OH synthesis reaction. Specifically, any one solution of #02-001 to #02-217 was added to Premix 1, respectively.
- an imidazole-containing buffer 250 mM imidazole, 50 mM HEPES (pH 7.5), 150 mM sodium chloride was added. This was mixed well and incubated at 37°C for 19 hours.
- the concentration of each compound at the start of the reaction was 50 mM for 2-cyclopentyl-2-oxo-acetic acid, 100 mM for D(+)-glucose, 500 mM for methylamine, 100 mM for phosphate buffer, and 0 for ⁇ -NADPH. 0.89 mM, 0.002 unit/ ⁇ L of GDH solution, and 2.5 ⁇ M of any one of #02-001-217.
- reaction solution after incubation was post-processed to prepare samples for LCMS analysis. Specifically, hydrochloric acid was added in an amount 9 times the amount of the reaction solution so that the final concentration after the addition of hydrogen chloride was 30 mM (this solution is hereinafter referred to as post-treated reaction solution 1).
- a dilution series of H-MeGly(cPent)-OH synthesized in Synthesis Example 1 for the purpose of quantifying the concentration of H-MeGly(cPent)-OH dissolved in the post-treated reaction solution 1 by LCMS. was made. Specifically, after dissolving H-MeGly(cPent)-OH in a 1M sodium hydroxide aqueous solution to 1000 mM, the solution was repeatedly diluted twice with ultrapure water.
- ⁇ -NADPH aqueous solution 1 ⁇ TNG, imidazole-containing buffer, and dilution series were added to Premix 2 and mixed well.
- concentration of each compound at this point was 25 mM for 2-cyclopentyl-2-oxo-acetic acid, 75 mM for D(+)-glucose, 475 mM for methylamine, 100 mM for phosphate buffer, and 0 for ⁇ -NADPH.
- 89 mM, and 1 ⁇ TNG and imidazole-containing buffers are each 10% by volume.
- sample 1 a calibration curve sample for LCMS analysis
- diluent solutions simulating the composition of various compounds dissolved in the post-treated reaction solution 1 were prepared. Specifically, premix 2, 1xTNG, an imidazole-containing buffer solution, a ⁇ -NADPH aqueous solution, and hydrochloric acid were mixed and diluted with ultrapure water.
- the concentrations of ⁇ -NADPH and hydrogen chloride after volume up are 0.089 mM and 30 mM, respectively, and the final volume ratios of premix 2, 1xTNG, and imidazole-containing buffer are 6%, 1%, and 1%, respectively. .
- a post-treated reaction solution 2 was obtained by diluting the post-treated reaction solution 1 32-fold using this dilution solution.
- Post-treated reaction solution 1, post-treated reaction solution 2, and post-treated calibration curve sample 1 were all passed through a 0.2 ⁇ m PVDF membrane filter (purchased from Corning, Inc.) and subjected to LCMS measurement.
- the liquid volume used for the measurement is 1 ⁇ L.
- Evaluation Example 2 Implementation of Modified Enzyme Screening Using H-EtPhe-OH Synthesis Activity as Index (Single Mutant Screening)
- a solution containing a substrate hereinafter referred to as premix 3
- premix 3 a solution containing a substrate
- two compounds of phenylpyruvate sodium salt purchased from Sigma-Aldrich Japan G.K.
- D(+)-glucose are added to an ethylamine aqueous solution (purchased from Tokyo Kasei Co., Ltd.
- the aqueous solution is adjusted to pH 7.7 with hydrochloric acid.
- premix 3 The concentration of each compound at the time of premix 3 was 55.6 mM for phenylpyruvate sodium salt, 111 mM for D(+)-glucose, 556 mM for ethylamine, 111 mM for phosphate buffer, and 0 for ⁇ -NADPH. .99 mM, 0.0022 units/ ⁇ L of GDH solution.
- any one of #02-001 to 217 was added to the prepared premix 3 to carry out the H-EtPhe-OH synthesis reaction. Specifically, any one solution of #02-001 to #02-217 was added to Premix 3, respectively. An imidazole-containing buffer was added to the negative control enzyme (-). This was mixed well and incubated at 37°C for 19 hours. The concentration of each compound at the start of the reaction was phenylpyruvate sodium salt of 50 mM, D(+)-glucose of 100 mM, ethylamine of 500 mM, phosphate buffer of 100 mM, ⁇ -NADPH of 0.89 mM, and GDH solution. is 0.002 unit/ ⁇ L, and any one of #02-001 to 217 is 2.5 ⁇ M.
- reaction solution was post-treated to prepare a sample for LCMS analysis. Specifically, hydrochloric acid was added in an amount 9 times the amount of the reaction solution so that the final concentration after the addition of hydrogen chloride was 30 mM (this solution is hereinafter referred to as post-treated reaction solution 3).
- this solution is hereinafter referred to as post-treated reaction solution 3.
