WO2022250470A1 - Asm 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 뇌질환 치료용 약학적 조성물 - Google Patents

Asm 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 뇌질환 치료용 약학적 조성물 Download PDF

Info

Publication number
WO2022250470A1
WO2022250470A1 PCT/KR2022/007485 KR2022007485W WO2022250470A1 WO 2022250470 A1 WO2022250470 A1 WO 2022250470A1 KR 2022007485 W KR2022007485 W KR 2022007485W WO 2022250470 A1 WO2022250470 A1 WO 2022250470A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
set forth
light chain
nos
Prior art date
Application number
PCT/KR2022/007485
Other languages
English (en)
French (fr)
Inventor
홍승범
배재성
진희경
Original Assignee
주식회사 이수앱지스
경북대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020220057049A external-priority patent/KR20220160483A/ko
Priority to MX2023014103A priority Critical patent/MX2023014103A/es
Priority to AU2022279866A priority patent/AU2022279866A1/en
Priority to MA63152A priority patent/MA63152A1/fr
Priority to BR112023024632A priority patent/BR112023024632A2/pt
Priority to JP2023572865A priority patent/JP7484028B1/ja
Application filed by 주식회사 이수앱지스, 경북대학교 산학협력단 filed Critical 주식회사 이수앱지스
Priority to CN202280038237.1A priority patent/CN117396518A/zh
Priority to IL308738A priority patent/IL308738A/en
Priority to CA3219114A priority patent/CA3219114A1/en
Priority to EP22811661.2A priority patent/EP4349865A1/en
Priority to US18/564,378 priority patent/US20240254260A1/en
Publication of WO2022250470A1 publication Critical patent/WO2022250470A1/ko
Priority to CONC2023/0016081A priority patent/CO2023016081A2/es

