WO2022192478A1 - Bifunctional degraders of galactose-deficient immunoglobulins - Google Patents
Bifunctional degraders of galactose-deficient immunoglobulins Download PDFInfo
- Publication number
- WO2022192478A1 WO2022192478A1 PCT/US2022/019658 US2022019658W WO2022192478A1 WO 2022192478 A1 WO2022192478 A1 WO 2022192478A1 US 2022019658 W US2022019658 W US 2022019658W WO 2022192478 A1 WO2022192478 A1 WO 2022192478A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- group
- optionally substituted
- groups
- moiety
- independently
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/549—Sugars, nucleosides, nucleotides or nucleic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
Definitions
- the present invention relates to bifunctional molecules which contain a circulating protein binding moiety linked through a linker group to a cellular receptor binding moiety.
- IgA nephropathy is an autoimmune disease characterized by circulating nephritogenic immune complexes composed of galactose-deficient IgA1 (Gd-IgA1) and a glycan-specific IgG antibody. These immune complexes accumulate in the glomerular mesangium and induce the mesangioproliferative glomerulonephritis characteristic of IgAN, a cause of kidney injury.
- IgAN is the most common form of primary glomerulonephritis in the world that currently has no treatment. Thus, there remains a need in new medicines capable of treating or slowing down progression of the disease.
- SUMMARY OF THE INVENTION [0005] The present invention is directed to bifunctional molecules capable of binding and degrading galactose-deficient immunoglobulins.
- an agent including: a glycan-specific IgG antibody moiety, a cellular receptor binding moiety which binds to hepatocytes or other degrading cells through asialoglycoprotein (ASGPR) receptors of hepatocytes or other cell receptors which are on the surface degrading cells in a patient or subject, and optionally a linker moiety connecting the glycan-specific IgG antibody moiety and the cellular receptor binding moiety.
- ASGPR asialoglycoprotein
- first, second, third etc. may be used herein to describe various elements, components, regions, layers, and/or sections, these elements, components, regions, layers, and/or sections should not be limited by these terms. These terms are only used to distinguish one element, component, region, layer, or section from another element, component, region, layer, or section. Thus, a first element, component, region, layer, or section discussed below could be termed a second element, component, region, layer, or section without departing from the teachings of the present embodiments.
- an agent including: an antibody binding moiety, a cellular receptor binding moiety which binds to hepatocytes or other degrading cells through asialoglycoprotein (ASGPR) receptors of hepatocytes or other cell receptors which are on the surface degrading cells in a patient or subject, and optionally a linker moiety linking the antibody moiety and the cellular receptor binding moiety.
- the antibody binding moiety may be a glycan-specific IgG antibody moiety.
- the glycan- specific IgG antibody moiety may be configured to bind to a galactose-deficient IgA1 (Gd-IgA1).
- the glycan-specific IgG antibody moiety may be a recombinant IgG antibody moiety (rIgG).
- the glycan-specific IgG antibody moiety may be isolated from sera of a IgA nephropathy patient.
- the presently claimed bifunctional compounds selectively bind to a galactose-deficient IgA1 in circulation and form a protein complex that then binds a cellular receptor and is endocytosed and degraded.
- the galactose-deficient IgA1 is eliminated from circulation by hepatocytes, macrophages, or another cell type, thus resulting in lowered level of the galactose-deficient IgA1 with the potential of attenuating the IgAN symptoms.
- the galactose-deficient IgA1 may be eliminated, resulting in substantially reduced symptoms or even a cure or elimination of IgAN.
- the present disclosure provides agents having a structure of: R CN ⁇ (Xaa)y ⁇ R CC , , , or or a salt thereof.
- an agent has the structure of or a salt thereof.
- an agent has the structure of b or a salt thereof. In some embodiments, an agent has the structure of or a salt thereof. In some embodiments, an agent has the structure of or a salt thereof. In some embodiments, each cellular receptor binding moiety independently has the structure of ⁇ (R CN ⁇ (Xaa)y ⁇ R CC ) or salt form thereof. In the above structures, a, b, and c may independently be an integer of 1 or greater. [0022] In some embodiments, an antibody binding moiety is a universal antibody binding moiety. [0023] In some embodiments, an antibody binding moiety comprises one or more amino acid residues. In some embodiments, an antibody binding moiety is or comprises a peptide moiety.