- H-MePhe-OH whose molar extinction coefficient is estimated to be equivalent to that of H-EtPhe-OH. A dilution series was made.
- H-MePhe-OH purchased from Watanabe Kagaku Kogyo Co., Ltd.
- 1M potassium hydroxide aqueous solution a 1M potassium hydroxide aqueous solution
- the solution was repeatedly diluted twice with ultrapure water.
- This dilution series was added to a mixed solvent containing a phosphate buffer, 1xTNG, and an imidazole-containing buffer to prepare a calibration curve sample.
- the concentration of the phosphate buffer was 100 mM (pH 7.4)
- the volume ratios of 1xTNG, imidazole-containing buffer, and H-MePhe-OH dilution series were 10%, 10%, and 20%, respectively.
- sample 2 a calibration curve sample for LCMS analysis
- Post-treated reaction solution 3 and post-treated calibration curve sample 2 were all passed through a 0.2 ⁇ m PVDF membrane filter (purchased from Corning, Inc.) and subjected to LCMS measurement.
- the liquid volume used for the measurement is 1 ⁇ L.
- TargetLynx the H-EtPhe-OH synthesis activity of each of #02-001 to 217 was evaluated by detecting the area of the H-EtPhe-OH-derived peak on the UV chart (254 nm). The results are shown in the table below, and multiple modified enzymes with higher H-EtPhe-OH synthesis activity than the wild-type enzyme (#02-001) were found.
- LCMS (ESI) m/z 194.18 (M+H) + Retention time: 0.37 minutes (analysis condition FA05-2, retention time in UV chart (254 nm))
- the synthetic activity is obtained by dividing the yield of the target product when using #02-001 to 217 by the yield of the target product when using the wild-type enzyme (#02-001). rice field. Tables 6 and 7 show the calculated synthetic activity ratios. The yield of the wild-type enzyme was 22% for #02-193-200 and 28% for the others.
- Synthesis Example 2 Sodium chloride of 2-oxo-3-(p-tolyl) propanoic acid Sodium salification was performed. Specifically, 2-oxo-3-(p-tolyl)propanoic acid (purchased from ChemSpace) was suspended in a mixed solvent of acetonitrile and ultrapure water (1:1), and then 1M sodium hydroxide aqueous solution was added. 1 equivalent was added to the above keto acid and stirred well. After confirming complete dissolution, it was passed through a 0.5 ⁇ m PTFE membrane filter (purchased from Tosoh Corporation) and freeze-dried.
- a 0.5 ⁇ m PTFE membrane filter purchased from Tosoh Corporation
- Evaluation Example 3 Example of Modified Enzyme Screening Using H-EtPhe(4-Me)-OH Synthesis Activity as Index -Me)-OH synthesis activity was used as an indicator, and a substrate-containing solution (hereinafter referred to as premix 4) was prepared. Specifically, the sodium salt of keto acid and D(+)-glucose prepared in Synthesis Example 2 were dissolved in a mixed solvent of ethylamine aqueous solution and phosphate buffer. After adjusting the pH to 8.0 using an aqueous sodium hydroxide solution, the solution was diluted with ultrapure water. A ⁇ -NADPH aqueous solution and a GDH solution were added to this solution to obtain a premix 4.
- the concentration of each compound at the time of premix 4 was 55.6 mM for sodium salt of keto acid prepared in Synthesis Example 2, 111 mM for D(+)-glucose, 556 mM for ethylamine, and 556 mM for ethylamine. 111 mM, ⁇ -NADPH is 0.99 mM, and GDH solution is 0.0022 unit/ ⁇ L.
- any one of #02-001 to 217 was added to the prepared premix 4 to carry out the H-EtPhe(4-Me)-OH synthesis reaction. Specifically, any one solution of #02-001 to #02-217 was added to Premix 4, respectively. An imidazole-containing buffer was added to the negative control enzyme (-). This was mixed well and incubated at 37°C for 19 hours. The concentration of each compound at the start of the reaction was 50 mM for the sodium salt of the keto acid prepared in Synthesis Example 2, 100 mM for D(+)-glucose, 500 mM for ethylamine, 100 mM for phosphate buffer, and 100 mM for ⁇ -NADPH. is 0.89 mM, GDH solution is 0.002 unit/ ⁇ L, and any one of #02-001 to 217 is 2.5 ⁇ M.
- reaction solution 4 The reaction solution after incubation was post-processed to prepare samples for LCMS analysis. Specifically, a DMSO solution containing hydrochloric acid in an amount 9 times the volume of the reaction solution (the volume ratio of hydrochloric acid and DMSO is 3:87) was added so that the final concentration after the addition of hydrogen chloride was 30 mM (hereinafter referred to as this solution is called post-treated reaction solution 4).
- Post-treated reaction solution 4 and post-treated calibration curve sample 2 were all passed through a 0.2 ⁇ m PVDF membrane filter (purchased from Corning, Inc.) and subjected to LCMS measurement.