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17—Amino acids, peptides or proteins
    • A23L33/18—Peptides; Protein hydrolysates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
    • A61K9/0056—Mouth soluble or dispersible forms; Suckable, eatable, chewable coherent forms; Forms rapidly disintegrating in the mouth; Lozenges; Lollipops; Bite capsules; Baked products; Baits or other oral forms for animals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to the use of an antibody that specifically binds to an acid sphingomyelinase (ASM) protein.
  • ASM acid sphingomyelinase
  • Acid sphingomyelinase (ASM) protein an enzyme that regulates sphingolipid metabolism, is a protein expressed in almost all types of cells and plays an important role in sphingolipid metabolism and cell membrane turnover.
  • Korean Patent Registration No. 10-1521117 discloses that inhibiting the activity of overexpressed ASM protein or inhibiting the expression of ASM protein inhibits the accumulation of ⁇ -amyloid and improves learning ability and memory, thereby preventing neurodegenerative diseases. that it can be treated.
  • the activity of the ASM protein is recently increased even in neurological diseases such as depression, it has been known that the expression or activity of the ASM protein is suppressed to improve depression.
  • tricyclic antidepressants used in the treatment of depression, which include amitriptyline, desipramine, mipramine, and the like. Although these tricyclic antidepressants were not developed as ASM protein inhibitors, various studies have demonstrated that they exhibit an ASM protein inhibitory effect.
  • the main pharmacological mechanism of tricyclic antidepressants is to inhibit the reuptake of neurotransmitters in nerve cells to increase their activity, and their action as an ASM inhibitor has been confirmed as a side effect.
  • tricyclic antidepressants may cause side effects such as blurred vision, increased light sensitivity, and vomiting by acting on the nervous system and nerve cells.
  • the present invention provides a pharmaceutical composition for preventing or treating brain diseases comprising an antibody or antigen-binding fragment thereof that specifically binds to ASM (acid sphingomyelinase) protein as an active ingredient.
  • ASM acid sphingomyelinase
  • the present invention provides a health functional food for preventing or improving brain diseases comprising an antibody or an antigen-binding fragment thereof that specifically binds to an ASM protein as an active ingredient.
  • the present invention provides a method for preventing, improving or treating brain diseases comprising administering an antibody or antigen-binding fragment thereof that specifically binds to an ASM protein to a subject.
  • the present invention provides the use of an antibody or antigen-binding fragment thereof that specifically binds to an ASM protein for use in the manufacture of a drug for preventing, improving or treating brain diseases.
  • the antibody or antigen-binding fragment thereof according to the present invention specifically binds to the ASM protein with high avidity, significantly inhibits the activity of the ASM protein present in the cell membrane, and improves cognitive memory without toxicity in an Alzheimer's animal model. effect, ASM protein activity inhibitory effect, amyloid- ⁇ and tau protein accumulation inhibitory effect, and neuroinflammation inhibition effect, so it can be usefully used for the treatment of brain diseases.
  • 1 is a schematic diagram showing amino acid sequences of heavy and light chain variable regions of an antibody prepared in one embodiment of the present invention.
  • Figure 2 is a graph of the result of confirming the binding of the antibody prepared in one embodiment of the present invention with ASM protein by ELISA analysis method.
  • Figure 3 is a schematic diagram showing the antigen-binding site to which the antibody prepared in one embodiment of the present invention binds to the ASM protein structure model.
  • Figure 4 is a result diagram showing a heat map of deuterium substitution in the ASM protein saposin domain by an antibody prepared in one embodiment of the present invention.
  • FIG. 5 is a graph showing the inhibition of the activity of the ASM protein located in the Alzheimer's patient's cell membrane by the antibody prepared in one embodiment of the present invention.
  • FIG. 6 is a graph confirming that the antibody prepared in one embodiment of the present invention inhibits the activity of the ASM protein located in the cell membrane of Alzheimer's patients in a concentration-dependent manner.
  • FIG. 7 is a graph showing the metabolic changes of sphingomyelin in Alzheimer's patient's cell membrane of the antibody prepared in one embodiment of the present invention.
  • FIG. 8 is a schematic diagram showing administration of an antibody prepared in one embodiment of the present invention to an Alzheimer's animal model.
  • FIG. 9 is a graph showing the result of performing an aquatic maze experiment on an Alzheimer's disease animal model to which an antibody prepared in one embodiment of the present invention was administered.
  • FIG. 10 is a diagram showing the result of confirming the swimming path of an Alzheimer's disease animal model to which an antibody prepared in one embodiment of the present invention was administered.
  • FIG. 11 is a graph showing the retention time of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention in the target (A0) or non-target (A1, A2, A3) quadrants.
  • FIG. 12 is a graph showing the results of checking the swimming distance (A), swimming speed (B), and the number of times passing the platform (C) of the Alzheimer's animal model to which the antibody prepared in one embodiment of the present invention was administered.
  • FIG. 13 is a graph showing the results of a fear condition test according to the situation (A) or atmosphere (B) of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • FIG. 14 is a graph showing the inhibition of ASM activity in blood plasma of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • 15 is a graph showing the level of ASM protein in blood plasma of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • 16 is a result confirming the expression of dense-core amyloid- ⁇ plaques in the brain cortex or hippocampus of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • 17 is a result confirming the expression of high-density and diffuse amyloid- ⁇ plaques in the brain cortex or hippocampus of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • 18 is a graph showing the expression of amyloid- ⁇ 40 or amyloid- ⁇ 42 in the brain cortex or hippocampus of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • 19 is a result of confirming the expression of tau protein in the brain cortex or hippocampus of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • 20 is a result of confirming the expression of lba-1 protein in the brain cortex or hippocampus of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • 21 is a result of confirming the expression of GFAP protein in the brain cortex or hippocampus of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • FIG. 22 is a graph showing the survival rate (A) and weight change (B) of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • FIG. 23 is a diagram confirming the long-term toxicity of an Alzheimer's animal model administered with an antibody prepared in one embodiment of the present invention.
  • the present invention provides a pharmaceutical composition for preventing or treating brain diseases comprising an antibody or an antigen-binding fragment thereof that specifically binds to an acid sphingomyelinase (ASM) protein as an active ingredient.
  • ASM acid sphingomyelinase
  • ASM protein' refers to an enzyme that is one of the sphingomyelinase (SMase) family that regulates sphingolipid metabolism.
  • the ASM protein catalyzes the decomposition of sphingomyelin into ceramide and phosphorylcholine, and can be classified as alkaline, neutral or acidic depending on the pH that exhibits optimal enzyme activity.
  • the ASM protein may include all types of ASM proteins known in the art. Specifically, the ASM protein may be derived from mammals, and more specifically, may be derived from humans, monkeys, rats, or mice. In addition, the ASM protein may include all amino acid sequences known as ASM proteins in the art. For example, the ASM protein may be a polypeptide consisting of the amino acid sequences shown in SEQ ID NOs: 66 and 67, respectively, or a nucleic acid encoding the same.
  • the ASM protein may have one or more amino acids added, deleted, or substituted in the amino acid sequence shown in SEQ ID NO: 66 or 67 as long as it maintains the same or corresponding biological activity.
  • the amino acid substitution may be a conservative substitution performed within a range that does not affect or weakens the charge of the entire protein, that is, polarity or hydrophobicity.
  • the ASM protein may have a homology of at least 80%, at least 90%, at least 95%, at least 97%, or at least 99% to the amino acid sequences represented by SEQ ID NOs: 66 and 67, respectively.
  • the ASM protein may include only a part of the ASM protein as long as it maintains the same or corresponding biological activity.
  • the term 'antibody' refers to an immune protein that binds to an antigen and interferes with the action of the antigen or removes the antigen.
  • the antibody may include all types of antibodies included in the conventional art.
  • the antibody may include IgM, IgD, IgG, IgA, and IgE, each of which may include a heavy chain made from ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , which are genes encoding heavy chain constant regions.
  • IgG is mainly used in antibody technology, which is composed of IgG1, IgG2, IgG3, or IgG4 isotypes, and each of these may have different structural and functional properties.
  • the antibody may include both humanized antibodies comprising minimal sequences derived from non-human antibodies, human antibodies composed of sequences derived from humans, or chimeric antibodies in which sequences derived from different species are mixed.
  • the IgG can form a very stable Y-shaped structure (about 150 kDa) made of two heavy chain proteins of about 50 kDa and two light chain proteins of about 25 kDa.
  • Light chains and heavy chains constituting antibodies may be divided into variable regions having different amino acid sequences and constant regions having the same amino acid sequence.
  • the heavy chain constant region includes CH1, hinge (hinge, H), CH2 and CH3 domains, each domain is composed of two ⁇ -sheets ( ⁇ -sheet), linked by intramolecular disulfide bonds can
  • the light chain constant region may include a CL domain.
  • the antigen binding site may be present on each of the two Y-shaped arms.
  • a portion capable of binding to an antigen in a full-length antibody is called an antibody binding fragment (Fab)
  • Fab antibody binding fragment
  • Fc crystallizable fragment
  • Fab and Fc may be hingedly connected.
  • the IgG may be mouse-derived IgG, specifically a mouse IgG heavy chain constant region composed of the amino acid sequence set forth in SEQ ID NO: 74 and a mouse composed of the amino acid sequence set forth in SEQ ID NO: 76 light chain ⁇ constant region.
  • mouse-derived IgG may include a mouse IgG heavy chain constant region composed of the nucleotide sequence shown in SEQ ID NO: 75 and a mouse light chain ⁇ constant region composed of the nucleotide sequence shown in SEQ ID NO: 77.
  • Antibodies according to the present invention may include both full-length antibodies as well as antigen-binding fragments thereof.
  • the antigen-binding fragment may refer to a part other than Fc that functions to deliver binding stimuli with an antigen to cells or complement.
  • the antigen-binding fragment of an antibody may include both Fab, scFv, F(ab) 2 and Fv, and may also include third-generation antibody fragments such as single domain antibodies or minibodies.
  • the antibody or antigen-binding fragment comprises the 53rd to 72nd amino acid fragment, the 101st to 123rd amino acid fragment, the 135th to 159th amino acid fragment, the 135th to 155th amino acid fragment, 218 from the N-terminus of the ASM protein. to 228th amino acid fragment and 259th to 269th amino acid fragment may bind to any one or more epitopes selected from the group consisting of.
  • the ASM protein may have the characteristics as described above.
  • the 53rd to 72nd amino acid fragment from the N-terminus of the ASM protein may be a polypeptide consisting of the amino acid sequence described in SEQ ID NO: 68 (TAINLGLKKEPNVARVGSVA), and the 101st to 123rd amino acid fragment is SEQ ID NO: 69 (VWRRSVLSPSEACGLLLGSTCGH), the 135th to 159th amino acid fragment may be a polypeptide consisting of the amino acid sequence described in SEQ ID NO: 70 (PTVPKPPPKPPSPPAPGAPVSRILF), and the 135th to 155th amino acid fragment is SEQ ID NO: 71 (PTVPKPPPKPPSPPAPGAPVS), the 218th to 228th amino acid fragment may be a polypeptide consisting of the amino acid sequence described in SEQ ID NO: 72 (SGLGPAGPFDM), and the 259th to 269th amino acid fragment is SEQ ID NO: 73 (VRKFLGPVPVY). That is,
  • epitope is a specific site of an antigen at which an antibody can identify an antigen, and refers to a determining site of an antigen to which an antibody can specifically bind.
  • the epitope is commonly used in the same sense as the term antigenic determinant.
  • the epitope consists of a group of chemically active surface molecules, such as amino acids or sugar side chains, and generally has specific three-dimensional structural characteristics as well as specific charge characteristics.
  • the antibody or antigen-binding fragment thereof is a heavy chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 61 (X 1 YX 2 MS), a heavy chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 62 (X 3 IX 4 X 5 X 6 X 7 X 8 X 9 X 10 YYADSVKG), and a heavy chain variable region comprising a heavy chain CDR3 selected from the group consisting of amino acid sequences set forth in SEQ ID NOs: 27, 30, 33, 36, 39 and 42, respectively.
  • a light chain CDR1 consisting of the amino acid sequence set forth in SEQ ID NO: 63 (X 11 GSSSNIGX 12 NX 13 VX 14 ), a light chain CDR2 consisting of the amino acid sequence set forth in SEQ ID NO: 64 (X 15 X 16 X 17 X 18 RPS), and a sequence It may include a light chain variable region including a light chain CDR3 (X 19 X 20 WDX 21 SLX 22 X 23 YV) consisting of the amino acid sequence described in No. 65.
  • CDR complementarity determining region
  • the term 'complementarity determining region (CDR)' refers to a hypervariable region, which is a region having different amino acid sequences for each antibody in the heavy and light chain variable regions of an antibody, and refers to a region that actually binds to an antigen.
  • the CDRs are located on the surface of the antibody in a loop shape, and a framework region (FR) that structurally supports them may be present under the loop.
  • FR framework region
  • Each of the heavy chain and the light chain has three ring structures, and these six ring structures can be combined to make direct contact with an antigen.
  • CDRs, which are antigen binding sites having the six ring structures may be referred to as heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, or light chain CDR3, respectively, for convenience.
  • X 1 and X 2 may be selected from acidic and neutral amino acids, respectively.
  • X 1 may be an acidic or neutral amino acid
  • X 2 may be a neutral amino acid.
  • X 1 and X 2 are asparagine (Asn), glycine (Gly), serine (Ser), aspartic acid (Asp), alanine (Ala) and tyrosine, respectively. (tyrosine, Tyr).
  • X 1 may be asparagine, glycine, serine or aspartic acid
  • X 2 may be alanine or tyrosine
  • the heavy chain CDR1 may be composed of the amino acid sequence described in SEQ ID NO: 25, 28, 31, 34, 37 or 40.
  • X 3 to X 10 may be selected from neutral and basic amino acids, respectively.
  • X 3 and X 4 to X 9 may each be a neutral amino acid
  • X 10 may be a neutral or basic amino acid.
  • the X 3 to X 10 are each glycine, leucine (leucine, Leu), alanine, serine, tyrosine, proline (proline, Pro), asparagine, lysine (lysine, Lys) and isoleucine (isoleucine, Ile).
  • X 3 may be glycine, leucine, alanine or serine
  • X 4 may be tyrosine or serine
  • X 5 may be proline or tyrosine
  • X 6 may be asparagine or glycine
  • X 7 and X 8 may each be glycine or serine
  • X 9 may be asparagine or serine
  • X 10 may be lysine or isoleucine.
  • the heavy chain CDR2 may be composed of the amino acid sequence described in SEQ ID NO: 26, 29, 32, 35, 38 or 41.
  • X 11 to X 14 in the light chain CDR1 (X 11 GSSSNIGX 12 NX 13 VX 14 ) composed of the amino acid sequence set forth in SEQ ID NO: 63 may be selected from neutral amino acids.
  • each of X 11 to X 14 may be selected from the group consisting of threonine (Threonine, Thr), serine, asparagine, alanine, proline, and tyrosine.
  • X 11 may be threonine or serine
  • X 12 may be asparagine or serine
  • X 13 may be alanine, proline, threonine or tyrosine
  • X 14 may be asparagine, tyrosine or serine.
  • the light chain CDR1 may be composed of the amino acid sequence described in SEQ ID NO: 43, 46, 49, 52, 55 or 58.
  • X 15 to X 18 in the light chain CDR2 (X 15 X 16 X 17 X 18 RPS) composed of the amino acid sequence set forth in SEQ ID NO: 64 may be selected from acidic, basic, and neutral amino acids, respectively.
  • X 15 and X 16 may each be an acidic or neutral amino acid
  • X 17 may be a neutral amino acid
  • X 18 may be a basic or neutral amino acid.
  • each of X 15 to X 18 may be selected from the group consisting of tyrosine, alanine, aspartic acid, serine, asparagine, histidine (His), glutamine (Gln), and lysine.
  • X 15 may be tyrosine, alanine, aspartic acid or serine
  • X 16 may be aspartic acid or asparagine
  • X 17 may be serine or asparagine
  • X 18 may be histidine, glutamine or lysine.
  • the light chain CDR2 may be composed of the amino acid sequence described in SEQ ID NO: 44, 47, 50, 53, 56 or 59.
  • X 19 to X 23 in the light chain CDR3 (X 19 X 20 WDX 21 SLX 22 X 23 YV) consisting of the amino acid sequence set forth in SEQ ID NO: 65 may be selected from neutral amino acids.
  • X 19 to X 23 may be selected from the group consisting of glycine, alanine, serine, threonine, tyrosine, aspartic acid, and asparagine.
  • X 19 may be glycine or alanine
  • X 20 may be alanine, serine or threonine
  • X 21 may be tyrosine, serine, alanine or aspartic acid
  • X 22 may be serine or asparagine
  • X 23 can be alanine or glycine.
  • the light chain CDR3 may be composed of the amino acid sequence described in SEQ ID NO: 45, 48, 51, 54, 57 or 60.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain CDR1 selected from the group consisting of amino acid sequences set forth in SEQ ID NOs: 25, 28, 31, 34, 37 and 40, SEQ ID NOs: 26, 29, 32, 35 . area; And a light chain CDR1 selected from the group consisting of amino acid sequences set forth in SEQ ID NOs: 43, 46, 49, 52, 55 and 58, respectively, from the group consisting of amino acid sequences set forth in SEQ ID NOs: 44, 47, 50, 53, 56 and 59, respectively. It may include a light chain variable region including a selected light chain CDR2 and a light chain CDR3 selected from the group consisting of the amino acid sequences set forth in SEQ ID NOs: 45, 48, 51, 54, 57 and 60, respectively.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising heavy chain CDR1, CDR2 and CDR3 consisting of the amino acid sequences shown in SEQ ID NOs: 25, 26 and 27, respectively, and the amino acid sequences shown in SEQ ID NOs: 28, 29 and 30, respectively.
  • a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequences set forth in SEQ ID NOs: 49, 50 and 51, a light chain variable region comprising CDR2 and CDR3, and an amino acid sequence set forth in SEQ ID NOs: 52, 53 and 54, respectively.
  • a light chain variable region comprising light chain CDR1, CDR2 and CDR3, a light chain variable region comprising light chain CDR1, CDR2 and CDR3 consisting of the amino acid sequences set forth in SEQ ID NOs: 55, 56 and 57, respectively, and SEQ ID NOs: 58, 59 and 60 It may include a light chain variable region selected from the group consisting of light chain variable regions comprising light chain CDR1, CDR2 and CDR3 each consisting of the amino acid sequences described above.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising heavy chain CDR1, CDR2 and CDR3 consisting of the amino acid sequences set forth in SEQ ID NOs: 25, 26 and 27, respectively, and amino acids set forth in SEQ ID NOs: 43, 44 and 45, respectively.
  • a light chain variable region comprising light chain CDR1, CDR2 and CDR3 consisting of sequences;
  • a heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 composed of the amino acid sequences set forth in SEQ ID NOs: 28, 29, and 30, and light chain CDR1, CDR2, and CDR3 composed of the amino acid sequences set forth in SEQ ID NOs: 46, 47, and 48, respectively.
  • a light chain variable region comprising a; A heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 consisting of the amino acid sequences set forth in SEQ ID NOs: 31, 32, and 33, respectively, and light chain CDR1, CDR2, and CDR3 consisting of the amino acid sequences set forth in SEQ ID NOs: 49, 50, and 51, respectively.
  • a light chain variable region comprising a; A heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 consisting of the amino acid sequences set forth in SEQ ID NOs: 34, 35, and 36, respectively, and light chain CDR1, CDR2, and CDR3 consisting of the amino acid sequences set forth in SEQ ID NOs: 52, 53, and 54, respectively.
  • a light chain variable region comprising a; A heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 composed of the amino acid sequences set forth in SEQ ID NOs: 37, 38, and 39, respectively, and light chain CDR1, CDR2, and CDR3 composed of the amino acid sequences set forth in SEQ ID NOs: 55, 56, and 57, respectively.
  • a light chain variable region comprising a; Or a heavy chain variable region comprising heavy chain CDR1, CDR2 and CDR3 consisting of the amino acid sequences set forth in SEQ ID NOs: 40, 41 and 42, respectively, and light chain CDR1, CDR2 and It may include a light chain variable region including CDR3.
  • the heavy chain variable region may be a polypeptide consisting of the amino acid sequence described in SEQ ID NO: 1, 3, 5, 7, 9 or 11, and the light chain variable region may be SEQ ID NO: 13, 15, 17, 19, 21 or It may be a polypeptide consisting of the amino acid sequence set forth in 23.
  • the antibody or antigen-binding fragment thereof according to the present invention may be modified as necessary.
  • the antibody or antigen-binding fragment thereof may be modified by conjugation, glycosylation, label attachment, or a combination thereof.
  • the antibody or antigen-binding fragment thereof is HRP (horseradish peroxidase), alkaline phosphatase, hapten, biotin, streptavidin, fluorescent material, radioactive material, quantum dot, PEG (polyethylene glycol), histidine label etc. can be transformed.
  • the antibody or antigen-binding fragment thereof may be conjugated with other drugs, if necessary.
  • the antibody or antigen-binding fragment thereof may be prepared according to a method for preparing a monoclonal antibody known in the art, and the method may be appropriately modified by a person skilled in the art.
  • the antibody may be prepared by preparing a hybridoma using B lymphocytes obtained from an animal immunized with the antigen, or may be prepared using phage display technology.
  • the antibody or antigen-binding fragment thereof included in the pharmaceutical composition according to the present invention may include a nucleic acid encoding the antibody or antigen-binding fragment thereof. Since the amino acid sequence constituting the antibody or antigen-binding fragment thereof is known, the nucleic acid sequence encoding it is also apparent to those skilled in the art. In addition, the nucleic acid sequence may have one or more bases added, deleted, or substituted as long as the activity of the antibody or antigen-binding fragment thereof translated therefrom is maintained.
  • the pharmaceutical composition according to the present invention may include an expression vector containing a nucleic acid encoding the antibody or antigen-binding fragment thereof.
  • the term 'expression vector' is a means for expressing a gene of interest in a host cell and may include all of a plasmid vector, a cosmid vector, a bacteriophage vector, a viral vector, and the like.
  • the expression vector may include elements necessary for generating a peptide from a nucleic acid contained therein.
  • the expression vector may include a signal sequence, an origin of replication, a marker gene, a promoter, a transcription termination sequence, and the like.
  • the nucleic acid encoding the antibody or antigen-binding fragment thereof according to the present invention may be operatively linked to a promoter.
  • an expression vector used in a prokaryotic cell may include a promoter for promoting transcription, a ribosome binding site for initiation of translation, and termination sequences for transcription and translation.
  • expression vectors used in eukaryotic cells may include a promoter and polyadenylation sequences derived from mammals or mammalian viruses.