- an antibody binding moiety is or comprises a cyclic peptide moiety. In some embodiments, such antibody binding moiety comprises one or more natural amino acid residues. In some embodiments, such antibody binding moiety comprises one or more unnatural natural amino acid residues. [0024] In some embodiments, an antibody-binding moiety is a cyclic peptide moiety. In some embodiments, an antibody binding moiety is or comprises or a salt form thereof. In some embodiments, an antibody binding moiety is or a salt form thereof. In some embodiments, each antibody binding moiety in an agent independently is or comprises or a salt form thereof. In some embodiments, each antibody binding moiety in an ( ) agent is independently or a salt form thereof.
- each antibody binding moiety in an agent is of the same antibody binding moiety or a salt thereof.
- the present disclosure provides a compound of formula I-a: , or a salt thereof, wherein: each Xaa is independently a residue of an amino acid or an amino acid analog; t is 0-50; z is 1-50; L is a linker moiety; TBT is a cellular receptor binding moiety; each R c is independently ⁇ L a ⁇ R’; each of a and b is independently 1-200; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ ,
- a is 1. In some embodiments, b is 3. In some embodiments, a is 1 and b is 3, and a compound of formula I-a has the structure of .
- each residue, e.g., Xaa is independently a residue of an amino acid or an amino acid analog, wherein the amino acid or the amino acid analog has the structure of H ⁇ L a1 ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ L a2 ⁇ H or a salt thereof.
- an amino acid has the structure of NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH or a salt thereof.
- an amino acid analog has the structure of H ⁇ L a1 ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ L a2 ⁇ H or a salt thereof.
- the first ⁇ L a1 ⁇ (bonded to –H in the formula) is not ⁇ N(R a1 ) ⁇ (e.g., is optionally substituted bivalent C 1-6 aliphatic).
- each residue e.g., each Xaa in formula I-a, is independently a residue of an amino acid having the structure of formula A-I.
- each Xaa independently has the structure of ⁇ L a1 ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ L a2 ⁇ . In some embodiments, each Xaa independently has the structure of – L aX1 ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ L aX2 ⁇ , wherein L aX1 is optionally substituted ⁇ NH ⁇ , optionally substituted ⁇ CH 2 ⁇ , ⁇ N(R a1 ) ⁇ , or ⁇ S ⁇ , L aX2 is optionally substituted ⁇ NH ⁇ , optionally substituted ⁇ CH 2 ⁇ , ⁇ N(R a1 ) ⁇ , or ⁇ S ⁇ , and each other variable is independently as described herein.
- L aX1 is optionally substituted ⁇ NH ⁇ , or ⁇ N(R a1 ) ⁇ . In some embodiments, L aX1 is optionally substituted ⁇ CH 2 ⁇ , or ⁇ S ⁇ . In some embodiments, L aX2 is optionally substituted ⁇ NH ⁇ , optionally substituted ⁇ CH 2 ⁇ , ⁇ N(R a1 ) ⁇ , or ⁇ S ⁇ . In some embodiments, optionally substituted ⁇ CH 2 ⁇ is ⁇ C(O) ⁇ . In some embodiments, optionally substituted ⁇ CH 2 ⁇ is not ⁇ C(O) ⁇ . In some embodiments, L aX2 is ⁇ C(O) ⁇ .
- each Xaa independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ .
- two or more residues e.g., two or more Xaa residues
- Residues can be linked, optionally through a linker (e.g., L T ) at any suitable positions.
- a linkage between two residues can connect each residue independently at its N-terminus, C-terminus, a point on the backbone, or a point on a side chain, etc.
- two or more side chains of residues are optionally take together to form a bridge, e.g., in some embodiments, two cysteine residues form a ⁇ S ⁇ S ⁇ bridge as typically observed in natural proteins.
- a formed bridge has the structure of L b , wherein L b is L a as described in the present disclosure.
- each end of L b independently connects to a backbone atom of a cyclic peptide (e.g., a ring atom of the ring formed by ⁇ (Xaa) z ⁇ in formula I-a).
- L b comprises an R group (e.g., when a methylene unit of L b is replaced with ⁇ C(R) 2 ⁇ or ⁇ N(R) ⁇ ), wherein the R group is taken together with an R group attached to a backbone atom (e.g., R a1 , R a2 , R a3 , etc. if being R) and their intervening atoms to form a ring.
- L b connects to a ring, e.g., the ring formed by ⁇ (Xaa) z ⁇ in formula I-a through a side chain of an amino acid residue (e.g., Xaa in formula I-a).
- a side chain comprises an amino group or a carboxylic acid group.
- L T is L b as described herein.
- a linkage e.g., L b or L T , connects a side chain with a N-terminus or a C-terminus of a residue.
- a linkage connects a side chain with an amino group of a residue.
- a linkage connects a side chain with an alpha-amino group of a residue.