- the liquid volume used for the measurement is 1 ⁇ L.
- TargetLynx by detecting the area of the peak derived from H-EtPhe(4-Me)-OH on the UV chart (254 nm), #02-001 to 217 of each H-EtPhe(4-Me)-OH Synthetic activity was evaluated. The results are shown in the table below, and multiple modified enzymes with higher H-EtPhe(4-Me)-OH synthesis activity than the wild-type enzyme (#02-001) were found.
- LCMS (ESI) m/z 208.21 (M+H) + Retention time: 0.59 minutes (analysis condition FA05-2, retention time in UV chart (254 nm))
- the synthetic activity is obtained by dividing the yield of the target product when using #02-001 to 217 by the yield of the target product when using the wild-type enzyme (#02-001). rice field. Tables 8 and 9 show the calculated synthetic activity ratios. The yield of the wild-type enzyme was 10% for #02-002-073, #02-092-109, #02-128-145 and #02-200-217, and 6% for the others.
- Evaluation Example 4 Implementation of Modified Enzyme Screening Using H-EtPhe-OH Synthesis Activity as Index (Double Mutant Screening)
- the modified enzymes (#03-001-130) prepared in Example 1 were screened using H-EtPhe-OH synthesis activity as an indicator.
- the protocol was the same as in Evaluation Example 2, except that #03-001-130 was used instead of #02-002-217 as the modifying enzyme.
- #02-021 and 117 had already been evaluated for their activity in Evaluation Example 2, they were used as controls in an experimental system different from WT. The results are shown in the table below, and multiple modified enzymes with higher H-EtPhe-OH synthesis activity than the wild-type enzyme (#02-001) were found.
- Evaluation Example 5 Implementation of Modified Enzyme Screening Using H-EtPhe-OH Synthesis Activity as Index (Triple Mutant Screening)
- the modified enzymes (#04-001-072) prepared in Example 1 were screened using H-EtPhe-OH synthesis activity as an index.
- the protocol was the same as in Evaluation Example 2, except that #04-001 to 072 were used instead of #02-002 to 217 as modifying enzymes.
- #02-021, 117 and #03-006, 020 had already been evaluated for activity in Evaluation Examples 2 and 3, they were used as controls in an experimental system different from WT.
- the results are shown in the table below, and multiple modified enzymes with higher H-EtPhe-OH synthesis activity than the wild-type enzyme (#02-001) were found.
- Synthesis Example 3 Synthesis of H-MeVal-OH A solution containing a substrate (hereinafter referred to as premix 5) for testing H-MeVal-OH synthesis by the modified enzyme (#02-169) prepared in Example 1 was prepared. Specifically, sodium 3-methyl-2-oxobutanoate (purchased from Sigma-Aldrich Japan LLC), two compounds of D(+)-glucose, methylamine aqueous solution, phosphate buffer (400 mM, pH 7.4) was dissolved in a mixed solvent of After adjusting the pH to 8.0 using an aqueous sodium hydroxide solution, the solution was diluted with ultrapure water.
- premix 5 a substrate for testing H-MeVal-OH synthesis by the modified enzyme (#02-169) prepared in Example 1 was prepared. Specifically, sodium 3-methyl-2-oxobutanoate (purchased from Sigma-Aldrich Japan LLC), two compounds of D(+)-glucose, methylamine aqueous solution, phosphate buffer (400
- a ⁇ -NADPH aqueous solution and a GDH solution were added to this solution to obtain a premix 5.
- the concentration of each compound at the time of premix 5 is 55.6 mM for sodium 3-methyl-2-oxobutanoate, 111 mM for D (+)-glucose, 556 mM for methylamine, 111 mM for phosphate buffer, ⁇ -NADPH is 0.99 mM, and GDH solution is 0.0022 unit/ ⁇ L.
- #02-169 was added to the prepared premix 5 to carry out the H-MeVal-OH synthesis reaction. Specifically, to premix 5, the solution of #02-169 was added. This was mixed well and incubated at 37°C for 19 hours. The concentration of each compound at the start of the reaction was 50 mM for sodium 3-methyl-2-oxobutanoate, 100 mM for D(+)-glucose, 500 mM for methylamine, 100 mM for phosphate buffer, and 0 for ⁇ -NADPH. 0.89 mM, 0.002 unit/ ⁇ L for GDH solution, and 2.5 ⁇ M for #02-169.
- reaction solution 5 The reaction solution after incubation was post-processed to prepare samples for LCMS analysis. Specifically, hydrochloric acid was added in an amount 9 times the amount of the reaction solution so that the final concentration after the addition of hydrogen chloride was 30 mM (this solution is hereinafter referred to as post-treated reaction solution 5).
- a dilution series of H-MeVal-OH was prepared for the purpose of quantifying the concentration of H-MeVal-OH dissolved in the post-treated reaction solution 5 by LCMS. Specifically, after dissolving H-MeVal-OH in ultrapure water to a concentration of 1000 mM, the solution was repeatedly diluted twice with ultrapure water.