  • the marker gene included in the expression vector any marker gene known in the art may be used, and specifically, it may be an antibiotic resistance gene.
  • the antibiotic resistance gene may be a gene showing resistance to antibiotics including ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, neomycin, tetracycline, and the like.
  • the pharmaceutical composition according to the present invention may contain, as an active ingredient, a host cell containing a nucleic acid or an expression vector as described above.
  • a host cell all types of cells known in the art can be used to produce antibodies or antigen-binding fragments thereof.
  • the host cell may be a prokaryotic cell, yeast or eukaryotic cell.
  • the prokaryotic cell may include Escherichia coli ( E.
  • yeast may include Saccharomyces cerevisiae, etc.
  • the eukaryotic cells are COS-7, BHK, CHO, CHOK1, DXB-11, DG-44, CHO/-DHFR, CV1, HEK293, TM4, VERO, HELA, MDCK, BRL 3A, W138, Hep G2, SK -Hep, MMT, TRI, MRC 5, FS4, 3T3, RIN, A549, PC12, K562, PERC6, SP2/0, NS-0, U20S, and HT1080.
  • the host cell may be transfected with the nucleic acid or expression vector as described above according to a method known in the art.
  • the transfection is transient transfection, microinjection, transduction, cell fusion, calcium phosphate precipitation, liposome-mediated transfection, DEAE dextran-mediated transfection (DEAE dextran-mediated transfection), polybrene-mediated transfection (polybrene-mediated transfection), electroporation, gene gun (gene gun), and the like.
  • the method can be appropriately modified by a person skilled in the art.
  • the brain disease may include all types of brain diseases known in the art, and specifically, the brain disease may be a degenerative brain disease.
  • the degenerative brain disease may be a disease in which the expression or aggregation level of amyloid- ⁇ is higher than normal or at risk of being higher.
  • the degenerative brain diseases include dementia, Alzheimer's disease, Parkinson's disease, Huntington's disease, mild cognitive impairment, cerebral amyloid angiopathy, Down's syndrome, amyloidogenic stroke, systemic amyloidosis, Dutch-type amyloidosis, Niemann-Pick disease, Senile dementia, amyotrophic lateral sclerosis, spinocerebellar atrophy, Tourette's syndrome, Friedrich's Ataxia, Machado-Joseph's disease, Lewy It could be corpuscular dementia, dystonia, progressive supranuclear palsy or frontotemporal dementia.
  • the pharmaceutical composition according to the present invention may include 10 to 95% by weight of an antibody or antigen-binding fragment thereof that specifically binds to ASM protein, which is an active ingredient, based on the total weight of the composition.
  • the pharmaceutical composition of the present invention may further include at least one active ingredient exhibiting the same or similar function in addition to the above active ingredient.
  • the pharmaceutical composition of the present invention may include carriers, diluents, excipients, or mixtures thereof commonly used in biological preparations.
  • Any pharmaceutically acceptable carrier may be used as long as it is suitable for delivering the composition in vivo.
  • the carrier is described in Merck Index, 13th ed., Merck & Co. Inc., saline, sterile water, Ringer's solution, dextrose solution, maltodextrin solution, glycerol, ethanol or mixtures thereof.
  • conventional additives such as antioxidants, buffers, bacteriostatic agents and the like may be added as needed.
  • diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, and surfactants may be added.
  • the composition of the present invention may be formulated as an oral preparation or a parenteral preparation.
  • Oral preparations may include solid preparations and liquid preparations.
  • the solid preparation may be a tablet, pill, powder, granule, capsule or troche, and such a solid preparation may be prepared by adding at least one excipient to the composition.
  • the excipient may be starch, calcium carbonate, sucrose, lactose, gelatin or mixtures thereof.
  • the solid preparation may include a lubricant, examples of which include magnesium stearate and talc.
  • the liquid formulation may be a suspension, internal solution, emulsion or syrup. In this case, the liquid formulation may include excipients such as wetting agents, sweeteners, fragrances, and preservatives.
  • the parenteral formulation may include injections, suppositories, powders for respiratory inhalation, aerosols for sprays, powders and creams, and the like.
  • the injection may include a sterilized aqueous solution, a non-aqueous solvent, a suspending agent, an emulsion, and the like.
  • vegetable oils such as propylene glycol, polyethylene glycol, and olive oil, or injectable esters such as ethyl oleate may be used as non-aqueous solvents or suspending solvents.
  • the present invention provides a health functional food for preventing or improving brain diseases comprising an antibody or an antigen-binding fragment thereof that specifically binds to an ASM protein as an active ingredient.
  • Antibodies or antigen-binding fragments thereof specifically binding to the ASM protein included as an active ingredient in the health functional food according to the present invention may have characteristics as described above.
  • the antibody or antigen-binding fragment thereof that specifically binds to the ASM protein of the present invention can be added to food as it is or used together with other food or food ingredients.
  • the content of the active ingredient added may be determined according to the purpose, and may generally be 0.01 to 90 parts by weight of the total food weight.
  • the form and type of health functional food is not particularly limited.
  • the health functional food may be in the form of tablets, capsules, powders, granules, liquids and pills.
  • the health functional food may include various flavors, sweeteners, or natural carbohydrates as additional ingredients.
  • the sweetener may be a natural or synthetic sweetener, and examples of the natural sweetener include thaumatin and stevia extract.
  • examples of synthetic sweeteners include saccharin and aspartame.
  • the natural carbohydrates may be monosaccharides, disaccharides, polysaccharides, oligosaccharides and sugar alcohols.
  • the health functional food of the present invention in addition to the above-mentioned additional ingredients, nutrients, vitamins, electrolytes, flavoring agents, coloring agents, pectanes and salts thereof, alginic acid and salts thereof, organic acids, protective colloidal thickeners, pH adjusting agents, stabilizers, and preservatives , glycerin, alcohol, and the like may be further included. These components may be used independently or in combination.
  • the ratio of the additives may be selected in the range of 0.01 to 0.1 parts by weight per 100 parts by weight of the composition of the present invention.
  • the present invention provides a method for preventing, improving or treating brain diseases comprising administering an antibody or antigen-binding fragment thereof that specifically binds to an ASM protein to a subject.
  • the antibody or antigen-binding fragment thereof specifically binding to the ASM protein used in the method for preventing, improving or treating brain diseases according to the present invention may have the characteristics described above.
  • the subject may be a mammal, specifically a human.
  • the administration may be administered orally or parenterally depending on the desired method.
  • Parenteral administration may include intraperitoneal, intrarectal, subcutaneous, intravenous, intramuscular or intrathoracic injection modes.
  • the administration may be administered in a pharmaceutically effective amount. This may vary depending on the type and severity of the disease, the activity of the drug, the patient's sensitivity to the drug, the administration time, the route of administration, the treatment period, and the drugs used simultaneously. However, for desirable effects, the amount of the active ingredient included in the pharmaceutical composition according to the present invention may be 0.0001 to 1,000 mg/kg, specifically 0.001 to 500 mg/kg. The administration may be once or several times a day.
  • the administration may be administered alone or in combination with other therapeutic agents.
  • administration can be sequential or simultaneous.
  • the present invention provides the use of an antibody or antigen-binding fragment thereof that specifically binds to an ASM protein for use in the manufacture of a drug for preventing, improving or treating brain diseases.
  • Antibodies or antigen-binding fragments thereof specifically binding to ASM proteins used in the preparation of drugs for preventing, improving or treating brain diseases according to the present invention may have the characteristics as described above.
  • Example 1 Construction of an antibody that specifically binds to ASM (acid sphingomyelinase) protein
  • Antibodies specifically binding to human ASM protein SEQ ID NO: 66
  • mouse ASM protein SEQ ID NO: 67
  • panning is performed in a conventional manner using recombinant human and mouse ASM proteins and a human synthetic scFv-phage library to select phage having an scFv that specifically binds to human ASM protein or mouse ASM protein.
  • the nucleic acid sequence encoding the selected scFv was analyzed, and the resulting amino acid sequence was identified.
  • a mouse heavy chain constant region and a mouse light chain ⁇ constant region composed of the nucleotide sequences set forth in SEQ ID NOs: 75 and 77 are located at the carboxy terminus of each of the heavy chain variable region and light chain variable region of the identified scFv sequence.
  • An expression vector was constructed so as to be expressed in a concatenated form.
  • amino acid sequence and nucleic acid sequence of the heavy chain variable region constituting the scFv included in the constructed expression vector are shown in Table 1 below, and the amino acid sequence and nucleic acid sequence of the light chain variable region are shown in Table 2 below.
  • Antibodies order sequence number #9101 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGIYPNGGNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKNAYRFDYWGQGTLVTVSS SEQ ID NO: 1 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCAATTATGCTATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGGGATCTATCCTAATGGTGGTAATAAATATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAATTCCAAGAACACGCTGTATCTGCAAATGAACAATTCCAAGAACACGCTGTATCTGCAAATGAACAATTCCAAGAACACGCTGTATCTGCAAATGAACAATTCCAAGA
  • a mammalian expression vector was used as the expression vector.
  • the constructed expression vector was transformed into CHO or HEK293 cell lines to prepare full-length antibodies that bind to human ASM protein or both human and mouse ASM proteins.
  • the complementarity-determining regions were confirmed by a conventional method, and as a result, the CDR sequences of the heavy chain variable region are shown in Table 3 and the CDR sequences of the light chain variable region are shown in Table 4.
  • the binding of the antibody specifically binding to the ASM protein prepared above to the ASM protein was confirmed by ELISA analysis.
  • the plate was washed three times with PBS containing 0.05% Tween, and 100 ⁇ l of goat-anti-mouse IgG-HRP (Jackson Immunoresearch) antibody was added as a secondary antibody. This was reacted again at 37° C. for 1 hour, and washed three times with PBS containing 0.05% Tween. 100 ⁇ l of TMB substrate (tetramethylbenzidine) was added thereto, followed by additional reaction at room temperature for 5 minutes, the reaction was stopped with 100 ⁇ l of 2 N sulfuric acid solution, and absorbance was measured at a wavelength of 450 nm. As a result, the measured absorbance is shown in FIG. 2, and the EC 50 value of the antibody calculated from the absorbance value is shown in Table 5.
  • TMB substrate tetramethylbenzidine
  • the binding affinity and interaction kinetics of the antibody specifically binding to the ASM protein prepared above with the ASM protein were measured using the Octet ® QK384 system (Pall Life Sciences).
  • a solution in which the ASM protein was diluted was added to an AR2G sensor having an activated carboxy group to obtain an AR2G sensor immobilized with a recombinant human or mouse ASM protein.
  • 1 M ethanolamine (ForteBio) was added to the sensor to which the obtained ASM protein was immobilized to inactivate unreacted residual carboxy groups.
  • the antibody prepared in Example 1 at a concentration of 0.4, 2 or 10 nM was added thereto, and the binding phase of the reaction was observed for about 900 seconds. Then, 1 ⁇ kinetics buffer (ForteBio) was added, and the separated phase of the reaction was observed for about 1,200 seconds.
  • association constant (Kon), dissociation constant (Kdis), and equilibrium dissociation constant (KD) for each antibody were determined using Octet ® analysis software (Pall Life Sciences).
  • Kh association constant
  • Kdis dissociation constant
  • KD equilibrium dissociation constant
  • Example 6 the five types of antibodies prepared in Example 1 bound to the human ASM protein with an avidity of 10 ⁇ 10 to 10 ⁇ 9 M.
  • Table 7 only antibodies #9102, #9104 or #9108 showed binding affinity of 10 -10 to 10 -9 M for mouse ASM protein.
  • the antigenic determinant region which is the region where the antibody according to the present invention binds to the ASM protein, was confirmed by HDX-MS (hydrogen deuterium exchange mass spectrometry).
  • 1,000 ⁇ g/ml of ASM protein 1,000 ⁇ g/ml of #9101 mIgG1, 1,250 ⁇ g/ml of #9102 mIgG2, 1,000 ⁇ g/ml of #9104 mIgG4, 1,000 ⁇ g/ml of #9108 mIgG1, 3,300 ⁇ g/ml of #9113 mIgG1 or 2,932 ⁇ g/ml of #9123 mIgG1 antibody were serially diluted two-fold to a 128-fold dilution.
  • 1 ⁇ l of the prepared dilution was mixed with an equal amount of 10 mg/ml synapinic acid matrix (K200 MALDI kit, CovalX), and 1 ⁇ l of the mixture was dispensed onto a SCOUT 384 MALDI plate and crystallized at room temperature. Then, the crystals were measured using a MALDI mass spectrometer.
  • 1 ⁇ l of a 128-fold dilution was mixed with an equal amount of 2 mg/ml K200 stabilizing solution (K200 stabilizer reagent, K200 MALDI kit, CovalX), , which was reacted at room temperature for 3 hours.
  • the antibody according to the present invention is the 53rd to 72nd amino acid fragment from the N-terminus of the ASM protein (SEQ ID NO: 68: TAINLGLKKEPNVARVGSVA), the 101st to 123rd amino acid fragment (SEQ ID NO: 69: VWRRSVLSPSEACGLLLGSTCGH) , 135 to 159 amino acid fragment (SEQ ID NO: 70: PTVPKPPPKPPSPPAPGAPVSRILF), 135 to 155 amino acid fragment (SEQ ID NO: 71: PTVPKPPPKPPSPPAPGAPVS), 218 to 228 amino acid fragment (SEQ ID NO: 72: SGLGPAGPFDM) or 259 to 269 amino acid fragment ( SEQ ID NO: 73: VRKFLGPVPVY).
  • the antibody according to the present invention mainly bound to ⁇ -helix 1 and ⁇ -helix 2 of the saposin domain.
  • fibroblasts of Alzheimer's patients were treated with the antibody prepared in Example 1 at a concentration of 3 ⁇ g/ml and reacted at 37° C. for 24 hours. Thereafter, the cells were collected, and cell membranes were separated and proteins were extracted using the Mem-PERTM Plus Membrane Protein Extraction Kit (Thermo) according to the manufacturer's protocol. Using the extracted protein as a sample, it was put into an insert for UPLC, and UPLC analysis (Waters, 186004800) was performed in a conventional manner, and the results are shown in FIG. 5 . At this time, as a control, #9105 antibody, which was confirmed not to bind to the ASM protein, was used.
  • UPLC analysis Waters, 186004800
  • antibody #9104 significantly suppressed the increased activity of ASM protein in the cell membrane of Alzheimer's patients.
  • ASM protein activity inhibition rate (%) #9104 #9105 0.03 0 - 0.3 7.9 - 3 16 - 30 21 - 300 28 - 3,000 32 9
  • the #9104 antibody according to the present invention significantly inhibited the activity of the ASM protein located in the cell membrane in a concentration-dependent manner.
  • the #9105 antibody used as a control slightly inhibited the activity of the ASM protein located in the cell membrane only when treated at a concentration of 3,000 ng/ml or more.
  • the content of ceramide present in the cell membrane of fibroblasts of Alzheimer's patients was significantly decreased by the treatment with antibody #9104, but the content of sphingomyelin was not significantly changed.
  • the antibody according to the present invention inhibits the degradation of sphingomyelin by ASM protein.
  • Antibody #9104 was administered to APP/PS1 mice, which are an animal model for Alzheimer's disease, and changes in cognitive memory of the mice were confirmed.
  • 7-month-old APP/PS1 mice were intraperitoneally administered with 324 ⁇ l of #9104 antibody at a dose of 50 mg/kg for 8 weeks. Administration was performed twice a week (3 days apart), and #9104 antibody was administered a total of 16 times (FIG. 8). At this time, the case where no treatment was given to offspring born from the mating of C57BL/6 mice and APP/PS1 mice was used as an untreated control group, and the case where APP/PS1 mice were treated with 324 ⁇ l of PBS was used as a negative control group.
  • a behavioral function test was performed from the 41st day to the last day of antibody #9104 administration, and changes in cognitive memory due to antibody administration were confirmed.
  • mice in the negative control group exhibited an average escape delay time of 30 seconds, resulting in impaired cognitive function, and mice in the untreated control group showed a reduced escape delay time while repeating the test.
  • the group administered with the #9104 antibody showed a 31.5% reduction in escape delay at the 9th round and a 30.8% reduction at the 10th round, compared to the mice of the negative control group.
  • mice administered with #9104 antibody significantly increased the retention time in the target quadrant compared to the retention time in the non-target quadrant. This was similar to the untreated control and differed from the negative control with little difference in retention time in the target and non-target quadrants.
  • FIG. 12C it was confirmed that the number of crossing platforms (crossing platform) significantly increased in the group administered with the #9104 antibody, whereas it decreased in the negative control group.
  • Figures 12A and 12B it was confirmed that the swimming distance and speed were similar in all mouse groups, indicating that the administration of antibody #9104 did not affect exercise capacity.
  • Antibody #9104 was administered at a dose of 50 mg/kg to APP/PS1 mice, which are an animal model for Alzheimer's disease, and changes in cognitive memory of the mice were confirmed. In the experiment, antibody #9104 was administered in the same manner as in Experimental Example 6-1, and a contextual and cued fear conditioning test was performed in a conventional manner, and the results are shown in FIG. 13 .
  • the antibody according to the present invention significantly improved cognitive memory in Alzheimer's animal models.
  • the activity of the ASM protein present in the blood and brain tissue of the animal model in which cognitive memory improvement was confirmed in Experimental Example 6 was confirmed. Specifically, UPLC was performed in the same manner as described in Experimental Example 4-1 by obtaining proteins from blood plasma of mice by a conventional method and using the obtained proteins as samples. As a result, the ASM activity (%) of untreated control mice and #9104-administered mice was calculated based on the ASM protein activity of negative control mice, and the results are shown in FIG. 14 .
  • ELISA analysis was performed to confirm that the suppression of the activity of the ASM protein identified in Experimental Example 7-1 was due to a decrease in the expression level of the protein.
  • the experiment was performed using the blood plasma tissue obtained in Experimental Example 7-1 as a sample and analyzed according to the manufacturer's protocol using a mouse ASM ELISA kit (Mybiosource), and the results are shown in FIG. 15 .
  • the concentration of ASM protein was significantly increased in the mice administered with antibody #9104, rather than in the untreated control group or the negative control group.
  • the antibody according to the present invention significantly inhibits the activity of ASM protein without affecting its concentration.
  • amyloid- ⁇ present in the brain tissue of the animal model confirmed to improve cognitive memory in Experimental Example 6 was Western blotted using tioflavin-S staining and 6E10 antibody, and ELISA analysis was performed as follows. confirmed together.
  • the animal model of Experimental Example 6 was anesthetized with 2.5% avertin, and blood was obtained from the heart using a 1 cc syringe by opening the chest cavity. After obtaining blood, perfusion was performed with 20 ml of PBS, and additional perfusion was performed with 20 to 30 ml of 4% paraformaldehyde (PFA). The brains of the mice were excised, placed in a 4% PFA solution and left overnight, and the tissues were sectioned to a thickness of 30 ⁇ m using a vibratome. After putting the obtained brain tissue slices in a 12-well plate, 1 ml of PBS solution was added and stirred at room temperature at 33 rpm for 5 minutes.
  • PFA paraformaldehyde
  • the PBS solution was removed, and 500 ⁇ l of 0.5% thioflavin-S reagent diluted in ethanol was applied to stain A ⁇ plaques for 10 minutes. Thereafter, the sections were washed twice with 50% ethanol and washed once with 1 ml of PBS solution. Mounting medium (mount media) containing DAPI was added thereto and mounted.
  • the brain tissue sections were placed in a 12-well plate, 1 ml of PBS solution was added, stirred at room temperature at 33 rpm for 5 minutes, and the PBS solution was removed. A PBS solution containing 1 ml of 0.2% Triton X-100 was added thereto and stirred for 1 hour at 33 rpm. After stirring, the PBS solution containing Triton X-100 was removed, and the mixture was pretreated with a PBS solution containing 0.05% Triton X-100 for 1 hour.
  • 6E10 antibody (Biolegend) was mixed with a PBS solution containing 0.05% Triton X-100 in a volume ratio of 1:1 to the pretreated brain tissue slices and added in an amount of 500 ⁇ l. It was stirred and reacted at 4°C overnight, and washed three times with a PBS solution containing Triton X-100. The mouse-488 secondary antibody was treated and reacted for 2 hours at room temperature, followed by washing three times with a PBS solution containing Triton X-100. Mounting medium (mount media) containing DAPI was added thereto and mounted.
  • the brain tissue obtained above was separated into cortex and hippocampus, RIPA buffer containing 100 mM PMSF and 1% protease inhibitor was added, and the tissue was homogenized.
  • the homogenized tissue was centrifuged for 10 minutes at 4°C and 13,000 rpm to obtain a supernatant.
  • the obtained supernatant was further centrifuged for 30 minutes under the same conditions to obtain the supernatant again, and using it as a sample, A ⁇ was tested with the amyloid- ⁇ 40 ELISA kit (KHB3481, invitrogen) and the amyloid- ⁇ 42 ELISA kit (KHB3441, invitrogen). The level of was measured. After that, the obtained results are shown in FIG. 18 .
  • a ⁇ 40 present in the brain cortex and hippocampus was decreased by 30.9% and 30.9%, respectively, by antibody #9104, which was significant compared to the negative control group.
  • a ⁇ 42 was also significantly decreased by administration of the #9104 antibody compared to the negative control.
  • the amount of tau protein present in the brain cortex and hippocampus was significantly reduced by treatment with the #9104 antibody.
  • the antibody according to the present invention has an effect of improving brain neuroinflammation.
  • the toxicity of antibody #9104 was confirmed by the following method.
  • the experiment was conducted while administering #9104 antibody in Experimental Example 6. Specifically, the survival rate was evaluated by visually observing the movement and abnormal signs of the mouse twice a week, and the weight of the mouse was measured once a week on the same day and time. On the other hand, it was confirmed whether organ toxicity by the #9104 antibody was observed by observing the organs by performing autopsy on the mice after administration was completed in a conventional manner. As a result, the survival rate and weight change of mice are shown in FIG. 22, and the result of confirming organ toxicity is shown in FIG. 23.
  • the antibody according to the present invention can be significantly used for the treatment of brain diseases such as Alzheimer's disease without toxicity.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nutrition Science (AREA)
  • Epidemiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Hospice & Palliative Care (AREA)
  • Biochemistry (AREA)
  • Psychiatry (AREA)
  • Mycology (AREA)
  • Zoology (AREA)
  • Physiology (AREA)
  • Microbiology (AREA)
  • Food Science & Technology (AREA)
  • Polymers & Plastics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Coloring Foods And Improving Nutritive Qualities (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 ASM(acid sphingomyelinase) 단백질에 특이적으로 결합하는 항체의 용도에 관한 것이다. 구체적으로, 본 발명에 따른 항체 또는 이의 항원 결합 단편은 ASM 단백질에 특이적으로 높은 결합력으로 결합하고, 세포막에 존재하는 ASM 단백질의 활성을 유의적으로 억제하며, 알츠하이머 동물 모델에서 독성을 나타내지 않으면서 인지 기억력 개선 효과, ASM 단백질 활성 억제 효과, 아밀로이드-β 및 타우 단백질 축적 억제 효과, 및 신경염증 생성 억제 효과를 나타냄으로써, 뇌질환의 치료에 유용하게 사용될 수 있다.