- a linkage e.g., L b or L T
- L b or L T is ⁇ CH 2 ⁇ C(O) ⁇ .
- the ⁇ CH 2 ⁇ is bonded to a side chain, e.g., bound to ⁇ S ⁇ of a cysteine residue, and the ⁇ C(O) ⁇ is bonded to an amino group, e.g., an alpha-amino group of a residue.
- a linkage e.g., L b or L T
- L b or L T is optionally substituted ⁇ CH 2 ⁇ S ⁇ CH 2 ⁇ C(O) ⁇ NH ⁇ , wherein each end is bonded to the alpha-carbon of a residue.
- the ⁇ NH ⁇ is of an alpha-amino group of a residue, e.g., of a N-terminal residue.
- is an antibody binding moiety binds to an antibody).
- is a universal antibody binding moiety. is a universal antibody binding moiety which can bind to antibodies having different Fab regions.
- an antibody binding moiety that can bind to a Fc region.
- an antibody binding moiety e.g., a universal antibody binding moiety having the structure of
- an antibody binding moiety, e.g., of an antibody binding moiety having the structure of has the structure of
- R has the structure of .
- the present disclosure provides a compound of formula II: or a pharmaceutically acceptable salt thereof, wherein: each of R 1 , R 3 and R 5 is independently hydrogen or an optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or: R 1 and R 1’ are optionally taken together with their intervening carbon atom to form a 3-8 membered optionally substituted group selected from C 1-6 aliphatic,
- an amino acid has the structure of formula A-I: NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH, A-I or a salt thereof, wherein: each of R a1 , R a2 , R a3 is independently ⁇ L a ⁇ R’; each of L a1 and L a2 is independently L a ; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇
- a residue has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COO ⁇ or a salt form thereof.
- an amino acid analog is a compound in which the amino group and/or carboxylic acid group are independently replaced with an optionally substituted aliphatic or heteroaliphatic moiety. As those skilled in the art will appreciate, many amino acid analogs, which mimics structures, properties and/or functions of amino acids, are described in the art and can be utilized in accordance with the present disclosure, e.g., in various moieties.
- one or more peptide groups are optionally and independently replaced with non-peptide groups.
- an amino acid moiety in a polypeptide or peptide is replaced with an amino acid analog moiety.
- MATES the present disclosure provides an agent comprising: an antibody moiety, a cellular receptor binding moiety, and optionally a linker moiety linking an antibody moiety and a cellular receptor binding moiety.
- Such an agent may be referred to as a MATE agent or MATE.
- the MATE agents are described, for example, in International Application No. PCT/US2020/061127 filed November 18, 2020 and U.S.
- an agent comprises an antibody moiety, a cellular receptor binding moiety, and a linker moiety linking an antibody moiety and a cellular receptor binding moiety.
- the antibody binding moiety may be a glycan-specific IgG antibody moiety.
- the glycan-specific IgG antibody moiety may be configured to bind to a galactose-deficient IgA1 (Gd-IgA1).
- the glycan-specific IgG antibody moiety may be a recombinant IgG antibody moiety (rIgG).
- the glycan-specific IgG antibody moiety may be isolated from sera of a IgA nephropathy patient.
- an agent has the structure of formula M-I: , M-I or a pharmaceutically acceptable salt thereof, wherein: each of a, b and c is independently 1-200; each AT is independently an antibody moiety; L is a linker moiety; and each TBT is independently a cellular receptor binding moiety.
- an agent has the structure of formula M-II: , M-II or a pharmaceutically acceptable salt thereof, wherein: each of a and b is independently 1-200; each AT is independently an antibody moiety; L is a linker moiety; and each TBT is independently a cellular receptor binding moiety.
- an agent comprises one and no more than one antibody moiety. In some embodiments, one or no more than one antibody moiety is bound to a linker moiety. In some embodiments, a is 1. In some embodiments, an agent comprises two or more antibody moieties. In some embodiments, two or more antibody moieties are bound to a single linker moiety. In some embodiments, a is 2 or more.
- one and no more than one cellular receptor binding moiety is bonded to a linker moiety.
- b is 1.
- two or more cellular receptor binding moiety is bonded to a single linker moiety.
- b is 2 or more.
- an agent comprises one and no more than one cellular receptor binding moiety.
- c is 1.
- b is 1 and c is 1.
- a is 1, b is 1 and c is 1.
- an agent comprises two or more target binding moieties.
- b is 2 or more and c is 1.
- b is 2 or more and c is 2 or more.
- b is 1 and c is 2 or more.
- c is 1-20, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
- c is 1-15.
- c is 1-10.