- ⁇ -NADPH aqueous solution 1 ⁇ TNG, imidazole-containing buffer, and dilution series were added to premix 6 and mixed well.
- concentration of each compound at this time was 25 mM for sodium 3-methyl-2-oxobutanoate, 75 mM for D(+)-glucose, 475 mM for methylamine, 100 mM for phosphate buffer, and 0 for ⁇ -NADPH.
- 89 mM, and 1 ⁇ TNG and imidazole-containing buffers are each 10% by volume.
- sample 3 a calibration curve sample for LCMS analysis
- diluent solutions were prepared that mimicked the composition of various compounds dissolved in the post-treated reaction solution 5 . Specifically, premix 6, 1 ⁇ TNG, imidazole-containing buffer solution, ⁇ -NADPH aqueous solution, and hydrochloric acid were mixed and diluted with ultrapure water.
- the concentrations of ⁇ -NADPH and hydrogen chloride after volume up were 0.089 mM and 30 mM, respectively, and the final volume ratios of premix 6, 1 ⁇ TNG, and imidazole-containing buffer were 6%, 1%, and 1%, respectively. is.
- the post-treated reaction solution 6 was obtained by diluting the post-treated reaction solution 5 by 32 times using this dilution solution.
- Post-treated reaction solution 5, post-treated reaction solution 6, and post-treated calibration curve sample 3 were all passed through a 0.2 ⁇ m PVDF membrane filter and subjected to LCMS measurement.
- the liquid volume used for the measurement is 1 ⁇ L.
- Oxidized nicotinamide adenine dinucleotide phosphate 50 mg was dissolved in 0.4 mol/L N,N-di(2-hydroxyethyl)glycine solution (1.0 mL, pH 9.0) to obtain oxidized nicotinamide adenine dinucleotide.
- a phosphoric acid solution A solution was prepared.
- D-glucose dehydrogenase 50 mg was dissolved in 0.4 mol/L N,N-di(2-hydroxyethyl)glycine solution (1.0 mL, pH 9.0) to give a D-glucose dehydrogenase solution (solution B). ) was prepared.
- MeHph(2-Cl) Using Modified Enzyme W253H-SBP-His and Additive (Dimethylsulfoxide)
- the abbreviation MeHph(2-Cl) indicates a compound having the following structural formula.
- LCMS analysis conditions are as follows.
- TFA00-QDa Equipment Waters H class/QDa Column: (ID x length (mm), particle size ( ⁇ m)): ACQUITY UPLC HSS T3 (2.1 x 50, 1.8) Mobile phase: A) 0.05% TFA H2O , B) 0.05% TFA MeCN Gradient (A/B): 100/0 to 2/98 (5.0 minutes) ⁇ 2/98 (1.0 minutes) ⁇ 100/0 (0.01 minutes) ⁇ 100/0 (2.0 minutes) Flow rate (ml/min): 0.5 Column temperature: 30°C Wavelength: 197nm
- LCMS analysis conditions are as follows.
- Evaluation Example 7 Synthesis of (2S,3S)-2-amino-3-phenyl-butanoic acid using modified enzyme W253H-SBP-His and additive (dimethylsulfoxide) Sodium 2-oxo-3-phenylbutanoate (50 mM final concentration), D(+)-glucose (100 mM final concentration), ammonia solution (500 mM final concentration), N,N-di(2-hydroxyethyl)glycine buffer (final concentration 0.1 M), NADPH solution (final concentration 1 mM), GDH solution (final concentration 0.002 unit / ⁇ L), additive DMSO (20 vol%), modified enzyme W253H-SBP-His prepared in Example 2 (final concentration: 20 ⁇ M), a mixed solution of ultrapure water was prepared, and incubation was carried out at 37° C.
- modified enzyme W253H-SBP-His prepared in Example 2 final concentration: 20 ⁇ M
- a mixed solution of ultrapure water was prepared, and
- Chiral HPLC analysis conditions are as follows. Equipment: Shimadzu Nexera X3 Column (ID x length (mm), particle size ( ⁇ m)): DAICEL CHIRALPAK ZWIX (+) (3.0 x 150, 3.0) Mobile phase: MeOH:MeCN: H2O (49:49:2, v/v) solution containing 50 mM formic acid and 25 mM diethylamine Elution method: isocratic Analysis time: 10 minutes Flow rate (ml/min): 0.5 Column temperature: 25°C Wavelength: 254nm
- Evaluation Example 8 Evaluation of additives in MeGly (cPent) synthesis using modified enzyme W253H-SBP-His and additive (DMSO) Sodium 2-cyclopentyl-2-oxoacetate (final concentration 100 mM), D (+) - Glucose (final concentration 200 mM), methylamine hydrochloride (final concentration 500 mM), NADPH (final concentration 2.0 mM), N,N-di(2-hydroxyethyl)glycine (final concentration 100 mM) were dissolved in distilled water, After adding the additive DMSO (0 to 40 v/v%), the pH was adjusted to 8.8 to 8.9 with a 5M sodium hydroxide aqueous solution.