Description

ASM 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 뇌질환 치료용 약학적 조성물
본 발명은 ASM(acid sphingomyelinase) 단백질에 특이적으로 결합하는 항체의 용도에 관한 것이다.
스핑고지질 대사는 정상적인 세포 신호전달을 조절하며, 스핑고지질 대사의 비정상적 변화는 알츠하이머 질환을 포함하는 다양한 신경퇴행성 질환에 영향을 미친다. 스핑고지질 대사를 조절하는 효소인 ASM(acid sphingomyelinase) 단백질은 거의 모든 종류의 세포에서 발현되는 단백질로서, 스핑고지질 대사 및 세포막 턴오버(turnover)에 중요한 역할을 한다.
알츠하이머 질환과 같은 신경퇴행성 질환 환자의 뇌에서는 정상인에 비해 ASM 단백질의 활성이 현저히 증가되어 있다. 이와 관련하여, 대한민국 특허등록 제10-1521117호는 과발현된 ASM 단백질의 활성을 저해하거나, ASM 단백질로의 발현을 억제하면 β-아밀로이드의 축적이 억제되고 학습능력 및 기억력이 개선되어 신경퇴행성 질환을 치료할 수 있음을 개시하고 있다. 또한, 최근 우울증과 같은 신경 질환에서도 ASM 단백질의 활성이 증가되어 있어, 상기 ASM 단백질의 발현 또는 활성을 억제하여 우울증을 개선하는 효과가 있음이 알려졌다.
그러나 ASM 단백질의 발현 또는 활성을 직접 억제하는 물질은 개발되지 않았으며, 다만, ASM 단백질의 발현을 간접적으로 억제하는 몇 종류의 억제제가 동정되었다. 예를 들어, 우울증의 치료에 사용되고 있는 삼환계 항우울제(tricyclic antidepressant)가 있으며, 여기에는 아미트리프틸린(amitriptyline), 데시프라민(desipramine), 미프라민(mipramine) 등이 포함된다. 이들 삼환계 항우울제는 ASM 단백질 억제제로서 개발된 것은 아니나, 다양한 연구결과에 의해 ASM 단백질 억제 효과를 나타내는 것이 증명되었다. 삼환계 항우울제의 주요 약리기전은 신경세포에서 신경전달물질의 재흡수를 억제하여 이들의 활성을 증가시키는 것이며, ASM 억제제로서의 작용은 부수적인 작용으로 확인되었다. 그러나, 삼환계 항우울제는 신경계 및 신경세포에 작용하여 시야흐림, 빛 감수성 증가, 구토 등의 부작용을 유발할 수 있다.
본 발명의 목적은 ASM 단백질에 특이적으로 결합하는 항체의 용도를 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 ASM(acid sphingomyelinase) 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 뇌질환 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 뇌질환 예방 또는 개선용 건강기능식품을 제공한다.
또한, 본 발명은 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 개체에 투여하는 단계를 포함하는 뇌질환 예방, 개선 또는 치료방법을 제공한다.
나아가, 본 발명은 뇌질환의 예방, 개선 또는 치료를 위한 약제의 제조에 사용하기 위한 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편의 용도를 제공한다.
본 발명에 따른 항체 또는 이의 항원 결합 단편은 ASM 단백질에 특이적으로 높은 결합력으로 결합하고, 세포막에 존재하는 ASM 단백질의 활성을 유의적으로 억제하며, 알츠하이머 동물 모델에서 독성을 나타내지 않으면서 인지 기억력 개선 효과, ASM 단백질 활성 억제 효과, 아밀로이드-β 및 타우 단백질 축적 억제 효과, 및 신경염증 생성 억제 효과를 나타냄으로써, 뇌질환의 치료에 유용하게 사용될 수 있다.
도 1은 본 발명의 일 실시예에서 제조된 항체의 중쇄 및 경쇄 가변영역 아미노산 서열을 나타내는 모식도이다.
도 2는 본 발명의 일 실시예에서 제조된 항체의 ASM 단백질과의 결합을 ELISA 분석 방법으로 확인한 결과 그래프이다.
도 3은 본 발명의 일 실시예에서 제조된 항체가 결합하는 항원 결합 부위를 ASM 단백질 구조 모델에 표시한 모식도이다.
도 4는 본 발명의 일 실시예에서 제조된 항체에 의한 ASM 단백질 사포신(saposin) 도메인에서의 중수소 치환 히트맵을 나타낸 결과 도면이다.
도 5는 본 발명의 일 실시예에서 제조된 항체의 알츠하이머 환자 세포막에 위치하는 ASM 단백질의 활성 억제를 확인한 결과 그래프이다.
도 6은 본 발명의 일 실시예에서 제조된 항체가 알츠하이머 환자 세포막에 위치하는 ASM 단백질의 활성을 농도 의존적으로 억제하는 것을 확인한 결과 그래프이다.
도 7은 본 발명의 일 실시예에서 제조된 항체의 알츠하이머 환자 세포막에서 스핑고미엘린의 대사 변화를 확인한 결과 그래프이다.
도 8은 본 발명의 일 실시예에서 제조된 항체를 알츠하이머 동물 모델에 투여하는 것을 나타내는 모식도이다.
도 9는 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 수중 미로 실험을 수행한 결과 그래프이다.
도 10은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 수영 경로를 확인한 결과 도면이다.
도 11은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델이 표적(A0) 또는 비-표적(A1, A2, A3) 사분면에 머무르는 시간을 확인한 결과 그래프이다.
도 12는 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 수영 거리(A), 수영 속도(B) 및 플랫폼이 있던 위치를 지나가는 횟수(C)를 확인한 결과 그래프이다.
도 13은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 상황(A) 또는 분위기(B)에 따른 공포 조건 테스트를 수행한 결과 그래프이다.
도 14는 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 혈액 플라즈마에서 ASM의 활성 억제를 확인한 결과 그래프이다.
도 15는 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 혈액 플라즈마에서 ASM 단백질의 수준을 확인한 결과 그래프이다.
도 16은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 뇌 피질 또는 해마에서 고밀도(dense-core) 아밀로이드-β 플라크의 발현을 확인한 결과이다.
도 17은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 뇌 피질 또는 해마에서 고밀도 및 확산형(diffuse) 아밀로이드-β 플라크의 발현을 확인한 결과이다.
도 18은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 뇌 피질 또는 해마에서 아밀로이드-β40 또는 아밀로이드-β42의 발현을 확인한 결과 그래프이다.
도 19는 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 뇌 피질 또는 해마에서 타우 단백질의 발현을 확인한 결과이다.
도 20은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 뇌 피질 또는 해마에서 lba-1 단백질의 발현을 확인한 결과이다.
도 21은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 뇌 피질 또는 해마에서 GFAP 단백질의 발현을 확인한 결과이다.
도 22는 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 생존율(A) 및 체중 변화(B)를 확인한 결과 그래프이다.
도 23은 본 발명의 일 실시예에서 제조된 항체를 투여한 알츠하이머 동물 모델의 장기독성을 확인한 도면이다.
이하, 본 발명을 상세히 설명한다.
본 발명은 ASM(acid sphingomyelinase) 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 뇌질환 예방 또는 치료용 약학적 조성물을 제공한다.
본 명세서에서 사용된 용어, 'ASM(acid sphingomyelinase) 단백질'은 스핑고지질 대사를 조절하는 SMase(sphingomyelinase) 패밀리 중 하나인 효소를 의미한다. 상기 ASM 단백질은 스핑고미엘린(sphingomyelin)을 세라마이드(ceramide) 및 포스포릴콜린(phosphorylcholine)으로 분해하는 과정을 촉매하며, 최적의 효소 활성을 나타내는 pH에 따라 알칼리성, 중성 또는 산성으로 구분할 수 있다.
상기 ASM 단백질은 통상의 기술분야에 알려진 모든 종류의 ASM 단백질을 포함할 수 있다. 구체적으로, 상기 ASM 단백질은 포유동물 유래일 수 있고, 더욱 구체적으로는 인간, 원숭이, 랫트 또는 마우스 유래일 수 있다. 또한, 상기 ASM 단백질은 통상의 기술분야에 ASM 단백질로 알려진 모든 아미노산 서열을 포함할 수 있다. 일례로, 상기 ASM 단백질은 서열번호 66 및 67로 각각 기재된 아미노산 서열로 구성되는 폴리펩티드 또는 이를 암호화하는 핵산일 수 있다.
상기 ASM 단백질은 이와 동일하거나 이에 상응하는 생물학적 활성을 유지하는 한, 서열번호 66 또는 67로 기재된 아미노산 서열에서 하나 또는 그 이상의 아미노산이 첨가, 결실 또는 치환된 것일 수 있다. 이때, 아미노산의 치환은 전체 단백질의 전하, 즉, 극성 또는 소수성에 영향을 주지 않거나 약하게 주는 범위 내에서 수행되는 보존적 치환일 수 있다. 또한, 상기 ASM 단백질은 서열번호 66 및 67로 각각 기재된 아미노산 서열과 80% 이상, 90% 이상, 95% 이상, 97% 이상 또는 99% 이상의 상동성을 가질 수 있다. 또한, 상기 ASM 단백질은 이와 동일하거나 이에 상응하는 생물학적 활성을 유지하는 한, ASM 단백질의 일부만을 포함할 수 있다.
본 명세서에 사용된 용어, '항체(antibody)'는 항원과 결합하여 항원의 작용을 방해하거나, 항원을 제거하는 면역 단백질을 의미한다. 상기 항체는 통상의 기술분야에 포함되는 모든 종류의 항체를 포함할 수 있다. 구체적으로, 상기 항체는 IgM, IgD, IgG, IgA 및 IgE를 포함할 수 있으며, 이들 각각은 중쇄 불변영역을 암호화하는 유전자인 μ, δ, γ, α 및 ε으로부터 만들어진 중쇄를 포함할 수 있다. 통상적으로 항체기술에서는 주로 IgG가 사용되는데, 이는 다시 IgG1, IgG2, IgG3 또는 IgG4의 동종(isotype)으로 구성되며, 이들 각각의 구조 및 기능적 특성은 상이할 수 있다. 상기 항체는 비-인간 항체로부터 유래된 최소 서열을 포함하는 인간화 항체, 인간으로부터 유래된 서열로 구성된 인간 항체, 또는 서로 다른 종으로부터 유래된 서열이 혼합된 키메라 항체를 모두 포함할 수 있다.
상기 IgG는 약 50 kDa의 중쇄(heavy chain) 단백질 2개와 약 25 kDa의 경쇄(light chain) 단백질 2개로 만들어진 Y자 모양의 매우 안정된 구조(약 150 kDa)를 형성할 수 있다. 항체를 구성하는 경쇄 및 중쇄는 항체 사이에서 아미노산 서열이 다른 가변영역(variable region) 및 아미노산 서열이 같은 불변영역(constant region)으로 나뉠 수 있다. 이때, 중쇄 불변영역은 CH1, 힌지(hinge, H), CH2 및 CH3 도메인을 포함하며, 각 도메인은 두 개의 β-시트(β-sheet)로 구성되고, 분자 내 이황화결합(disulfide bond)으로 연결될 수 있다. 또한, 경쇄 불변영역은 CL 도메인을 포함할 수 있다. 한편, 중쇄 및 경쇄의 가변영역 두 개가 합쳐져 항원 결합 부위(antigen binding site)가 형성되며, 상기 항원 결합 부위는 Y자 모양의 두 개의 팔에 각각 한 개씩 존재할 수 있다. 전장의 항체에서 항원과 결합할 수 있는 부분을 Fab(antibody binding fragment), 항원과 결합하지 못하는 부분을 Fc(crystallizable fragment)라고 하며, Fab 및 Fc는 힌지로 연결될 수 있다. 본 발명의 일 실시예에서, 상기 IgG는 마우스 유래의 IgG일 수 있고, 구체적으로 서열번호 74로 기재된 아미노산 서열로 구성되는 마우스 IgG 중쇄 불변 영역 및 서열번호 서열번호 76으로 기재된 아미노산 서열로 구성되는 마우스 경쇄 λ 불변 영역을 포함할 수 있다. 또한, 상기 마우스 유래의 IgG는 서열번호 75로 기재된 염기서열로 구성되는 마우스 IgG 중쇄 불변 영역 및 서열번호 77로 기재된 염기서열로 구성되는 마우스 경쇄 λ 불변 영역을 포함할 수 있다.
본 발명에 따른 항체는 전장의 항체뿐 아니라 이의 항원 결합 단편을 모두 포함할 수 있다. 구체적으로, 상기 항원 결합 단편은 항원과의 결합 자극을 세포나 보체 등에 전달하는 기능을 하는 Fc를 제외한 부분을 의미할 수 있다. 일례로, 항체의 항원 결합 단편은 Fab, scFv, F(ab)2 및 Fv를 모두 포함할 수 있고, 단일 도메인 항체(single domain antibody)나 소형 항체(minibody) 등과 같은 3세대 항체 절편도 포함할 수 있다.
본 발명의 일 측면에서, 상기 항체 또는 항원 결합 단편은 ASM 단백질의 N-말단으로부터 53 내지 72번째 아미노산 단편, 101 내지 123번째 아미노산 단편, 135 내지 159번째 아미노산 단편, 135 내지 155번째 아미노산 단편, 218 내지 228번째 아미노산 단편 및 259 내지 269번째 아미노산 단편으로 구성된 군으로부터 선택되는 어느 하나 이상의 에피토프에 결합할 수 있다. 이때, 상기 ASM 단백질은 상술한 바와 같은 특징을 가질 수 있다. 본 발명의 일 실시예에서, 상기 ASM 단백질의 N-말단으로부터 53 내지 72번째 아미노산 단편은 서열번호 68(TAINLGLKKEPNVARVGSVA)로 기재된 아미노산 서열로 구성되는 폴리펩티드일 수 있고, 101 내지 123번째 아미노산 단편은 서열번호 69(VWRRSVLSPSEACGLLLGSTCGH)로 기재된 아미노산 서열로 구성되는 폴리펩티드일 수 있으며, 135 내지 159번째 아미노산 단편은 서열번호 70(PTVPKPPPKPPSPPAPGAPVSRILF)으로 기재된 아미노산 서열로 구성되는 폴리펩티드일 수 있고, 135 내지 155번째 아미노산 단편은 서열번호 71(PTVPKPPPKPPSPPAPGAPVS)로 기재된 아미노산 서열로 구성되는 폴리펩티드일 수 있으며, 218 내지 228번째 아미노산 단편은 서열번호 72(SGLGPAGPFDM)로 기재된 아미노산 서열로 구성되는 폴리펩티드일 수 있고, 259 내지 269번째 아미노산 단편은 서열번호 73(VRKFLGPVPVY)으로 기재된 아미노산 서열로 구성되는 폴리펩티드일 수 있다. 즉, 본 발명의 다른 측면에서, 상기 항체 또는 항원 결합 단편은 서열번호 68 내지 73으로 각각 기재된 폴리펩티드로 구성된 군으로부터 선택되는 어느 하나 이상의 에피토프에 결합할 수 있다.
상기 용어, "에피토프(epitope)"는 항체가 항원을 식별할 수 있는 항원의 특정 부위로서, 항체가 특이적으로 결합할 수 있는 항원의 결정부위를 의미한다. 상기 에피토프는 항원 결정 부위(determinant, antigenic determinant)라는 용어와 동일한 의미로 통용된다. 상기 에피토프는 화학적으로 활성을 갖는 표면 분자군, 예를 들어 아미노산 또는 당 측쇄로 구성되며, 일반적으로 특정한 3차원의 구조적 특징뿐 아니라 특정한 전하 특성을 갖는다.
본 발명의 일 측면에서, 상기 항체 또는 이의 항원 결합 단편은 서열번호 61로 기재된 아미노산 서열로 구성되는 중쇄 CDR1(X1YX2MS), 서열번호 62로 기재된 아미노산 서열로 구성되는 중쇄 CDR2(X3IX4X5X6X7X8X9X10YYADSVKG), 및 서열번호 27, 30, 33, 36, 39 및 42로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 중쇄 CDR3을 포함하는 중쇄 가변영역; 및 서열번호 63으로 기재된 아미노산 서열로 구성되는 경쇄 CDR1(X11GSSSNIGX12NX13VX14), 서열번호 64로 기재된 아미노산 서열로 구성되는 경쇄 CDR2(X15X16X17X18RPS), 및 서열번호 65로 기재된 아미노산 서열로 구성되는 경쇄 CDR3(X19X20WDX21SLX22X23YV)을 포함하는 경쇄 가변영역을 포함할 수 있다.
상기 용어, 'CDR(complementarity determining region)'은 항체의 중쇄 및 경쇄 가변영역 내에 항체마다 다른 아미노산 서열을 갖는 부위인 초가변영역(hypervariable region)으로, 실제로 항원과 결합하는 부위를 의미한다. 항체의 입체구조에서 CDR은 고리(loop) 모양으로 항체의 표면에 위치하고, 고리 아래에는 이를 구조적으로 지지해주는 FR(framework region)이 존재할 수 있다. 중쇄 및 경쇄는 모두 각각 세 개씩 고리 구조가 존재하며, 이들 여섯 개의 고리 구조가 합쳐져서 항원과 직접 접촉할 수 있다. 상기 여섯 개의 고리 구조를 갖는 항원 결합 부위인 CDR을 각각 편의상 중쇄 CDR1, 중쇄 CDR2, 중쇄 CDR3, 경쇄 CDR1, 경쇄 CDR2 또는 경쇄 CDR3로 지칭할 수 있다.
일례로, 상기 서열번호 61로 기재된 아미노산 서열로 구성되는 중쇄 CDR1(X1YX2MS)에서 X1 및 X2는 각각 산성 및 중성 아미노산에서 선택될 수 있다. 구체적으로, 상기 X1은 산성 또는 중성 아미노산일 수 있고, X2는 중성 아미노산일 수 있다. 예를 들어, 상기 X1 및 X2는 각각 아스파라긴(asparagine, Asn), 글리신(glycine, Gly), 세린(serine, Ser), 아스파르트산(aspartic acid, Asp), 알라닌(alanine, Ala) 및 티로신(tyrosine, Tyr)으로 구성된 군으로부터 선택될 수 있다. 구체적으로, 상기 X1은 아스파라긴, 글리신, 세린 또는 아스파르트산일 수 있고, X2는 알라닌 또는 티로신일 수 있다. 본 발명의 일 실시예에서, 상기 중쇄 CDR1은 서열번호 25, 28, 31, 34, 37 또는 40으로 기재된 아미노산 서열로 구성될 수 있다.
또한, 상기 서열번호 62로 기재된 아미노산 서열로 구성되는 중쇄 CDR2(X3IX4X5X6X7X8X9X10YYADSVKG)에서 X3 내지 X10은 각각 중성 및 염기성 아미노산에서 선택될 수 있다. 구체적으로, 상기 X3 및 X4 내지 X9는 각각 중성 아미노산일 수 있고, X10은 중성 또는 염기성 아미노산일 수 있다. 예를 들어, 상기 X3 내지 X10은 각각 글리신, 류신(leucine, Leu), 알라닌, 세린, 티로신, 프롤린(proline, Pro), 아스파라긴, 리신(lysine, Lys) 및 이소류신(isoleucine, Ile)으로 구성된 군으로부터 선택될 수 있다. 구체적으로, 상기 X3는 글리신, 류신, 알라닌 또는 세린일 수 있고, X4는 티로신 또는 세린일 수 있으며, X5는 프롤린 또는 티로신일 수 있고, X6은 아스파라긴 또는 글리신일 수 있으며, X7 및 X8은 각각 글리신 또는 세린일 수 있고, X9는 아스파라긴 또는 세린일 수 있으며, X10은 리신 또는 이소류신일 수 있다. 본 발명의 일 실시예에서, 상기 중쇄 CDR2는 서열번호 26, 29, 32, 35, 38 또는 41로 기재된 아미노산 서열로 구성될 수 있다.
또한, 상기 서열번호 63으로 기재된 아미노산 서열로 구성되는 경쇄 CDR1(X11GSSSNIGX12NX13VX14)에서 X11 내지 X14는 각각 중성 아미노산에서 선택될 수 있다. 예를 들어, 상기 X11 내지 X14는 각각 트레오닌(threonine, Thr), 세린, 아스파라긴, 알라닌, 프롤린 및 티로신으로 구성된 군으로부터 선택될 수 있다. 구체적으로, 상기 X11은 트레오닌 또는 세린일 수 있고, X12는 아스파라긴 또는 세린일 수 있으며, X13은 알라닌, 프롤린, 트레오닌 또는 티로신일 수 있고, X14는 아스파라긴, 티로신 또는 세린일 수 있다. 본 발명의 일 실시예에서, 상기 경쇄 CDR1은 서열번호 43, 46, 49, 52, 55 또는 58로 기재된 아미노산 서열로 구성될 수 있다.
또한, 상기 서열번호 64로 기재된 아미노산 서열로 구성되는 경쇄 CDR2(X15X16X17X18RPS)에서 X15 내지 X18은 각각 산성, 염기성 및 중성 아미노산에서 선택될 수 있다. 구체적으로, 상기 X15 및 X16은 각각 산성 또는 중성 아미노산일 수 있고, X17은 중성 아미노산일 수 있으며, X18은 염기성 또는 중성 아미노산일 수 있다. 예를 들어, 상기 X15 내지 X18은 각각 티로신, 알라닌, 아스파르트산, 세린, 아스파라긴, 히스티딘(histidine, His), 글루타민(glutamine, Gln) 및 리신으로 구성된 군으로부터 선택될 수 있다. 구체적으로, X15는 티로신, 알라닌, 아스파르트산 또는 세린일 수 있고, X16는 아스파르트산 또는 아스파라긴일 수 있으며, X17은 세린 또는 아스파라긴일 수 있고, X18은 히스티딘, 글루타민 또는 리신일 수 있다. 본 발명의 일 실시예에서 상기 경쇄 CDR2는 서열번호 44, 47, 50, 53, 56 또는 59로 기재된 아미노산 서열로 구성될 수 있다.
또한, 상기 서열번호 65로 기재된 아미노산 서열로 구성되는 경쇄 CDR3(X19X20WDX21SLX22X23YV)에서 X19 내지 X23은 각각 중성 아미노산에서 선택될 수 있다. 예를 들어, 상기 X19 내지 X23은 글리신, 알라닌, 세린, 트레오닌, 티로신, 아스파르트산 및 아스파라긴으로 구성된 군으로부터 선택될 수 있다. 구체적으로, X19는 글리신 또는 알라닌일 수 있고, X20은 알라닌, 세린 또는 트레오닌일 수 있으며, X21은 티로신, 세린, 알라닌 또는 아스파르트산일 수 있고, X22는 세린 또는 아스파라긴일 수 있으며, X23은 알라닌 또는 글리신일 수 있다. 본 발명의 일 실시예에서, 상기 경쇄 CDR3는 서열번호 45, 48, 51, 54, 57 또는 60으로 기재된 아미노산 서열로 구성될 수 있다.
본 발명의 다른 측면에서, 상기 항체 또는 이의 항원 결합 단편은 서열번호 25, 28, 31, 34, 37 및 40으로 기재된 아미노산 서열로 구성된 군으로부터 선택되는 중쇄 CDR1, 서열번호 26, 29, 32, 35, 38 및 41로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 중쇄 CDR2, 및 서열번호 27, 30, 33, 36, 39 및 42로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 중쇄 CDR3을 포함하는 중쇄 가변영역; 및 서열번호 43, 46, 49, 52, 55 및 58로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 경쇄 CDR1, 서열번호 44, 47, 50, 53, 56 및 59로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 경쇄 CDR2, 및 서열번호 45, 48, 51, 54, 57 및 60으로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 경쇄 CDR3을 포함하는 경쇄 가변영역을 포함할 수 있다.
또한, 상기 항체 또는 이의 항원 결합 단편은 서열번호 25, 26 및 27로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 서열번호 28, 29 및 30으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 서열번호 31, 32 및 33으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 서열번호 34, 35 및 36으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 서열번호 37, 38 및 39로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 40, 41 및 42로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역으로 구성된 군에서 선택되는 중쇄 가변영역; 및 서열번호 43, 44 및 45로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역, 서열번호 46, 47 및 48로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역, 서열번호 49, 50 및 51로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역, 서열번호 52, 53 및 54로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역, 서열번호 55, 56 및 57로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역, 및 서열번호 58, 59 및 60으로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역으로 구성된 군에서 선택되는 경쇄 가변영역을 포함할 수 있다.
나아가, 상기 항체 또는 이의 항원 결합 단편은 서열번호 25, 26 및 27로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 43, 44 및 45로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역; 서열번호 28, 29 및 30으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 46, 47 및 48로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역; 서열번호 31, 32 및 33으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 49, 50 및 51로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역; 서열번호 34, 35 및 36으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 52, 53 및 54로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역; 서열번호 37, 38 및 39로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 55, 56 및 57로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역; 또는 서열번호 40, 41 및 42로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 58, 59 및 60으로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역을 포함할 수 있다.