- c is 1-9.
- c is 1-8.
- c is 1-7.
- c is 1-6.
- c is 1-5.
- c is 1-4.
- c is 1-3.
- c is 1-2.
- c is 1. In some embodiments, c is 2.
- each cellular receptor binding moiety in an agent is the same.
- each linker moiety connecting a cellular receptor binding moiety to an antibody moiety is the same.
- TBT in an agent are the same.
- ⁇ L ⁇ (TBT) b are the same.
- b is 1.
- c is 1.
- c is two or more.
- c is 2.
- target binding moieties are connected to antibody moieties through certain types groups and/or amino acid residues.
- target binding moieties are connected to lysine residues optionally through linker moieties.
- target binding moieties are connected to cysteine residues optionally through linker moieties.
- target binding moieties are connected to unnatural amino acid residues optionally through linker moieties.
- the present disclosure provides technologies for selectively linking target binding moieties to certain particular amino acid residues optionally through linker moieties.
- provided technologies selectively connect target binding moieties to certain types of amino acid residues, e.g., lysine residues, optionally through linker moieties.
- provided technologies selectively connect target binding moieties to particular sites of antibody moieties optionally through linker moieties.
- provided technologies selectively connect target binding moieties to certain types of amino acid residues at particular sites optionally through linker moieties.
- target binding moieties are connected to K246 and K248 of an IgG1 heavy chain and amino acid residues corresponding thereto optionally through linker moieties.
- target binding moieties are connected to K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto optionally through linker moieties.
- target binding moieties are connected to K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto optionally through linker moieties.
- a cellular receptor binding moiety is connected to a particular amino acid residue or site optionally through a linker.
- each cellular receptor binding moiety is independently connected to a particular amino acid residue or site optionally through a linker.
- an antibody agent may comprise more than one particular sites (e.g., one on each of the more than one chain (e.g., one or each heavy chain)).
- an antibody moiety comprise two heavy chains and one or both of the amino acid residues or amino acid residues corresponding thereto are each independently connected to a cellular receptor binding moiety optionally through a linker.
- one and no more than one is connected.
- c is 1. In some embodiments, both are connected. In some embodiments, c is 2.
- both target binding moieties and/or both linker moieties are the same.
- Antibody Binding Moieties [0041] Various antibody binding moieties including universal antibody binding moieties can be utilized in accordance with the present disclosure. Certain antibody binding moieties and technologies for identifying and/or assessing antibody binding moieties are described in WO2019/023501 and WO2019/136442, each of which is incorporated herein in its entirety by reference. Those skilled in the art appreciates that additional technologies in the art may be suitable for identifying and/or assessing antibody binding moieties in accordance with the present disclosure. In some embodiments, an antibody binding moiety comprises one or more amino acid residues, each independently natural or unnatural.
- an antibody binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)), has the structure of or a salt form thereof, wherein: each of R 1 , R 3 and R 5 is independently hydrogen or an optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or: R 1 and R 1’ are optionally
- L 1 is an optionally substituted trivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- an antibody binding moiety e.g. a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)), has the structure of R or a salt form thereof, wherein: each of R 7 is independently hydrogen or an optionally substituted group selected from C 1-6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring
- an antibody binding moiety e.g., a universal antibody binding moiety is or comprises a peptide moiety, e.g., a moiety having the structure of R c ⁇ (Xaa)z ⁇ or a salt form thereof, wherein each of R c , z and Xaa is independently as described herein.
- one or more Xaa are independently an unnatural amino acid residue.
- side chains of two or more amino acid residues may be linked together to form bridges.
- side chains of two cysteine residues may form a disulfide bridge comprising ⁇ S ⁇ S ⁇ (which, as in many proteins, can be formed by two ⁇ SH groups).
- an antibody binding moiety e.g. a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)), is or comprises a cyclic peptide moiety, e.g., a moiety having the structure of or a salt form thereof, wherein: each Xaa is independently a residue of an amino acid or an amino acid analog; t is 0-50; z is 1-50; each R c is independently ⁇ L a ⁇ R’; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C
- a heteroatom is independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- an antibody binding moiety is or comprises R c ⁇ (Xaa)z ⁇ or a salt form thereof, wherein each variable is as described herein.
- a protein binding moiety is or comprises R c ⁇ (Xaa)z ⁇ or a salt form thereof, wherein each variable is as described herein.
- an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises R c ⁇ (Xaa)z ⁇ or a salt form thereof, wherein each variable is as described herein.
- an antibody binding moiety is or comprises or a salt form thereof, wherein each variable is as described herein.