- DMSO additive
- GDH solution (0.10 units/ ⁇ L, 1 ⁇ TNG solution, final concentration 0.0040 units/ ⁇ L), modified enzyme W253H-SBP-His (0.67 mM, final concentration 5.0 ⁇ M) prepared in Example 2 was added. , 25° C. for 24 hours.
- Evaluation Example 9 Evaluation of Additives in Phe Synthesis Using Modified Enzyme W253H-SBP-His N,N-di (2-hydroxyethyl) glycine buffer (final concentration 0.1 M), NADPH solution (final concentration 1 mM), GDH solution (final concentration 0.002 unit / ⁇ L), additive DMSO (with respect to the reaction solution 20 v/v%), the modified enzyme W253H-SBP-His (final concentration 2.5 ⁇ M) prepared in Example 2, and a mixed solution of ultrapure water (pH 8-9) were prepared and incubated at 25°C. , an evaluation of the reaction was carried out.
- Condition 1 for high-performance liquid chromatography Apparatus Waters AQUITY H-class/QDa Column: (ID x length (mm), particle size ( ⁇ m)): ACQUITY UPLC HSS T3 (2.1 x 50, 1.8) Mobile phase: A) 0.05% TFA H2O , B) 0.05% TFA MeCN Gradient (A/B): 100/0 to 2/98 (5.0 minutes) ⁇ 2/98 (1.0 minutes) ⁇ 100/0 (0.01 minutes) ⁇ 100/0 (2.0 minutes) Flow rate (ml/min): 0.5 Column temperature: 30°C
- 2-Cyclopentyl-2-oxo-acetic acid sodium salt (3.9 g, 24 mmol), methylamine hydrochloride (8.1 g, 120 mmol), D-glucose (8.7 g, 48 mmol) and N,N-di(2- Hydroxyethyl)glycine (7.8 g, 48 mmol) was dissolved in distilled water (50 mL) and the external temperature of the reaction vessel was set to 25°C. A 5M sodium hydroxide aqueous solution (6.0 mL) was added to adjust the pH to 8.8.
- NADP + (0.18 g, 0.24 mmol), D-glucose dehydrogenase (3.8 mg, 960 U, 250 U / mg) and modified enzyme W253H-SBP-His prepared in Example 2 (1.6 mL, as enzyme 43 mg equivalent, 1.1% by mass) was added, and the mixture was stirred at an external temperature of the reaction vessel of 25° C. for 24 hours. Concentrated hydrochloric acid (3.0 mL) was added to adjust the pH to 1.9 and stirred for 1 hour. Insoluble matter was filtered through a celite pad, and the celite pad was washed with distilled water (20 mL) to give a (S)-2-cyclopentyl-2-(methylamino)acetic acid solution (120 g).
- a 50 w/v % sodium hydroxide aqueous solution (1.5 mL) was added and stirred for 3 hours.
- N-Carbobenzoxyoxysuccinimide (1.2 g, 4.8 mmol) was added and stirred for 90 minutes.
- a 50 w/v % sodium hydroxide aqueous solution (0.5 mL) was added, and the mixture was stirred for 18 hours.
- Concentrated hydrochloric acid (8.0 mL) was added, the target substance was extracted into the organic layer, and the resulting organic layer was concentrated to dryness under reduced pressure at an external temperature of 40°C of the reaction vessel.
- Methyl tert-butyl ether (15 mL) was added, the organic layer was washed twice with a 5% aqueous solution of disodium hydrogen phosphate (10 mL x 2) and once with an aqueous 2 M sodium hydroxide solution (10 mL), and the desired product was added to the aqueous layer. Extracted. The resulting aqueous layers were combined, and methyl tert-butyl ether (20 mL) and concentrated hydrochloric acid (1.5 mL) were added to re-extract the desired product into the organic layer. The obtained organic layer was concentrated to dryness under reduced pressure at an external temperature of 40° C. of the reaction vessel.
- NADP + (0.25 g, 0.33 mmol
- D-glucose dehydrogenase 26 mg, 1300 U, 50 U / mg
- modified enzyme W253H-SBP-His prepared in Example 2 (2.0 mL, equivalent to 53 mg as enzyme , 1.0% by mass) was added and stirred at an external temperature of the reaction vessel of 25° C. for 21 hours (reaction conversion rate of 99% or more).
- Concentrated hydrochloric acid (7.5 mL) was added to adjust the pH to 1.9 and stirred for 1 hour. Insoluble matter was filtered through a celite pad, and the celite pad was washed with distilled water (11 mL) to give a (S)-2-cyclopentyl-2-(methylamino)acetic acid solution (130 g).