일례로, 상기 중쇄 가변영역은 서열번호 1, 3, 5, 7, 9 또는 11로 기재된 아미노산 서열로 구성되는 폴리펩티드일 수 있고, 상기 경쇄 가변영역은 서열번호 13, 15, 17, 19, 21 또는 23으로 기재된 아미노산 서열로 구성되는 폴리펩티드일 수 있다.
또한, 본 발명에 따른 항체 또는 이의 항원 결합 단편은 필요에 따라 변형된 것일 수 있다. 구체적으로, 상기 항체 또는 이의 항원 결합 단편은 접합(conjugation), 당화(glycosylation), 표지 부착 또는 이들의 조합으로 변형될 수 있다. 구체적으로, 상기 항체 또는 이의 항원 결합 단편은 HRP(horseradish peroxidase), 알칼린 포스파타아제, 햅텐(hapten), 비오틴, 스트렙타비딘, 형광 물질, 방사성 물질, 양자점, PEG(polyethylene glycol), 히스티딘 표지 등으로 변형될 수 있다. 뿐만 아니라, 상기 항체 또는 이의 항원 결합 단편은 필요에 따라 다른 약물이 접합될 수도 있다.
상기 항체 또는 이의 항원 결합 단편은 통상의 기술분야에 알려진 단일클론항체 제조 방법에 따라 제조될 수 있고, 상기 제조 방법은 통상의 기술자에 의해 적절히 변형될 수 있다. 일례로, 상기 항체는 항원으로 면역화된 동물로부터 수득된 B 림프구를 사용하여 하이브리도마를 제조함으로써 제조되거나, 파지 디스플레이 기술을 이용하여 제조될 수 있다.
본 발명의 다른 측면에서, 본 발명에 따른 약학적 조성물에 포함되는 항체 또는 이의 항원 결합 단편은, 상기 항체 또는 이의 항원 결합 단편을 암호화하는 핵산을 포함할 수 있다. 상기 항체 또는 이의 항원 결합 단편을 구성하는 아미노산 서열이 공지된 바, 이를 암호화하는 핵산 서열 또한 통상의 기술자에게 자명하다. 또한, 상기 핵산 서열은 이로부터 번역되는 항체 또는 이의 항원 결합 단편의 활성을 유지하는 한, 하나 또는 그 이상의 염기가 첨가, 결실 또는 치환된 것일 수 있다.
본 발명의 또 다른 측면에서, 본 발명에 따른 약학적 조성물은 상기 항체 또는 이의 항원 결합 단편을 암호화하는 핵산을 포함하는 발현벡터를 포함할 수 있다. 상기 용어, '발현벡터(expression vector)'는 숙주세포에서 목적 유전자를 발현시키기 위한 수단으로 플라스미드 벡터, 코스미드 백터, 박테리오파지 벡터, 바이러스 벡터 등을 모두 포함할 수 있다. 상기 발현벡터는 이에 포함되는 핵산으로부터 펩티드를 생성하기 위해 필요한 요소를 포함할 수 있다. 구체적으로, 상기 발현벡터는 신호서열, 복제기점, 마커 유전자, 프로모터, 전사 종결 서열 등을 포함할 수 있다. 이때, 본 발명에 따른 항체 또는 이의 항원 결합 단편이 암호화된 핵산은 프로모터와 작동적으로 연결될 수 있다.
일례로, 원핵세포에 사용되는 발현벡터는 전사를 진행시키는 프로모터, 해독의 개시를 위한 라이보좀 결합 자리, 및 전사와 해독의 종결서열을 포함할 수 있다. 한편, 진핵세포에 사용되는 발현벡터는 포유동물 또는 포유동물 바이러스로부터 유래된 프로모터 및 폴리아데닐화 서열을 포함할 수 있다.
또한, 상기 발현벡터에 포함되는 마커 유전자로는 통상의 기술분야에 알려진 것을 모두 사용할 수 있으며, 구체적으로 항생제 내성 유전자일 수 있다. 구체적으로, 상기 항생제 내성 유전자는 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 네오마이신, 테트라사이클린 등을 포함하는 항생제에 대해 내성을 나타내는 유전자일 수 있다.
본 발명의 또 다른 측면에서, 본 발명에 따른 약학적 조성물은 상기 서술한 바와 같은 핵산 또는 발현벡터를 포함하는 숙주세포를 유효성분으로 포함할 수 있다. 상기 숙주세포는 통상의 기술분야에 항체 또는 이의 항원 결합 단편을 생산하기 위해 사용될 수 있다고 알려진 모든 종류의 세포를 사용할 수 있다. 구체적으로, 상기 숙주세포는 원핵세포, 효모 또는 진핵세포일 수 있다. 상기 원핵세포는 대장균(E. coli), 바실러스 속 균주, 스트렙토마이세스 속 균주, 슈도모나스 속 균주, 스타필로코쿠스 속 균주 등을 포함할 수 있고, 상기 효모는 사카로마이세스 세레비지애 등을 포함할 수 있다. 한편, 상기 진핵세포는 COS-7, BHK, CHO, CHOK1, DXB-11, DG-44, CHO/-DHFR, CV1, HEK293, TM4, VERO, HELA, MDCK, BRL 3A, W138, Hep G2, SK-Hep, MMT, TRI, MRC 5, FS4, 3T3, RIN, A549, PC12, K562, PERC6, SP2/0, NS-0, U20S 및 HT1080 등을 포함할 수 있다.
또한, 상기 숙주세포는 통상의 기술분야에 알려진 방법에 따라 상술한 바와 같은 핵산 또는 발현벡터가 형질주입된 것일 수 있다. 구체적으로, 상기 형질주입은 일시적 형질감염(transient transfection), 미세주사, 형질도입(transduction), 세포융합, 칼슘 포스페이트 침전법, 리포좀 매개 형질감염(liposome-mediated transfection), DEAE 덱스트란-매개 형질감염(DEAE dextran-mediated transfection), 폴리브렌-매개 형질감염(polybrene-mediated transfection), 전기침공법, 유전자 총(gene gun) 등의 방법으로 수행될 수 있다. 또한, 상기 방법은 통상의 기술자에 의해 적절히 변형될 수 있다.
상기 뇌질환은 통상의 기술분야에 알려진 모든 종류의 뇌질환을 포함할 수 있고, 구체적으로 상기 뇌질환은 퇴행성 뇌질환일 수 있다. 일례로, 상기 퇴행성 뇌질환은 아밀로이드-β의 발현 또는 응집 수준이 정상보다 높거나 높을 위험이 있는 질환일 수 있다. 예를 들어, 상기 퇴행성 뇌질환은 치매, 알츠하이머병, 파킨슨병, 헌팅턴병, 경도인지장애, 대뇌 아밀로이드 맥관병증, 다운증후군, 아밀로이드성 뇌졸증, 전신성 아밀로이드병, 더취(Dutch)형 아밀로이드증, 니만-픽병, 노인성 치매, 근위축성 측삭 경화증(amyotrophic lateral sclerosis), 척수소뇌성 운동실조증(spinocerebellar atrophy), 뚜렛 증후군(Tourette's syndrome), 프리드리히 보행실조(Friedrich's Ataxia), 마차도-조셉병(Machado-Joseph's disease), 루이소체 치매, 근육긴장이상(dystonia), 진행성 핵상 마비(progressive supranuclear palsy) 또는 전두측두엽 치매일 수 있다.
본 발명에 따른 약학적 조성물은 조성물 전체 중량에 대하여 유효성분인 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 10 내지 95 중량%로 포함할 수 있다. 또한, 본 발명의 약학적 조성물은 상기 유효성분 이외에 추가로 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 추가로 포함할 수 있다.
본 발명의 약학적 조성물은 생물학적 제제에 통상적으로 사용되는 담체, 희석제, 부형제 또는 이의 혼합물을 포함할 수 있다. 약학적으로 허용가능한 담체는 조성물을 생체 내에 전달하는데 적합한 것이면 모두 사용할 수 있다. 구체적으로, 상기 담체는 Merck Index, 13th ed., Merck & Co. Inc.에 기재된 화합물, 식염수, 멸균수, 링거액, 덱스트로스 용액, 말토덱스트린 용액, 글리세롤, 에탄올 또는 이의 혼합물일 수 있다. 또한, 필요에 따라 항산화제, 완충액, 정균제 등과 같은 통상의 첨가제를 첨가할 수 있다.
상기 조성물을 제제화하는 경우, 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 첨가할 수 있다.
본 발명의 조성물은 경구용 제제 또는 비경구용 제제로 제형화될 수 있다. 경구용 제제로는 고형 제제 및 액상 제제가 포함될 수 있다. 상기 고형 제제는 정제, 환제, 산제, 과립제, 캡슐제 또는 트로키제일 수 있고, 이러한 고형 제제는 상기 조성물에 적어도 하나 이상의 부형제를 첨가하여 조제할 수 있다. 상기 부형제는 전분, 탄산칼슘, 수크로스, 락토오스, 젤라틴 또는 이의 혼합물일 수 있다. 또한, 상기 고형 제제는 윤활제를 포함할 수 있고, 그 예로는 마그네슘 스티레이트, 탈크 등이 있다. 한편, 상기 액상 제제는 현탁제, 내용액제, 유제 또는 시럽제일 수 있다. 이때, 상기 액상 제제에는 습윤제, 감미제, 방향제, 보존제 등과 같은 부형제가 포함될 수 있다.
상기 비경구용 제제는 주사제, 좌제, 호흡기 흡입용 분말, 스프레이용 에어로졸제, 파우더 및 크림 등을 포함할 수 있다. 상기 주사제는 멸균된 수용액, 비수성용제, 현탁용제, 유제 등을 포함할 수 있다. 이때, 비수성용제 또는 현탁용제로서는 프로필렌글리콜, 폴리에틸렌글리콜, 올리브 오일과 같은 식물성 기름이나, 에틸올레이트와 같이 주사가능한 에스테르 등이 사용될 수 있다.
또한, 본 발명은 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 뇌질환 예방 또는 개선용 건강기능식품을 제공한다.
본 발명에 따른 건강기능식품에 유효성분으로 포함되는 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편은 상기 서술한 바와 같은 특징을 가질 수 있다.
본 발명의 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편은 식품에 그대로 첨가하거나, 다른 식품 또는 식품 성분과 함께 사용될 수 있다. 이때, 첨가되는 유효성분의 함량은 목적에 따라 결정될 수 있고, 일반적으로는 전체 식품 중량의 0.01 내지 90 중량부일 수 있다.
건강기능식품의 형태 및 종류는 특별히 제한되지 않는다. 구체적으로, 상기 건강기능식품은 정제, 캅셀, 분말, 과립, 액상 및 환의 형태일 수 있다. 상기 건강기능식품은 추가성분으로서 여러 가지 향미제, 감미제 또는 천연 탄수화물을 포함할 수 있다. 상기 감미제는 천연 또는 합성 감미제일 수 있고, 천연 감미제의 예로는 타우마틴, 스테비아 추출물 등이 있다. 한편, 합성 감미제의 예로는 사카린, 아스파르탐 등이 있다. 또한, 상기 천연 탄수화물은 모노사카라이드, 디사카라이드, 폴리사카라이드, 올리고당 및 당알코올 등일 수 있다.
본 발명의 건강기능식품은 상기 서술한 추가성분 외에, 영양제, 비타민, 전해질, 풍미제, 착색제, 펙스탄 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알코올 등을 더 포함할 수 있다. 이러한 성분은 독립적으로 또는 조합으로 사용될 수 있다. 상기 첨가제의 비율은 본 발명의 조성물의 100 중량부당 0.01 내지 0.1 중량부의 범위에서 선택될 수 있다.
또한, 본 발명은 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 개체에 투여하는 단계를 포함하는 뇌질환 예방, 개선 또는 치료방법을 제공한다.
본 발명에 따른 뇌질환 예방, 개선 또는 치료방법에 사용되는 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편은 상기 서술한 바와 같은 특징을 가질 수 있다.
상기 개체는 포유동물일 수 있고, 구체적으로 인간일 수 있다.
상기 투여는 목적하는 방법에 따라 경구 또는 비경구로 투여될 수 있다. 비경구 투여는 복강내, 직장내, 피하, 정맥, 근육내 또는 흉부내 주사 방식을 포함할 수 있다.
또한, 상기 투여는 약학적으로 유효한 양으로 투여될 수 있다. 이는 질환의 종류, 중증도, 약물의 활성, 약물에 대한 환자의 민감도, 투여 시간, 투여 경로, 치료기간, 동시에 사용되는 약물 등에 따라 달라질 수 있다. 그러나, 바람직한 효과를 위해서, 본 발명에 따른 약학적 조성물에 포함되는 유효성분의 양은 0.0001 내지 1,000 ㎎/㎏, 구체적으로 0.001 내지 500 ㎎/㎏일 수 있다. 상기 투여는 하루에 1회 또는 수회일 수 있다.
상기 투여는 단독 또는 다른 치료제와 병용하여 투여될 수 있다. 병용 투여 시, 투여는 순차적 또는 동시일 수 있다.
나아가, 본 발명은 뇌질환의 예방, 개선 또는 치료를 위한 약제의 제조에 사용하기 위한 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편의 용도를 제공한다.
본 발명에 따른 뇌질환의 예방, 개선 또는 치료를 위한 약제의 제조에 사용되는 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편은 상기 서술한 바와 같은 특징을 가질 수 있다.
이하, 본 발명을 하기 실시예에 의해 상세히 설명한다, 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐, 이들에 의해 본 발명이 제한되는 것은 아니다. 본 발명의 청구범위에 기재된 기술적 사상과 실질적으로 동일한 구성을 갖고 동일한 작용 효과를 이루는 것은 어떠한 것이라도 본 발명의 기술적 범위에 포함된다.
실시예 1. ASM(acid sphingomyelinase) 단백질에 특이적으로 결합하는 항체의 제작
인간 ASM 단백질(서열번호 66) 및 마우스 ASM 단백질(서열번호 67)에 특이적으로 결합하는 항체를 다음과 같은 방법으로 제작하였다.
구체적으로, 재조합 인간 및 마우스 ASM 단백질, 및 인간 합성 scFv-파아지 라이브러리를 이용하여 통상적인 방법으로 패닝(panning)을 수행하여 인간 ASM 단백질 또는 마우스 ASM 단백질에 특이적으로 결합하는 scFv를 갖는 파아지를 선별하였다. 선별된 scFv를 암호화하는 핵산 서열을 분석하고, 이로부터 생성되는 아미노산 서열을 확인하였다. 확인된 scFv 서열의 중쇄 가변영역 및 경쇄 가변영역 각각의 카복시 말단(carboxy terminus)에, 서열번호 75 및 77로 각각 기재된 염기 서열로 구성되는 마우스 중쇄 불변영역(constant region) 및 마우스 경쇄 λ 불변영역이 연결된 형태로 발현되도록 발현벡터를 제작하였다. 이때, 제작된 발현벡터에 포함된 scFv를 구성하는 중쇄 가변영역의 아미노산 서열 및 핵산 서열을 하기 표 1에, 경쇄 가변영역의 아미노산 서열 및 핵산 서열을 하기 표 2에 나타내었다.
항체# 서열 서열번호
#9101 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGIYPNGGNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKNAYRFDYWGQGTLVTVSS 서열번호 1
GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCAATTATGCTATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGGGATCTATCCTAATGGTGGTAATAAATATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAAATGCTTATCGTTTCGACTACTGGGGCCAGGGTACACTGGTCACCGTGAGCTCA 서열번호 2
#9102 EVQLLESGGGLVQPGGSLRLSCAASGFTFSGYYMSWVRQAPGKGLEWVSLISPGSGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSWHHFDYWGQGTLVTVSS 서열번호 3
GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCGGTTATTATATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCATTGATCTCTCCTGGTAGTGGTAGTATATATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAATCTTGGCATCATTTCGACTACTGGGGCCAGGGTACACTGGTCACCGTGAGCTCA 서열번호 4
#9104 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLEWVSGIYYGSGNIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDTPGFDYWGQGTLVTVSS 서열번호 5
GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCAATTATTATATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGGGATCTATTATGGTAGTGGTAATATATATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAGAGATACGCCTGGGTTCGACTACTGGGGCCAGGGTACACTGGTCACCGTGAGCTCA 서열번호 6
#9108 EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAIYPGGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDVLGLTPKPFDYWGQGTLVTVSS 서열번호 7
GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCAATTATGCTATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGCGATCTATCCTGGTGGTGGTAGTATATATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAGAGATGTTTTGGGTCTGACTCCTAAGCCGTTCGACTACTGGGGCCAGGGTACACTGGTCACCGTGAGCTCA 서열번호 8
#9113 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYYMSWVRQAPGKGLEWVSSISPGGSSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGASLFDYWGQGTLVTVSS 서열번호 9
GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCAGTTATTATATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCATCGATCTCTCCTGGTGGTAGTAGTATATATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAAAGGGGCGTCTCTGTTCGACTACTGGGGCCAGGGTACACTGGTCACCGTGAGCTCA 서열번호 10
#9123 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAISYGGGNIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVGGMCTRRQCYYDYGMDVWGQGTLVTVSS 서열번호 11
GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCGATTATGCTATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGCGATCTCTTATGGTGGTGGTAATATATATTACGCTGATTCTGTAAAAGGTCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAGAGTTGGTGGTATGTGTACTAGGCGTCAGTGTTATTATGATTATGGTATGGACGTCTGGGGCCAGGGTACACTGGTCACCGTGAGCTCA 서열번호 12
항체# 서열 서열번호
#9101 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYADSKRPSGVPDRFSGSKSGTSASLAIGGLRSEDEADYYCGSWDYSLNAYVFGGGTKLTVL 서열번호 13
CAGTCTGTGCTGACTCAGCCACCCTCAGCTAGCGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTAGTGGCTCTTCATCCAATATTGGCAATAATTATGTCTCCTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATGCTGATAGTAAGCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCGCTGGCCATCGGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGGTTCTTGGGATTATAGCCTGAATGCTTATGTCTTCGGCGGAGGCACCAAGCTTACGGTCCTA 서열번호 14
#9102 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNPVYWYQQLPGTAPKLLIYANNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDSSLSGYVFGGGTKLTVL 서열번호 15
CAGTCTGTGCTGACTCAGCCACCCTCAGCTAGCGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTAGTGGCTCTTCATCTAATATTGGCAATAATCCTGTCTACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATGCTAATAATCAGCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCTGCTTGGGATTCTAGCCTGAGTGGTTATGTCTTCGGCGGAGGCACCAAGCTTACGGTCCTA 서열번호 16
#9104 QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNAVNWYQQLPGTAPKLLIYYDSHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDYSLSAYVFGGGTKLTVL 서열번호 17
CAGTCTGTGCTGACTCAGCCACCCTCAGCTAGCGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTACTGGCTCTTCATCTAATATTGGCAATAATGCTGTCAACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATTATGATAGTCATCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGGTGCTTGGGATTATAGCCTGAGTGCTTATGTCTTCGGCGGAGGCACCAAGCTTACGGTCCTA 서열번호 18
#9108 QSVLTQPPSASGTPGQRVTLSCTGSSSNIGSNTVYWYQQLPGTAPKLLIYANSQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGSWDYSLSGYVFGGGTKLTVL 서열번호 19
CAGTCTGTGCTGACTCAGCCACCCTCAGCTAGCGGGACCCCCGGGCAGAGGGTCACCCTCTCTTGTACTGGCTCTTCATCTAATATTGGCAGTAATACTGTCTACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATGCTAATAGTCAGCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGGTTCTTGGGATTATAGCCTGAGTGGTTATGTCTTCGGCGGAGGCACCAAGCTTACGGTCCTA 서열번호 20
#9113 QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNAVSWYQQLPGTAPKLLIYSDNKRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDASLNAYVFGGGTKLTVL 서열번호 21
CAGTCTGTGCTGACTCAGCCACCCTCAGCTAGTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTAGTGGCTCTTCATCTAATATTGGCAATAATGCTGTCTCCTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATTCTGATAATAAGCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGGTACTTGGGATGCTAGCCTGAATGCTTATGTCTTCGGCGGAGGCACCAAGCTTACGGTCCTA 서열번호 22
#9123 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYDNSKRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDDSLSGYVFGGGTKLTVL 서열번호 23
CAGTCTGTGCTGACTCAGCCACCCTCAGCTAGCGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTAGTGGCTCTTCATCTAATATTGGCAGTAATACTGTCAACTGGTACCAGCAGCTCCCAGGAACGGCCCCCAAACTCCTCATCTATGATAATAGTAAGCGGCCAAGCGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAAGATGAGGCTGATTATTACTGTGGTACTTGGGATGATAGCCTGAGTGGTTATGTCTTCGGCGGAGGCACCAAGCTTACGGTCCTA 서열번호 24
이때, 발현벡터는 포유류 발현벡터(mammalian expression vector)를 사용하였다. 제작된 발현벡터를 CHO 또는 HEK293 세포주에 형질전환시켜 인간 ASM 단백질에 결합하거나, 인간 및 마우스의 ASM 단백질에 모두 결합하는 전장의 항체를 제조하였다.
실시예 2. 상보성 결정영역(complementarity determining region, CDR)의 결정
상기 제조된 scFv에서 상보성 결정영역을 통상적인 방법으로 확인하고, 그 결과, 중쇄 가변영역의 CDR 서열을 표 3에, 경쇄 가변영역의 CDR 서열을 표 4에 나타내었다.
항체# CDR 서열 서열번호
#9101 CDR1 NYAMS 서열번호 25
CDR2 GIYPNGGNKYYADSVKG 서열번호 26