- a 50 w/v% sodium hydroxide aqueous solution (3.2 mL) was added to a (S)-2-cyclopentyl-2-(methylamino)acetic acid solution (27 g, equivalent to 6.5 mmol) to adjust the pH to 12.3.
- the obtained solution was concentrated to dryness at an external temperature of 40° C. of the reaction vessel.
- Distilled water (24 mL) and concentrated hydrochloric acid (0.53 mL) were added at an external temperature of 25° C. to adjust the pH to 9.2.
- Methyl tert-butyl ether (5.3 mL), acetonitrile (2.7 mL) and N-carbobenzoxoxysuccinimide (1.8 g, 7.2 mmol) were added and stirred for 105 minutes.
- Acetonitrile (1.6 mL) was added and stirred for another 30 minutes.
- a 50 w/v % sodium hydroxide aqueous solution (0.8 mL) was added to adjust the pH to 9.3, and the mixture was stirred for 105 minutes.
- N-Carbobenzoxyoxysuccinimide (1.0 g, 3.9 mmol) was added and stirred for 105 minutes.
- Synthesis Example 7 Synthesis of (S)-2-(benzyloxycarbonyl(methyl)amino)-2-cyclopentyl-acetate lithium salt seed crystals (S)-2-(benzyloxycarbonyl(methyl)amino)-2- Cyclopentyl-acetic acid (1.0 g, 3.4 mmol, commercial product) was dissolved in tetrahydrofuran (5.0 ml, 5.0 v/w) and stirred at an external temperature of the reaction vessel of 25°C. Lithium tert-butoxide (0.30 g, 3.8 mmol) was added and precipitation of crystals was confirmed. Tetrahydrofuran (20 ml, 20 v/w) was added and stirred for 1 hour.
- Comparative Example 2 and Example 1-1 Purification of Amino Acid Derivatives in Free Form and Purification with Lithium Salt Purification of amino acid derivatives in the free form (carboxylic acid) and purification with lithium salts were compared. Amino acid derivatives containing impurities were isolated as free forms or lithium salts, respectively, and their apparent purities were compared. The apparent purity or apparent impurity content was calculated from the UV absorption peak area ratio of high performance liquid chromatography. Apparent purity was calculated by Equation 1b, and apparent impurity content was calculated by Equation 2b.
- Heptane (1.0 mL, 0.6 v/w), seed crystals ((S)-2-(benzyloxycarbonyl(methyl)amino)-2-cyclopentyl-acetic acid (free form) crystals, commercial product, 5.0 mg ) was added and stirred for 15 minutes to confirm the precipitation of crystals.
- Example 1-1 Purification of (S)-2-(benzyloxycarbonyl(methyl)amino)-2-cyclopentyl-acetic acid with lithium salt
- Acetonitrile (5.0 ml, 10 v/w) was added over 10 minutes, seed crystals (synthesized according to Synthesis Example 7, 5.0 mg) were added, and the mixture was stirred for 40 minutes to confirm precipitation of crystals.
- the external temperature of the reaction vessel was set to 25° C. and stirred for 3 hours.
- the external temperature of the reaction vessel was set to 0° C. and stirred for 30 minutes, acetonitrile (2.5 ml, 5.0 v/w) was added over 5 minutes, and the mixture was further stirred for 30 minutes.
- Acetonitrile (5.0 ml, 10 v/w) was added over 5 minutes and stirred for 30 minutes.
- Example 1-2 Purification with (S)-2-(benzyloxycarbonyl(methyl)amino)-2-cyclopentyl-acetic acid lithium salt
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Low-Molecular Organic Synthesis Reactions Using Catalysts (AREA)
Priority Applications (18)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2023570983A JPWO2023127752A1 (https=) | 2021-12-28 | 2022-12-23 | |
| US18/724,369 US20250129398A1 (en) | 2021-12-28 | 2022-12-23 | Polypeptide and method for producing amino acid using same |
| CN202280083462.7A CN118401654A (zh) | 2021-12-28 | 2022-12-23 | 多肽和应用其的氨基酸的制备方法 |
| KR1020247023935A KR20240128008A (ko) | 2021-12-28 | 2022-12-23 | 폴리펩타이드 및 이를 이용한 아미노산의 제조 방법 |
| KR1020247040256A KR20250012580A (ko) | 2022-05-13 | 2023-05-12 | 리튬 염 침전 단계를 포함하는, 아미노산의 염 또는 펩타이드 화합물의 염 또는 상기 염 중 하나의 용매화물을 생성하는 방법 |