CDR3 NAYRFDY 서열번호 27
#9102 CDR1 GYYMS 서열번호 28
CDR2 LISPGSGSIYYADSVKG 서열번호 29
CDR3 SWHHFDY 서열번호 30
#9104 CDR1 NYYMS 서열번호 31
CDR2 GIYYGSGNIYYADSVKG 서열번호 32
CDR3 DTPGFDY 서열번호 33
#9108 CDR1 NYAMS 서열번호 34
CDR2 AIYPGGGSIYYADSVKG 서열번호 35
CDR3 DVLGLTPKPFDY 서열번호 36
#9113 CDR1 SYYMS 서열번호 37
CDR2 SISPGGSSIYYADSVKG 서열번호 38
CDR3 GASLFDY 서열번호 39
#9123 CDR1 DYAMS 서열번호 40
CDR2 AISYGGGNIYYADSVKG 서열번호 41
CDR3 VGGMCTRRQCYYDYGMDV 서열번호 42
항체# CDR 서열 서열번호
#9101 CDR1 SGSSSNIGNNYVS 서열번호 43
CDR2 ADSKRPS 서열번호 44
CDR3 GSWDYSLNAYV 서열번호 45
#9102 CDR1 SGSSSNIGNNPVY 서열번호 46
CDR2 ANNQRPS 서열번호 47
CDR3 AAWDSSLSGYV 서열번호 48
#9104 CDR1 TGSSSNIGNNAVN 서열번호 49
CDR2 YDSHRPS 서열번호 50
CDR3 GAWDYSLSAYV 서열번호 51
#9108 CDR1 TGSSSNIGSNTVY 서열번호 52
CDR2 ANSQRPS 서열번호 53
CDR3 GSWDYSLSGYV 서열번호 54
#9113 CDR1 SGSSSNIGNNAVS 서열번호 55
CDR2 SDNKRPS 서열번호 56
CDR3 GTWDASLNAYV 서열번호 57
#9123 CDR1 SGSSSNIGSNTVN 서열번호 58
CDR2 DNSKRPS 서열번호 59
CDR3 GTWDDSLSGYV 서열번호 60
실험예 1. ASM 단백질과의 결합 확인
상기에서 제조된 ASM 단백질에 특이적으로 결합하는 항체의 ASM 단백질과의 결합을 ELISA 분석 방법으로 확인하였다.
먼저, 멀티-어레이 96-웰 플레이트(Thermo scientific)에 1 ㎍/㎖의 재조합 인간 ASM 단백질(R&D systems)을 100 ㎕ 첨가하여 4℃에서 16시간 동안 방치하여 플레이트를 코팅하였다. 코팅된 플레이트에 5% BSA가 포함된 200 ㎕의 PBS를 첨가하여 37℃에서 2시간 동안 반응시켜 전처리한 후, 0.05%의 트윈 20(Tween 20)이 포함된 PBS로 이를 3회 세척하였다. 여기에 0.0001, 0.001, 0.01, 0.1, 1, 10 또는 100 nM의 항-ASM 항체를 처리하고, 37℃에서 1시간 동안 반응시켰다. 반응 후, 플레이트를 0.05%의 트윈이 포함된 PBS로 3회 세척하고, 2차 항체로서 100 ㎕의 염소-항-마우스 IgG-HRP(Jackson Immunoresearch) 항체를 첨가하였다. 이를 다시 37℃에서 1시간 동안 반응시키고, 0.05%의 트윈이 포함된 PBS로 3회 세척하였다. 여기에 100 ㎕의 TMB 기질(tetramethylbenzidine)을 첨가하고, 상온에서 5분 동안 추가 반응시킨 후, 100 ㎕의 2 N 황산용액으로 반응을 중단시키고, 450 ㎚의 파장에서 흡광도를 측정하였다. 그 결과, 측정된 흡광도를 도 2에, 흡광도 값으로부터 계산된 항체의 EC50 값을 표 5에 나타내었다.
항체# EC50(nM)
#9101 0.0815
#9102 0.0954
#9104 1.948
#9108 0.3269
#9123 0.7578
도 2에 나타난 바와 같이, 상기에서 제조된 5종류의 항체가 모두 농도 의존적으로 ASM 단백질에 결합하였다. 특히, 표 5에 나타난 바와 같이, #9101 항체가 가장 낮은 EC50값을 나타내어 ASM 단백질에 대한 결합력이 가장 높았다.
실험예 2. ASM 단백질과의 결합 친화성 확인
상기에서 제조된 ASM 단백질에 특이적으로 결합하는 항체의 ASM 단백질과의 결합 친화성 및 상호작용 동역학을 Octet® QK384 시스템(Pall Life Sciences)을 사용하여 측정하였다.
먼저, AR2G 센서(ForteBio)에 20 mM의 1-에틸-3-(3-디메틸아미노프로필)카르보디이미드 히드로클로라이드(EDC) 및 40 mM의 N-히드록시술포숙신이미드(술포-NHS) 용액을 처리하여 카르복시기를 활성화시켰다. 한편, 10 ㎍/㎖의 재조합 인간 ASM 단백질 또는 2.5 ㎍/㎖의 재조합 마우스 ASM 단백질은 10 mM의 소듐 아세테이트(pH 5.0)(ForteBio) 용액에 희석하여 준비하였다. 상기 ASM 단백질이 희석된 용액을 카르복시기가 활성화된 AR2G 센서에 가하여 재조합 인간 또는 마우스 ASM 단백질이 고정된 AR2G 센서를 수득하였다. 수득된 ASM 단백질이 고정된 센서에 1 M의 에탄올아민(ForteBio)을 첨가하여 미반응의 잔여 카르복시기를 불활성화시켰다. 여기에 0.4, 2 또는 10 nM 농도의 실시예 1에서 제조된 항체를 첨가하고 약 900초까지 반응물의 결합상을 관찰하였다. 이후, 1× 동역학 완충액(kinetics buffer)(ForteBio)을 첨가하고, 약 1,200초 동안 반응물의 분리상을 관찰하였다. Octet® 분석 소프트웨어(Pall Life Sciences)를 사용하여 각 항체에 대한 흡착율 상수(association constant: Kon), 분리율 상수(dissociation constant: Kdis) 및 평형분리상수(equilibrium dissociation constant: KD)를 결정하였다. 그 결과, 재조합 인간 ASM 단백질에 대한 분석 결과를 표 6에, 재조합 마우스 ASM 단백질에 대한 분석 결과를 표 7에 나타내었다.
항체# KD(M) Kon(1/Ms) Kdis(1/s) RMax Full R2
#9101 1.16E-09 6.26E+05 7.28E-04 0.4527 0.9861
#9102 2.52E-10 4.16E+05 1.05E-04 0.8652 0.997
#9104 2.09E-10 3.92E+05 8.18E-05 0.3324 0.9759
#9108 1.19E-10 2.49E+05 2.96E-05 0.45 0.999
#9113 5.64E-10 1.16E+06 6.56E-04 0.2868 0.9635
항체# KD(M) Kon(1/Ms) Kdis(1/s) RMax Full R2
#9101 4.25E-11 3.76E+06 1.59E-04 0.0185 0.5527
#9102 4.98E-10 4.89E+05 2.43E-04 0.4281 0.9944
#9104 6.38E-10 3.10E+05 1.98E-04 0.7027 0.9971
#9108 3.39E-09 4.59E+05 1.56E-03 0.3921 0.9865
#9113 <1.0E-12 1.00E+06 <1.0E-07 0 0
표 6에 나타난 바와 같이, 실시예 1에서 제조된 5종류의 항체가 10-10 내지 10-9 M 수준의 결합력으로 인간 ASM 단백질과 결합하였다. 한편, 표 7에 나타난 바와 같이, 마우스 ASM 단백질에 대해서는 #9102, #9104 또는 #9108의 항체만 10-10 내지 10-9 M 수준의 결합력을 보였다.
실험예 3. ASM 단백질의 항원 결정부위 확인
본 발명에 따른 항체가 ASM 단백질에 결합하는 부위인, 항원 결정부위를 HDX-MS(hydrogen deuterium exchange mass spectrometry) 방법으로 확인하였다.
먼저, 1,000 ㎍/㎖의 ASM 단백질, 1,000 ㎍/㎖의 #9101 mIgG1, 1,250 ㎍/㎖의 #9102 mIgG2, 1,000 ㎍/㎖의 #9104 mIgG4,1,000 ㎍/㎖의 #9108 mIgG1, 3,300 ㎍/㎖의 #9113 mIgG1 또는 2,932 ㎍/㎖의 #9123 mIgG1 항체를 연속으로 2배수씩 희석하여 128배 희석액까지 준비하였다. 준비된 희석액을 1 ㎕씩 취하여 동량의 10 ㎎/㎖의 시나핀산 매트릭스(K200 MALDI kit, CovalX)와 혼합하고, 상기 혼합물의 1 ㎕를 SCOUT 384 MALDI 플레이트에 분주하고 상온에서 결정화시켰다. 이후, 상기 결정을 MALDI 질량분석기(mass spectrometer)를 사용하여 측정하였다. 한편, 비공유 상호작용 분석을 위한 크로스-링크(cross-link) 데이터를 위해 1 ㎕의 128배 희석액을 동량의 2 ㎎/㎖의 K200 안정화 용액(K200 stabilizer reagent, K200 MALDI kit, CovalX)과 혼합하고, 이를 3시간 동안 상온에서 반응시켰다. 반응이 끝난 후, 1 ㎕의 혼합액을 이용하여, 상기와 동일하게 MALDI 질량분석기를 사용하여 측정하고, 측정한 결과는 하이-매스 MALDI MS(high-mass MALDI MS) 모드로 분석하였다. 그 결과, ASM 단백질 내 중수소 삽입에서 현저한 차이를 갖는 것으로 확인된 부위의 아미노산 서열을 하기 표 8에, 인간 ASM 단백질 구조 모델에 각 항체의 결합 위치를 표시한 결과를 도 3에 나타내었다. 또한, ASM 단백질 중, 사포신(saposin) 도메인에 대한 각 항체의 중수소 치환율 히트맵을 도 4에 나타내었다.
#항체 펩타이드 영역 아미노산 서열
#9101 135-159 PTVPKPPPKPPSPPAPGAPVSRILF
#9102 135-159 PTVPKPPPKPPSPPAPGAPVSRILF
218-228 SGLGPAGPFDM
#9104 53-72 TAINLGLKKEPNVARVGSVA
135-159 PTVPKPPPKPPSPPAPGAPVSRILF
#9108 53-72 TAINLGLKKEPNVARVGSVA
135-155 PTVPKPPPKPPSPPAPGAPVS
259-269 VRKFLGPVPVY
#9113 53-72 TAINLGLKKEPNVARVGSVA
101-123 VWRRSVLSPSEACGLLLGSTCGH
135-155 PTVPKPPPKPPSPPAPGAPVS
259-269 VRKFLGPVPVY
#9123 259-269 VRKFLGPVPVY
표 8 및 도 3에 나타낸 바와 같이, 본 발명에 따른 항체는 ASM 단백질의 N-말단으로부터 53 내지 72번째 아미노산 단편(서열번호 68: TAINLGLKKEPNVARVGSVA), 101 내지 123번째 아미노산 단편(서열번호 69: VWRRSVLSPSEACGLLLGSTCGH), 135 내지 159번째 아미노산 단편(서열번호 70: PTVPKPPPKPPSPPAPGAPVSRILF), 135 내지 155번째 아미노산 단편(서열번호 71: PTVPKPPPKPPSPPAPGAPVS), 218 내지 228번째 아미노산 단편(서열번호 72: SGLGPAGPFDM) 또는 259 내지 269번째 아미노산 단편(서열번호 73: VRKFLGPVPVY)에 결합하였다. 특히, 도 4에 나타난 바와 같이, 본 발명에 따른 항체는 사포신 도메인 중 α-헬릭스 1 및 α-헬릭스 2 부위에 주로 결합하였다.
실험예 4. ASM 단백질의 활성 억제 확인
4-1. ASM 단백질의 활성 억제 확인
상기에서 제조된 ASM 단백질에 특이적으로 결합하는 항체가 세포막에 위치하는 ASM 단백질의 활성을 억제하는지 확인하였다.
먼저, 알츠하이머 환자의 섬유아세포(Coriell institute)에 실시예 1에서 제조된 항체를 3 ㎍/㎖의 농도로 처리하고, 37℃에서 24시간 동안 반응시켰다. 이후, 세포를 모아서 Mem-PER™ 플러스 멤브레인 단백질 추출 키트(Mem-PER™ Plus Membrane Protein Extraction Kit, Thermo)를 이용하여 제조사의 프로토콜에 따라 세포막을 분리하고 단백질을 추출하였다. 추출된 단백질을 시료로서 사용하여 UPLC용 주입구(insert)에 넣고, 통상적인 방법으로 UPLC 분석(Waters, 186004800)을 수행하고, 그 결과를 도 5에 나타내었다. 이때, 대조군으로서는 ASM 단백질에 결합하지 않는 것으로 확인된 #9105 항체를 사용하였다.
도 5에 나타난 바와 같이, 실시예 1에서 제조된 6종류의 항체 중, #9104 항체가 알츠하이머 환자의 세포막에서 증가한 ASM 단백질의 활성을 유의적으로 억제하였다.
4-2. 항-ASM 항체의 처리 농도에 따른 ASM 단백질 활성 억제 확인
실시예 1에서 제조된 #9104 항체를 0.03, 0.3, 3, 30, 300 또는 3,000 ng/㎖의 농도로 처리한 것을 제외하고는, 상기 실험예 4-1과 동일한 방법으로 세포막에 위치하는 ASM 단백질의 활성 변화를 확인하였다. 그 결과, 분석된 ASM 단백질의 활성 억제율(%)을 도 6 및 표 9에 나타내었다. 이때, 대조군으로서 #9105 항체를 사용하였다.
처리농도(ng/㎖) ASM 단백질 활성 억제율(%)
#9104 #9105
0.03 0 -
0.3 7.9 -
3 16 -
30 21 -
300 28 -
3,000 32 9
도 6 및 표 9에 나타난 바와 같이, 본 발명에 따른 #9104 항체는 처리농도 의존적으로 세포막에 위치하는 ASM 단백질의 활성을 유의적으로 억제하였다. 반면, 대조군으로 사용된 #9105 항체는 3,000 ng/㎖ 이상의 농도로 처리한 경우에만 세포막에 위치하는 ASM 단백질의 활성을 약간 억제하였다.
실험예 5. 스핑고지질의 대사 변화 확인
실험예 4-1에 기재된 바와 같이 3 ㎍/㎖의 #9104 항체가 처리된 세포의 세포막에서 스핑고지질의 대사 변화를 스핑고미엘린(sphingomyelin) 및 세라마이드(ceramide)의 함량 변화를 통해 확인하였다. 실험은 통상적인 방법으로 수행되었으며, 측정된 스핑고미엘린 및 세라마이드의 함량은 도 7에 나타내었다.
도 7에 나타난 바와 같이, #9104 항체의 처리에 의해 알츠하이머 환자의 섬유아세포 세포막에 존재하는 세라마이드의 함량은 유의적으로 감소하였으나, 스핑고미엘린의 함량에는 큰 변화가 없었다.
따라서, 상기로부터 본 발명에 따른 항체가 ASM 단백질에 의한 스핑고미엘린의 분해를 억제하는 것을 알 수 있었다.
실험예 6. 인지 기억력 개선 확인
알츠하이머 동물 모델인 APP/PS1 마우스에 #9104 항체를 투여하여 상기 마우스의 인지 기억력 변화를 확인하였다.
6-1. 항-ASM 항체의 투여
7개월령 APP/PS1 마우스에 50 ㎎/㎏의 투여량으로 324 ㎕의 #9104 항체를 8주 동안 복강 투여하였다. 투여는 1주일에 2회(3일 간격) 수행되었으며, #9104 항체는 총 16회 투여되었다(도 8). 이때, C57BL/6 마우스 및 APP/PS1 마우스의 교배로 태어난 후손에 아무것도 처리하지 않은 경우를 무처리 대조군으로, APP/PS1 마우스에 324 ㎕의 PBS를 처리한 경우를 음성 대조군으로 하였다.
6-2. 인지 기억력 개선 확인-(1)
#9104 항체의 투여 41일째부터 마지막날까지 행동기능검사를 수행하여, 항체의 투여에 의한 인지 기억력 변화를 확인하였다.
먼저, 투여 41일째부터 5분 동안 모든 마우스의 꼬리를 잡고 시험자의 팔 및 손등에 올리기를 반복하여 시험자에 대한 마우스의 거부감을 없애고, 이후 30분 동안 물에 적응시켜 물에 대한 거부감을 없앤 후 실험에 사용하였다. 한편, 수조는 4면위에 큐(cue)를 제거한 상태로 플랫폼(platform)을 설치하고, 이를 중심으로 삼각형의 작은 수조를 설치하였다. 상기 마우스를 수조에 넣어 수영연습 및 플랫폼에 올라가는 연습을 10회 실시하였다. 이때, 수영을 연습한 후, 10초 후 플랫폼에 올라갈 때마다 10초씩 머무를 수 있게 하고, 10초 후에 마우스를 물에 다시 들어가게 하였다. 이를 10회 반복하고, 반복하는 동안 플랫폼에 대해 접근 방향을 변화시켜 다양한 방향에서 플랫폼에 올라갈 수 있도록 교육하였다. 다음날인 투여 42일째부터 51일까지 수중 미로 실험(morris water maze test)을 수행하였다. 구체적으로, 수조의 4면 위에 큐를 설치하고 매일 동일한 시간에 각 마우스당 4회 실험을 수행하고(회당 60초의 시간제한), 이를 총 10회 반복하여 플랫폼에 올라갈 때까지 소요되는 시간을 기록하였다. 또한, 투여 52일째에는 프로브 테스트(probe test)를 수행하여 플랫폼을 제거한 수조에서 기존에 플랫폼이 있던 위치 및 다른 사분면을 지나 수영하는 거리 및 속도 등을 기록하였다. 그 결과, 수중 미로 실험 결과를 도 9에, 프로브 테스트 결과를 도 10 내지 12에 나타내었다.
도 9에 나타난 바와 같이, 시험을 반복함에 따라 #9104 항체를 투여한 마우스는 탈출 지연 시간(escape latency time)이 유의적으로 감소하였다. 한편, 음성 대조군의 마우스는 평균 30초의 탈출 지연 시간을 보여 인지 기능이 손상되었고, 무처리 대조군의 마우스는 시험을 반복하면서 탈출 지연 시간이 줄어들었다. 구체적으로, #9104 항체를 투여한 군은 음성 대조군의 마우스와 비교하여 탈출 지연시간이 9회차에 31.5% 및 10회차에 30.8% 감소하였다.
또한, 도 10 및 11에 나타난 바와 같이, #9104 항체를 투여한 마우스는 표적 사분면에 머무는 시간이 비-표적 사분면에 머무는 시간에 비해 유의적으로 증가하였다. 이는 무처리 대조군과 유사하였고, 표적 사분면 및 비-표적 사분면에 머무르는 시간의 차이가 거의 없었던 음성 대조군과 차이를 보였다.
또한, 도 12C에 나타난 바와 같이, 플랫폼이 있던 위치를 지나가는 횟수(crossing platform)의 경우 #9104 항체를 투여한 군에서 유의적으로 증가한 반면, 음성 대조군은 감소한 것을 확인하였다. 한편, 도 12A 및 12B에 나타난 바와 같이, 모든 마우스군에서 수영 거리 및 속도는 유사한 것으로 확인되어 #9104 항체의 투여가 운동력에는 영향을 주지 않음을 알 수 있었다.
6-3. 인지 기억력 개선 확인-(2)
알츠하이머 동물 모델인 APP/PS1 마우스에 #9104 항체를 50 ㎎/㎏의 투여량으로 투여하여 상기 마우스의 인지 기억력 변화를 확인하였다. 실험은 상기 실험예 6-1과 동일한 방법으로 #9104 항체를 투여하고, 통상적인 방법으로 상황 및 큐 공포 조건 테스트(contextual and cued fear conditioning test)를 수행한 후, 그 결과를 도 13에 나타내었다.
도 13에 나타난 바와 같이, #9104 항체를 투여한 마우스는 상황(contextual)이나 분위기(tone)에 따라 경직(freezing)이 유의적으로 증가한 반면, 음성 대조군의 마우스는 경직정도가 감소하였다.
따라서, 상기 결과로부터, 본 발명에 따른 항체가 알츠하이머 동물 모델의 인지 기억력을 유의적으로 개선시킴을 확인하였다.
실험예 7. ASM 단백질 활성 확인
7-1. ASM 단백질 활성 확인
상기 실험예 6에서 인지 기억력 개선을 확인한 동물 모델의 혈액 및 뇌조직에 존재하는 ASM 단백질의 활성을 확인하였다. 구체적으로, 실험은 마우스의 혈액 플라즈마(plasma)에서 단백질을 통상적인 방법으로 수득하고, 수득된 단백질을 시료로 사용하여 실험예 4-1에 기재된 바와 동일한 방법으로 UPLC를 수행하였다. 그 결과, 음성 대조군 마우스의 ASM 단백질 활성을 기준으로 무처리 대조군 마우스 및 #9104를 투여한 마우스군의 ASM 활성(%)을 계산한 결과를 도 14에 나타내었다.
도 14에 나타난 바와 같이, #9104 항체의 투여에 의해 혈액 플라즈마에 존재하는 ASM 단백질의 활성이 약 64% 억제되었다.
7-2. ASM 단백질 농도 확인
실험예 7-1에서 확인된 ASM 단백질의 활성 억제가 단백질의 발현 수준 감소에 의한 것인지 확인하기 위해 ELISA 분석을 수행하였다. 실험은 실험예 7-1에서 수득된 혈액 플라즈마 조직을 시료로 사용하고, 마우스 ASM ELISA 키트(Mybiosource)를 사용하여 제조사의 프로토콜에 따라 분석을 통해 수행한 후, 그 결과를 도 15에 나타내었다.
도 15에 나타난 바와 같이, #9104 항체를 투여한 마우스에서 오히려 무처리 대조군이나 음성 대조군보다 ASM 단백질의 농도가 유의적으로 증가하였다.
따라서, 상기 결과로부터 본 발명에 따른 항체는 ASM 단백질의 농도에는 영향을 미치지 않으면서 그 활성을 유의적으로 억제시킴을 알 수 있었다.
실험예 8. 아밀로이드-β(Aβ) 축적 억제 확인
상기 실험예 6에서 인지 기억력 개선을 확인한 동물 모델의 뇌조직에 존재하는 아밀로이드-β의 축적을 티오플라빈-S(tioflavin-S) 염색 및 6E10 항체를 이용한 웨스턴블롯과, ELISA 분석 방법으로 다음과 같이 확인하였다.
8-1. Aβ 축적 억제 확인-(1)
실험예 6의 동물 모델을 2.5% 아베르틴(avertin)으로 마취하고, 흉강을 개복하여 1 cc 주사기를 이용하여 심장으로부터 혈액을 수득하였다. 혈액을 수득한 후, 20 ㎖의 PBS로 관류(perfusion)를 수행하고, 20~30 ㎖의 4% PFA(paraformaldehyde)로 추가 관류를 수행하였다. 상기 마우스의 뇌를 적출하여 4% PFA 용액에 넣어 하룻밤 동안 방치하고, 비브라톰(vibratome)을 이용하여 상기 조직을 30 ㎛ 두께로 절편화하였다. 수득된 뇌조직 절편을 12웰 플레이트에 넣은 후, 1 ㎖의 PBS 용액을 첨가하고 실온에서 33 rpm의 조건으로 5분 동안 교반하였다. PBS 용액을 제거하고, 에탄올에 희석된 500 ㎕의 0.5% 티오플라빈-S 시약을 처리하여 Aβ 플라크(plaque)를 10분 동안 염색하였다. 이후, 상기 절편을 50% 에탄올로 2회 세척하고, 1 ㎖의 PBS 용액으로 1회 세척하였다. 여기에 DAPI가 포함된 마운트 배지(mount media)를 첨가하여 마운팅하였다.
한편, 모든 형태의 Aβ 단백질을 염색하기 위해 상기 뇌조직 절편을 12웰 플레이트에 넣은 후, 1 ㎖의 PBS 용액을 첨가하여 실온에서 33 rpm의 조건으로 5분 동안 교반하고, PBS 용액을 제거하였다. 여기에 1 ㎖의 0.2%의 트리톤 X-100이 포함된 PBS 용액을 첨가하고 33 rpm의 조건으로 1시간 동안 교반하였다. 교반 후, 트리톤 X-100이 포함된 PBS 용액을 제거하고, 0.05%의 트리톤 X-100이 포함된 PBS 용액으로 1시간 동안 전처리하였다. 전처리된 뇌조직 절편에 6E10 항체(Biolegend)를 0.05%의 트리톤 X-100이 포함된 PBS 용액과 1:1의 부피비로 혼합하여 500 ㎕의 양으로 첨가하였다. 이를 4℃에서 하룻밤 동안 교반하면서 반응시키고, 트리톤 X-100이 포함된 PBS 용액으로 3회 세척하였다. 여기에 마우스-488 2차 항체를 처리하고 실온에서 2시간 동안 반응시킨 후, 다시 트리톤 X-100이 포함된 PBS 용액으로 3회 세척하였다. 여기에 DAPI가 포함된 마운트 배지(mount media)를 첨가하여 마운팅하였다.
염색된 뇌조직 절편은 레이저-스캐닝 공초점 현미경(FV3000, Olympus)을 사용하여 20배의 배율로 촬영하고, 메타모르프 소프트웨어(MetaMorph software, Molecular Devices)를 사용하여 염색 면적을 분석한 후, 분석 결과를 도 16 및 17에 나타내었다.
도 16 및 17에 나타난 바와 같이, 뇌의 피질 및 해마에 존재하는 고밀도(dense-core) 및 확산형(diffuse) 아밀로이드-β 플라크가 #9104 항체의 처리에 의해 유의적으로 감소하였다.
8-2. Aβ 축적 억제 확인-(2)
상기에서 수득된 뇌조직을 피질 및 해마로 분리하고, 100 mM PMSF 및 1% 프로테아제 억제제가 포함된 RIPA 완충액을 첨가하고, 조직을 균질화시켰다. 균질화된 조직을 4℃ 및 13,000 rpm의 조건하에서 10분 동안 원심분리하고 상층액을 수득하였다. 수득된 상층액을 동일한 조건으로 30분 동안 추가 원심분리하여 상층액을 다시 수득하고, 이를 시료로 사용하여 아밀로이드-β40 ELISA 키트(KHB3481, invitrogen) 및 아밀로이드-β42 ELISA 키트(KHB3441, invitrogen)로 Aβ의 수준을 측정하였다. 이후, 수득된 결과를 도 18에 나타내었다.
도 18에 나타난 바와 같이, 뇌의 피질 및 해마에 존재하는 Aβ40은 #9104 항체에 의해 각각 30.9% 및 30.9%로 감소하였고, 이는 음성 대조군과 비교하여 유의적이었다. Aβ42 또한 음성 대조군과 비교하여 #9104 항체의 투여에 의해 유의적으로 감소하였다.
실험예 9. 타우(tau) 축적 확인
상기 실험예 8에서 수득된 뇌조직 절편을 이용하여 타우의 축적 변화를 타우 단백질을 염색하여 확인하였다. 구체적으로, 실험은 1차 항체로서 항-AT8 항체(ThermoFisher Scientific, MN1020)을 사용한 것을 제외하고는, 실험예 8-1과 동일한 조건 및 방법으로 수행되었고, 분석 결과를 도 19에 나타내었다.
도 19에 나타난 바와 같이, 뇌의 피질 및 해마에 존재하는 타우 단백질이 #9104 항체의 처리에 의해 유의적으로 감소하였다.
실험예 10. 신경염증 개선 확인
상기 실험예 6에서 인지 기억력 개선을 확인한 동물 모델의 뇌조직에서 #9104 항체에 의한 신경염증 개선 효과를 미세아교세포(microglia) 및 별아교세포(astrocyte) 활성화를 통해 확인하였다. 실험은 1차 항체로서 항-lba-1 항체(Wako, 019-19941) 또는 항-GFAP 항체(Dako, N1506)를 사용하고, 2차 항체로서 토끼-488 2차 항체를 사용한 것을 제외하고는, 실험예 8-1과 동일한 조건 및 방법으로 수행되었고, 분석 결과는 도 20 및 21에 나타내었다.
도 20 및 21에 나타난 바와 같이, 뇌의 피질 및 해마에 존재하는 lba-1 및 GFAP 단백질의 발현이 유의적으로 감소함으로써, #9104 항체에 의해 뇌조직 내 미세아교세포 및 별아교세포의 활성이 억제됨을 확인하였다.
따라서, 상기 결과로부터 본 발명에 따른 항체는 뇌 신경염증을 개선하는 효과가 있음을 알 수 있었다.
실험예 11. 독성 확인
#9104 항체의 독성을 다음과 같은 방법으로 확인하였다.
실험은, 상기 실험예 6에서 #9104 항체를 투여하면서 진행되었다. 구체적으로, 매주 2회 마우스의 움직임 및 이상징후를 육안으로 관찰하여 생존율을 평가하였고, 매주 1회 동일한 요일 및 시간에 마우스의 체중을 측정하였다. 한편, 투여가 완료된 마우스를 통상적인 방법으로 부검하여 장기를 관찰함으로써, #9104 항체에 의한 장기독성을 보이는지 확인하였다. 그 결과, 마우스의 생존율 및 체중 변화를 도 22에, 장기 독성을 확인한 결과를 도 23에 나타내었다.
도 22 및 23에 나타낸 바와 같이, #9104 항체의 처리에 의해 생존율 및 체중은 유의적인 변화를 나타내지 않았으며, 장기 또한 정상인 것으로 확인되었다.
따라서, 상기 결과로부터 본 발명에 따른 항체는 독성이 없으면서도 알츠하이머와 같은 뇌질환의 치료에 유의적으로 사용될 수 있음을 알 수 있었다.

Claims (17)

  1. ASM(acid sphingomyelinase) 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 뇌질환 예방 또는 치료용 약학적 조성물.
  2. 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 ASM 단백질의 N-말단으로부터 53 내지 72번째 아미노산 단편, 101 내지 123번째 아미노산 단편, 135 내지 159번째 아미노산 단편, 135 내지 155번째 아미노산 단편, 218 내지 228번째 아미노산 단편 및 259 내지 269번째 아미노산 단편으로 구성된 군으로부터 선택되는 어느 하나 이상의 에피토프에 결합하는, 뇌질환 예방 또는 치료용 약학적 조성물.
  3. 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 서열번호 68 내지 73으로 각각 기재된 폴리펩티드로 구성된 군으로부터 선택되는 어느 하나 이상의 에피토프에 결합하는, 뇌질환 예방 또는 치료용 약학적 조성물.
  4. 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은,
    서열번호 61로 기재된 아미노산 서열로 구성되는 중쇄 CDR1(X1YX2MS), 서열번호 62로 기재된 아미노산 서열로 구성되는 중쇄 CDR2(X3IX4X5X6X7X8X9X10YYADSVKG), 및 서열번호 27, 30, 33, 36, 39 및 42로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 중쇄 CDR3을 포함하는 중쇄 가변영역; 및
    서열번호 63으로 기재된 아미노산 서열로 구성되는 경쇄 CDR1(X11GSSSNIGX12NX13VX14), 서열번호 64로 기재된 아미노산 서열로 구성되는 경쇄 CDR2(X15X16X17X18RPS), 및 서열번호 65로 기재된 아미노산 서열로 구성되는 경쇄 CDR3(X19X20WDX21SLX22X23YV)을 포함하는 경쇄 가변영역을 포함하는, 뇌질환 예방 또는 치료용 약학적 조성물.
  5. 제4항에 있어서,
    상기 X1 및 X2는 각각 아스파라긴(asparagine, Asn), 글리신(glycine, Gly), 세린(serine, Ser), 아스파르트산(aspartic acid, Asp), 알라닌(alanine, Ala) 및 티로신(tyrosine, Tyr)으로 구성된 군으로부터 선택,
    상기 X3 내지 X10은 각각 글리신, 류신(leucine, Leu), 알라닌, 세린, 티로신, 프롤린(proline, Pro), 아스파라긴, 리신(lysine, Lys) 및 이소류신(isoleucine, Ile)으로 구성된 군으로부터 선택,
    상기 X11 내지 X14는 각각 트레오닌(threonine, Thr), 세린, 아스파라긴, 알라닌, 프롤린 및 티로신으로 구성된 군으로부터 선택,
    상기 X15 내지 X18은 각각 티로신, 알라닌, 아스파르트산, 세린, 아스파라긴, 히스티딘(histidine, His), 글루타민(glutamine, Gln) 및 리신으로 구성된 군으로부터 선택, 및
    상기 X19 내지 X23은 글리신, 알라닌, 세린, 트레오닌, 티로신, 아스파르트산 및 아스파라긴으로 구성된 군으로부터 선택되는, 뇌질환 예방 또는 치료용 약학적 조성물.
  6. 제5항에 있어서,
    상기 X1은 아스파라긴, 글리신, 세린 또는 아스파르트산,
    상기 X2는 알라닌 또는 티로신,
    상기 X3는 글리신, 류신, 알라닌 또는 세린,
    상기 X4는 티로신 또는 세린,
    상기 X5는 프롤린 또는 티로신,
    상기 X6은 아스파라긴 또는 글리신,
    상기 X7 및 X8은 각각 글리신 또는 세린,
    상기 X9는 아스파라긴 또는 세린,
    상기 X10은 리신 또는 이소류신,
    상기 X11은 트레오닌 또는 세린,
    상기 X12는 아스파라긴 또는 세린,
    상기 X13은 알라닌, 프롤린, 트레오닌 또는 티로신,
    상기 X14는 아스파라긴, 티로신 또는 세린,
    상기 X15는 티로신, 알라닌, 아스파르트산 또는 세린,
    상기 X16는 아스파르트산 또는 아스파라긴,
    상기 X17은 세린 또는 아스파라긴,
    상기 X18은 히스티딘, 글루타민 또는 리신,
    상기 X19는 글리신 또는 알라닌,
    상기 X20은 알라닌, 세린 또는 트레오닌,
    상기 X21은 티로신, 세린, 알라닌 또는 아스파르트산,
    상기 X22는 세린 또는 아스파라긴, 및
    상기 X23은 알라닌 또는 글리신인, 뇌질환 예방 또는 치료용 약학적 조성물.
  7. 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은,
    서열번호 25, 28, 31, 34, 37 및 40으로 기재된 아미노산 서열로 구성된 군으로부터 선택되는 중쇄 CDR1,
    서열번호 26, 29, 32, 35, 38 및 41로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 중쇄 CDR2, 및
    서열번호 27, 30, 33, 36, 39 및 42로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 중쇄 CDR3을 포함하는 중쇄 가변영역; 및
    서열번호 43, 46, 49, 52, 55 및 58로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 경쇄 CDR1,
    서열번호 44, 47, 50, 53, 56 및 59로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 경쇄 CDR2, 및
    서열번호 45, 48, 51, 54, 57 및 60으로 각각 기재된 아미노산 서열로 구성된 군으로부터 선택되는 경쇄 CDR3을 포함하는 경쇄 가변영역을 포함하는, 뇌질환 예방 또는 치료용 약학적 조성물.
  8. 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은,
    서열번호 25, 26 및 27로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역,
    서열번호 28, 29 및 30으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역,
    서열번호 31, 32 및 33으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역,
    서열번호 34, 35 및 36으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역,
    서열번호 37, 38 및 39로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및
    서열번호 40, 41 및 42로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역으로 구성된 군에서 선택되는 중쇄 가변영역; 및
    서열번호 43, 44 및 45로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역,
    서열번호 46, 47 및 48로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역,
    서열번호 49, 50 및 51로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역,
    서열번호 52, 53 및 54로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역,
    서열번호 55, 56 및 57로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역, 및
    서열번호 58, 59 및 60으로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역으로 구성된 군에서 선택되는 경쇄 가변영역을 포함하는, 뇌질환 예방 또는 치료용 약학적 조성물.
  9. 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은,
    서열번호 25, 26 및 27로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 43, 44 및 45로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역;
    서열번호 28, 29 및 30으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 46, 47 및 48로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역;
    서열번호 31, 32 및 33으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 49, 50 및 51로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역;
    서열번호 34, 35 및 36으로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 52, 53 및 54로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역;
    서열번호 37, 38 및 39로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 55, 56 및 57로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역; 또는
    서열번호 40, 41 및 42로 각각 기재된 아미노산 서열로 구성되는 중쇄 CDR1, CDR2 및 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 58, 59 및 60으로 각각 기재된 아미노산 서열로 구성되는 경쇄 CDR1, CDR2 및 CDR3를 포함하는 경쇄 가변영역을 포함하는, 뇌질환 예방 또는 치료용 약학적 조성물.
  10. 제1항에 있어서, 상기 ASM 단백질은 포유동물 유래인, 뇌질환 예방 또는 치료용 약학적 조성물.
  11. 제1항에 있어서, 상기 ASM 단백질은 서열번호 66 또는 67로 기재된 아미노산 서열로 구성되는 폴리펩티드인, 뇌질환 예방 또는 치료용 약학적 조성물.
  12. 제1항에 있어서, 상기 뇌질환은 퇴행성 뇌질환인, 뇌질환 예방 또는 치료용 약학적 조성물.
  13. 제12항에 있어서, 상기 퇴행성 뇌질환은 아밀로이드-β의 발현 또는 응집 수준이 정상보다 높거나 높을 위험이 있는 것인, 뇌질환 예방 또는 치료용 약학적 조성물.
  14. 제12항에 있어서, 상기 퇴행성 뇌질환은 치매, 알츠하이머병, 파킨슨병, 헌팅턴병, 경도인지장애, 대뇌 아밀로이드 맥관병증, 다운증후군, 아밀로이드성 뇌졸증, 전신성 아밀로이드병, 더취(Dutch)형 아밀로이드증, 니만-픽병, 노인성 치매, 근위축성 측삭 경화증(amyotrophic lateral sclerosis), 척수소뇌성 운동실조증(spinocerebellar atrophy), 뚜렛 증후군(Tourette's syndrome), 프리드리히 보행실조(Friedrich's Ataxia), 마차도-조셉병(Machado-Joseph's disease), 루이소체 치매, 근육긴장이상(dystonia), 진행성 핵상 마비(progressive supranuclear palsy) 또는 전두측두엽 치매인, 뇌질환 예방 또는 치료용 약학적 조성물.
  15. ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 뇌질환 예방 또는 개선용 건강기능식품.
  16. ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 개체에 투여하는 단계를 포함하는 뇌질환 예방, 개선 또는 치료방법.
  17. 뇌질환의 예방, 개선 또는 치료를 위한 약제의 제조에 사용하기 위한 ASM 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편의 용도.
PCT/KR2022/007485 2021-05-27 2022-05-26 Asm 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 뇌질환 치료용 약학적 조성물 WO2022250470A1 (ko)