| EP23803630.5A EP4520829A1 (en) | 2022-05-13 | 2023-05-12 | Method for producing amino acid and peptide compound, using enzyme and additive |
| US18/864,039 US20250369029A1 (en) | 2022-05-13 | 2023-05-12 | Method for producing amino acid and peptide compound, using enzyme and additive |
| JP2024520496A JPWO2023219156A1 (https=) | 2022-05-13 | 2023-05-12 | |
| KR1020247040257A KR20250011913A (ko) | 2022-05-13 | 2023-05-12 | 효소 및 첨가제를 이용한 아미노산 및 펩타이드 화합물의 생성 방법 |
| PCT/JP2023/017844 WO2023219152A1 (ja) | 2022-05-13 | 2023-05-12 | リチウム塩の析出工程を含む、アミノ酸の塩若しくはペプチド化合物の塩又はこれらの溶媒和物の製造方法 |
| CN202380038589.1A CN119156450A (zh) | 2022-05-13 | 2023-05-12 | 使用酶和添加物产生氨基酸和肽化合物的方法 |
| JP2024520494A JPWO2023219152A1 (https=) | 2022-05-13 | 2023-05-12 | |
| TW112117692A TW202409292A (zh) | 2022-05-13 | 2023-05-12 | 使用酵素及添加劑的胺基酸及胜肽化合物的製造方法 |
| TW112117693A TW202411238A (zh) | 2022-05-13 | 2023-05-12 | 包含鋰鹽的析出步驟之胺基酸的鹽或胜肽化合物的鹽或該些之溶劑合物的製造方法 |
| US18/864,049 US20250368680A1 (en) | 2022-05-13 | 2023-05-12 | Method for producing salt of amino acid or salt of peptide compound or solvate of either one of said salts comprising lithium salt precipitation step |
| CN202380038518.1A CN119156373A (zh) | 2022-05-13 | 2023-05-12 | 包括锂盐沉淀步骤的用于生产氨基酸的盐或肽化合物的盐或所述盐中的任一者的溶剂化物的方法 |
| EP23803626.3A EP4520748A1 (en) | 2022-05-13 | 2023-05-12 | Method for producing salt of amino acid or salt of peptide compound or solvate of either one of said salts comprising lithium salt precipitation step |
| PCT/JP2023/017861 WO2023219156A1 (ja) | 2022-05-13 | 2023-05-12 | 酵素及び添加剤を用いたアミノ酸及びペプチド化合物の製造方法 |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2021215094 | 2021-12-28 | ||
| JP2021-215094 | 2021-12-28 | ||
| JP2022079712 | 2022-05-13 | ||
| JP2022079708 | 2022-05-13 | ||
| JP2022079711 | 2022-05-13 | ||
| JP2022-079711 | 2022-05-13 | ||
| JP2022-079708 | 2022-05-13 | ||
| JP2022-079712 | 2022-05-13 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023127752A1 true WO2023127752A1 (ja) | 2023-07-06 |
Family
ID=86558905
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2022/047741 Ceased WO2023127752A1 (ja) | 2021-12-28 | 2022-12-23 | ポリペプチド及びこれを用いたアミノ酸の製造方法 |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20250129398A1 (https=) |
| EP (1) | EP4206322A3 (https=) |
| JP (1) | JPWO2023127752A1 (https=) |
| KR (1) | KR20240128008A (https=) |
| TW (1) | TW202342741A (https=) |
| WO (1) | WO2023127752A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12312379B2 (en) | 2021-05-07 | 2025-05-27 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing cyclic compounds comprising N-substituted amino acid residues |
| US12404299B2 (en) | 2019-11-07 | 2025-09-02 | Chugai Seiyaku Kabushiki Kaisha | Method for producing peptide compound comprising highly sterically hindered amino acid |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003072770A1 (en) * | 2002-02-28 | 2003-09-04 | Mitsubishi Chemical Corporation | Novel dehydrogenase and gene encoding the same |
| JP2005095167A (ja) * | 2003-08-26 | 2005-04-14 | Mitsubishi Chemicals Corp | 光学活性環状アミノ酸の製造方法 |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2002306849A1 (en) | 2001-03-21 | 2002-10-08 | Elitra Pharmaceuticals, Inc. | Identification of essential genes in microorganisms |
| HUE036947T2 (hu) * | 2012-05-11 | 2018-08-28 | Codexis Inc | Átalakított iminreduktázok és eljárások keton- és aminvegyületek reduktív aminálására |
-
2022
- 2022-12-23 EP EP22216504.5A patent/EP4206322A3/en active Pending
- 2022-12-23 KR KR1020247023935A patent/KR20240128008A/ko active Pending
- 2022-12-23 WO PCT/JP2022/047741 patent/WO2023127752A1/ja not_active Ceased
- 2022-12-23 TW TW111149813A patent/TW202342741A/zh unknown
- 2022-12-23 US US18/724,369 patent/US20250129398A1/en active Pending
- 2022-12-23 JP JP2023570983A patent/JPWO2023127752A1/ja active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003072770A1 (en) * | 2002-02-28 | 2003-09-04 | Mitsubishi Chemical Corporation | Novel dehydrogenase and gene encoding the same |
| JP2005095167A (ja) * | 2003-08-26 | 2005-04-14 | Mitsubishi Chemicals Corp | 光学活性環状アミノ酸の製造方法 |
Non-Patent Citations (2)
| Title |
|---|
| KERBS ANASTASIA, MINDT MELANIE, SCHWARDMANN LYNN, WENDISCH VOLKER F.: "Sustainable Production of N-methylphenylalanine by Reductive Methylamination of Phenylpyruvate Using Engineered Corynebacterium glutamicum", MICROORGANISMS, vol. 9, no. 4, pages 824, XP093041754, DOI: 10.3390/microorganisms9040824 * |
| MINDT MELANIE, HANNIBAL SILVIN, HEUSER MARIA, RISSE JOE MAX, SASIKUMAR KEERTHI, NAMPOOTHIRI K. MADHAVAN, WENDISCH VOLKER F.: "Fermentative Production of N-Alkylated Glycine Derivatives by Recombinant Corynebacterium glutamicum Using a Mutant of Imine Reductase DpkA From Pseudomonas putida", FRONTIERS IN BIOENGINEERING AND BIOTECHNOLOGY, vol. 7, XP093041951, DOI: 10.3389/fbioe.2019.00232 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12404299B2 (en) | 2019-11-07 | 2025-09-02 | Chugai Seiyaku Kabushiki Kaisha | Method for producing peptide compound comprising highly sterically hindered amino acid |
| US12312379B2 (en) | 2021-05-07 | 2025-05-27 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing cyclic compounds comprising N-substituted amino acid residues |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20240128008A (ko) | 2024-08-23 |
| US20250129398A1 (en) | 2025-04-24 |
| TW202342741A (zh) | 2023-11-01 |
| EP4206322A3 (en) | 2023-09-06 |
| JPWO2023127752A1 (https=) | 2023-07-06 |
| EP4206322A2 (en) | 2023-07-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2023127752A1 (ja) | ポリペプチド及びこれを用いたアミノ酸の製造方法 | |
| CA2952638C (en) | Compositions and methods for making (s)-norcoclaurine and (s)-norlaudanosoline, and synthesis intermediates thereof | |
| US20250369029A1 (en) | Method for producing amino acid and peptide compound, using enzyme and additive | |
| TWI226372B (en) | Stereoselective reductive amination of ketones | |
| US20230416708A1 (en) | Novel Variants of Endonuclease V and Uses Thereof | |
| US20250368680A1 (en) | Method for producing salt of amino acid or salt of peptide compound or solvate of either one of said salts comprising lithium salt precipitation step | |
| CN113621593B (zh) | 来自古柯的聚酮合酶EnPKS1和EnPKS2及其基因和应用 | |
| JP6675519B2 (ja) | D型アミノ酸脱水素酵素 | |
| CN118401654A (zh) | 多肽和应用其的氨基酸的制备方法 | |
| HK40109225A (zh) | 多肽和应用其的氨基酸的制备方法 | |
| TW202409292A (zh) | 使用酵素及添加劑的胺基酸及胜肽化合物的製造方法 | |
| HK40113414A (zh) | 使用酶和添加物产生氨基酸和肽化合物的方法 | |
| JP5499350B2 (ja) | キヌクリジノン還元酵素及びそれを用いた光学活性3−キヌクリジノールの製造方法 | |
| JP2020530029A (ja) | ノルボルネン部分を担う新規アミノ酸 | |
| JP2005218342A (ja) | 新規甘味タンパク質及びその製法 | |
| KR101223665B1 (ko) | 나이트릴레이즈 rmn2을 이용한 카르복실산의 제조방법 | |
| KR101223664B1 (ko) | 나이트릴레이즈 rmn1을 이용한 카르복실산의 제조방법 | |
| KR101223663B1 (ko) | 나이트릴레이즈 vmn1을 이용한 카르복실산의 제조방법 | |
| KR101223666B1 (ko) | 나이트릴레이즈 orn을 이용한 카르복실산의 제조방법 | |
| TW202411238A (zh) | 包含鋰鹽的析出步驟之胺基酸的鹽或胜肽化合物的鹽或該些之溶劑合物的製造方法 | |
| JP2024157855A (ja) | 変異型テトラプレニル-β-クルクメン環化酵素及びそれを用いたアンブレインの製造方法 | |
| WO2026077378A1 (zh) | 高效生产芳香族非天然氨基酸和定点修饰重组蛋白的生物合成方法、工程菌株及其应用 | |
| Takacs | Adapting Proteins for Clinical and Industrial Use | |
| EP1278870A1 (en) | Splice variant of camp phosphodiesterase type 7 (pde7a3) | |
| HK40114071A (zh) | 包括锂盐沉淀步骤的用於生产氨基酸的盐或肽化合物的盐或所述盐中的任一者的溶剂化物的方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22915975 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2023570983 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280083462.7 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 20247023935 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 22915975 Country of ref document: EP Kind code of ref document: A1 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18724369 Country of ref document: US |