Priority Applications (11)

Application Number Priority Date Filing Date Title
US18/564,378 US20240254260A1 (en) 2021-05-27 2022-05-26 Pharmaceutical composition for treating brain diseases comprising antibody specifically binding to asm protein as active ingredient
AU2022279866A AU2022279866A1 (en) 2021-05-27 2022-05-26 Pharmaceutical composition for treating brain diseases comprising antibody specifically binding to asm protein as active ingredient
MA63152A MA63152A1 (fr) 2021-05-27 2022-05-26 Composition pharmaceutique pour le traitement de maladies cérébrales comprenant un anticorps se liant de manière spécifique à une protéine asm en tant que principe actif
BR112023024632A BR112023024632A2 (pt) 2021-05-27 2022-05-26 Composição farmacêutica para tratamento de doenças cerebrais que compreende anticorpo especificamente ligado à proteína asm como ingrediente ativo
JP2023572865A JP7484028B1 (ja) 2021-05-27 2022-05-26 Ａｓｍタンパク質に特異的に結合する抗体を有効成分として含む脳疾患治療用医薬組成物
MX2023014103A MX2023014103A (es) 2021-05-27 2022-05-26 Composicion farmaceutica para prevenir o tratar una enfermedad cerebral y alimento funcional de salud para prevenir o aliviar una enfermedad cerebral que la comprende.
CN202280038237.1A CN117396518A (zh) 2021-05-27 2022-05-26 包含与asm蛋白特异性结合的抗体作为有效成分的用于治疗脑部疾病的药物组合物
IL308738A IL308738A (en) 2021-05-27 2022-05-26 A pharmaceutical preparation containing an antibody that binds specifically to the ASM protein as an active ingredient for the treatment of brain diseases
CA3219114A CA3219114A1 (en) 2021-05-27 2022-05-26 Pharmaceutical composition for treating brain diseases comprising antibody specifically binding to asm protein as active ingredient
EP22811661.2A EP4349865A1 (en) 2021-05-27 2022-05-26 Pharmaceutical composition for treating brain diseases comprising antibody specifically binding to asm protein as active ingredient
CONC2023/0016081A CO2023016081A2 (es) 2021-05-27 2023-11-23 Composición farmacéutica para prevenir o tratar una enfermedad cerebral y alimento funcional de salud para prevenir o aliviar una enfermedad cerebral que la comprende

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR20210068628 2021-05-27
KR10-2021-0068628 2021-05-27
KR1020220057049A KR20220160483A (ko) 2021-05-27 2022-05-10 Asm 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 뇌질환 치료용 약학적 조성물
KR10-2022-0057049 2022-05-10

Publications (1)

Publication Number Publication Date
WO2022250470A1 true WO2022250470A1 (ko) 2022-12-01

Family

ID=84228972

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/007485 WO2022250470A1 (ko) 2021-05-27 2022-05-26 Asm 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 뇌질환 치료용 약학적 조성물

Country Status (12)

Country Link
US (1) US20240254260A1 (ko)
EP (1) EP4349865A1 (ko)
JP (1) JP7484028B1 (ko)
AR (1) AR126038A1 (ko)
AU (1) AU2022279866A1 (ko)
BR (1) BR112023024632A2 (ko)
CA (1) CA3219114A1 (ko)
CO (1) CO2023016081A2 (ko)
IL (1) IL308738A (ko)
MX (1) MX2023014103A (ko)
TW (1) TWI839741B (ko)
WO (1) WO2022250470A1 (ko)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101521117B1 (ko) 2013-05-07 2015-05-18 경북대학교 산학협력단 Ａｓｍ 억제제를 유효성분으로 포함하는 퇴행성 신경질환의 예방 또는 치료용 조성물
US20200255839A1 (en) * 2013-05-07 2020-08-13 Kyungpook National University Industry - Academic Cooperation Foundation Method for treating a degenerative neurological disorders comprising administering asm inhibitor

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022250520A1 (ko) * 2021-05-27 2022-12-01 주식회사 이수앱지스 Asm 단백질에 특이적으로 결합하는 항체

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101521117B1 (ko) 2013-05-07 2015-05-18 경북대학교 산학협력단 Ａｓｍ 억제제를 유효성분으로 포함하는 퇴행성 신경질환의 예방 또는 치료용 조성물
US20200255839A1 (en) * 2013-05-07 2020-08-13 Kyungpook National University Industry - Academic Cooperation Foundation Method for treating a degenerative neurological disorders comprising administering asm inhibitor

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
"Merck Index", MERCK & CO. INC.
HYUN DUK YANG: "Isu Abxis’ ISU203, a novel anti-ASM monoclonal antibody for alzheimer’s", 19 November 2021 (2021-11-19), pages 1 - 2, XP093007549, Retrieved from the Internet <URL:https://www.dementianews.co.kr/news/articleView.html?idxno=4565> [retrieved on 20221213] *
LEE HAN-SOO: "ISU Abxis, Kyungpook National University to co-develop Alzheimer's disease treatment", 9 July 2019 (2019-07-09), pages 1 - 1, XP093007520, Retrieved from the Internet <URL:http://www.koreabiomed.com/news/articleView.html?idxno=6076> [retrieved on 20221213] *
LEE JONG KIL, JIN HEE KYUNG, PARK MIN HEE, KIM BO-RA, LEE PHIL HYU, NAKAUCHI HIROMITSU, CARTER JANET E., HE XINGXUAN, SCHUCHMAN ED: "Acid sphingomyelinase modulates the autophagic process by controlling lysosomal biogenesis in Alzheimer’s disease", JOURNAL OF EXPERIMENTAL MEDICINE, vol. 211, no. 8, 28 July 2014 (2014-07-28), US , pages 1551 - 1570, XP093007524, ISSN: 0022-1007, DOI: 10.1084/jem.20132451 *
NIZIOLEK GRACE M., HOEHN RICHARD S., SEITZ AARON P., JERNIGAN PETER L., MAKLEY AMY T., GULBINS ERICH, EDWARDS MICHAEL J., GOODMAN : "The Role of Acid Sphingomyelinase Inhibition in Repetitive Mild Traumatic Brain Injury", JOURNAL OF SURGICAL RESEARCH, vol. 259, 1 March 2021 (2021-03-01), US , pages 296 - 304, XP093007527, ISSN: 0022-4804, DOI: 10.1016/j.jss.2020.09.034 *
PARK MIN HEE, JIN HEE KYUNG, BAE JAE-SUNG: "Potential therapeutic target for aging and age-related neurodegenerative diseases: the role of acid sphingomyelinase", EXPERIMENTAL AND MOLECULAR MEDICINE, vol. 52, no. 3, 1 March 2020 (2020-03-01), KR , pages 380 - 389, XP093007523, ISSN: 1226-3613, DOI: 10.1038/s12276-020-0399-8 *
ZHOU YAN-FENG, METCALF MATTHEW C., GARMAN SCOTT C., EDMUNDS TIM, QIU HUAWEI, WEI RONNIE R.: "Human acid sphingomyelinase structures provide insight to molecular basis of Niemann–Pick disease", NATURE COMMUNICATIONS, vol. 7, no. 1, 1 December 2016 (2016-12-01), pages 1 - 10, XP093007529, DOI: 10.1038/ncomms13082 *

Also Published As

Publication number Publication date
TW202246355A (zh) 2022-12-01
TWI839741B (zh) 2024-04-21
IL308738A (en) 2024-01-01
JP2024521163A (ja) 2024-05-28
EP4349865A1 (en) 2024-04-10
CO2023016081A2 (es) 2023-12-11
MX2023014103A (es) 2023-12-11
CA3219114A1 (en) 2022-12-01
AR126038A1 (es) 2023-09-06
BR112023024632A2 (pt) 2024-02-27
JP7484028B1 (ja) 2024-05-15
US20240254260A1 (en) 2024-08-01
AU2022279866A1 (en) 2023-12-14

Similar Documents

Publication Publication Date Title
AU2016346864B2 (en) Long-acting FGF21 fusion proteins and pharmaceutical composition comprising same
WO2021010621A1 (ko) 자가면역질환 및 염증성질환 펩타이드 치료제
WO2018169282A2 (ko) Atpif1을 함유하는 당뇨 치료용 약학조성물
WO2016114633A1 (en) Long-acting fgf21 fusion proteins and pharmaceutical composition comprising the same
WO2021167324A1 (en) Improved cell-permeable nuclear import inhibitor synthetic peptide for inhibition of cytokine storm or inflammatory disease and use thereof
KR20220160483A (ko) Asm 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 뇌질환 치료용 약학적 조성물
WO2018131893A1 (ko) 안정한 액체 제제
WO2019045477A1 (ko) 비멘틴 유래 펩타이드에 특이적으로 결합하는 물질을 포함하는 피부질환 예방 및 치료용 조성물
WO2022220632A1 (ko) 세포 투과 펩티드, 항암 펩티드 및 이를 포함하는 암 예방 또는 치료용 약학적 조성물
WO2019235856A1 (ko) Tie2에 결합하는 항체 및 이의 용도
WO2022250470A1 (ko) Asm 단백질에 특이적으로 결합하는 항체를 유효성분으로 포함하는 뇌질환 치료용 약학적 조성물
WO2021107603A2 (en) Long-acting gdf15 fusion protein and pharmaceutical composition comprising same
WO2023214833A1 (ko) Glp-1, 면역글로불린 fc, 및 igf-1을 포함하는 융합단백질 및 이의 용도
WO2017074013A1 (ko) 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도
WO2022250520A1 (ko) Asm 단백질에 특이적으로 결합하는 항체
WO2022050778A1 (en) Improved cell-permeable modified parkin recombinant protein for treatment of neurodegenerative diseases and use thereof
WO2018021778A1 (ko) Lrg1 당단백질을 포함하는 융합 단백질을 함유하는 발기부전, 허혈성 질환 또는 말초 신경질환의 예방 또는 치료용 조성물
WO2021029746A2 (ko) 항-tie2 항체 및 이의 용도
WO2019088658A1 (ko) Scf 및 갈렉틴-1을 표적으로 하는 이중표적항체 및 그 용도
WO2018124851A1 (ko) L1cam 단백질에 특이적으로 결합하는 항체; 및 피리미딘 유사체 및/또는 플라틴계 항암제를 포함하는 암의 예방 또는 치료용 약학적 조성물
WO2023128550A1 (ko) Asm에 특이적으로 결합하는 항체 및 이의 용도
WO2024010373A1 (ko) IgE-의존성 히스타민 방출인자와 결합하는 항체 및 이의 용도
WO2023214778A1 (ko) 항-cd300c 항체 또는 이의 항원 결합 단편 및 그의 퇴행성 뇌 질환 예방 또는 치료용 용도
WO2022245183A1 (en) Composition for preventing or treating non-alcoholic fatty liver disease or non-alcoholic steatohepatitis comprising growth differentiation factor-15 variant
WO2023234743A1 (ko) 항-tigit 항체를 포함하는 이중 특이적 항체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22811661

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 202392916

Country of ref document: EA

Ref document number: 3219114

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 202317078356

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 308738

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: NC2023/0016081

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 2023572865

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 202280038237.1

Country of ref document: CN

Ref document number: 18564378

Country of ref document: US

Ref document number: MX/A/2023/014103

Country of ref document: MX

Ref document number: 2022279866

Country of ref document: AU

Ref document number: AU2022279866

Country of ref document: AU

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023024632

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2022279866

Country of ref document: AU

Date of ref document: 20220526

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2022811661

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2022811661

Country of ref document: EP

Effective date: 20240102

ENP Entry into the national phase

Ref document number: 112023024632

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20231124

WWE Wipo information: entry into national phase

Ref document number: 11202308854Q

Country of ref document: SG