- a protein binding moiety is or comprises or a salt form thereof, wherein each variable is as described herein.
- an antibody binding moiety, e.g., a universal antibody binding moiety is or comprises ( or a salt form thereof, wherein each variable is as described herein.
- an antibody binding moiety, e.g., a universal antibody binding moiety is R c ⁇ (Xaa)z ⁇ or , or a salt form thereof, and is or comprises a peptide unit.
- ⁇ (Xaa)z ⁇ is or comprises a peptide unit.
- amino acid residues may form bridges, e.g., connections formed by side chains optionally through linker moieties (e.g., L); for example, as in many polypeptides, cysteine residues may form disulfide bridges.
- a peptide unit comprises an amino acid residue (e.g., at physiological pH about 7.4, “positively charged amino acid residue”, Xaa P ), e.g., a residue of an amino acid of formula A-I that has a positively charged side chain.
- a peptide unit comprises R.
- at least one Xaa is R.
- a peptide unit is or comprises APAR.
- a peptide unit is or comprises RAPA.
- a peptide unit comprises an amino acid residue, e.g., a residue of an amino acid of formula A-I, that has a side chain comprising an aromatic group (“aromatic amino acid residue”, Xaa A ).
- a peptide unit comprises a positively charged amino acid residue and an aromatic amino acid residue.
- a peptide unit comprises W.
- a peptide unit comprises a positively charged amino acid residue and an aromatic amino acid residue.
- a peptide unit is or comprises Xaa A XaaXaa P Xaa P .
- a peptide unit is or comprises Xaa P Xaa P XaaXaa A . In some embodiments, a peptide unit is or comprises Xaa P Xaa A Xaa P . In some embodiments, a peptide unit is or comprises two or more Xaa P Xaa A Xaa P . In some embodiments, a peptide unit is or comprises Xaa P Xaa A Xaa P XaaXaa P Xaa A Xaa P . In some embodiments, a peptide unit is or comprises Xaa P Xaa P Xaa A Xaa P .
- a peptide unit is or comprises Xaa P Xaa P Xaa P Xaa A . In some embodiments, a peptide unit is or comprises two or more Xaa A Xaa A Xaa P . In some embodiments, a peptide residue comprises one or more proline residues. In some embodiments, a peptide unit is or comprises HWRGWA. In some embodiments, a peptide unit is or comprises WGRR. In some embodiments, a peptide unit is or comprises RRGW. In some embodiments, a peptide unit is or comprises NKFRGKYK. In some embodiments, a peptide unit is or comprises NRFRGKYK.
- a peptide unit is or comprises NARKFYK. In some embodiments, a peptide unit is or comprises NARKFYKG. In some embodiments, a peptide unit is or comprises HWRGWV. In some embodiments, a peptide unit is or comprises KHFRNKD. In some embodiments, a peptide unit comprises a positively charged amino acid residue, an aromatic amino acid residue, and an amino acid residue, e.g., a residue of an amino acid of formula A-I, that has a negatively charged side chain (e.g., at physiological pH about 7.4, “negatively charged amino acid residue”, Xaa N ). In some embodiments, a peptide unit comprises RHRFNKD.
- a peptide unit is RHRFNKD. In some embodiments, a peptide unit comprises TY. In some embodiments, a peptide unit is TY. In some embodiments, a peptide unit comprises TYK. In some embodiments, a peptide unit is TYK. In some embodiments, a peptide unit comprises RTY. In some embodiments, a peptide unit is RTY. In some embodiments, a peptide unit comprises RTYK. In some embodiments, a peptide unit is RTYK. In some embodiments, a peptide unit is or comprises a sequence selected from PAM. In some embodiments, a peptide unit comprises WHL.
- a peptide unit is WHL. In some embodiments, a peptide unit is or comprises WXL, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.). In some embodiments, a peptide unit comprises WDL. In some embodiments, a peptide unit is WDL. In some embodiments, a peptide unit comprises ELVW. In some embodiments, a peptide unit is ELVW. In some embodiments, a peptide unit comprises GELVW. In some embodiments, a peptide unit is GELVW.
- a peptide unit is or comprises a sequence selected from AWHLGELVW. In some embodiments, a peptide unit is or comprises AWHLGELVW. In some embodiments, a peptide unit is or comprises a sequence selected from AWDLGELVW. In some embodiments, a peptide unit is or comprises AWDLGELVW. In some embodiments, a peptide unit is or comprises AWXLGELVW, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises a sequence selected from DCAWHLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises DCAWHLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from DCAWXLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises DCAWXLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins
- X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- X comprises ⁇ COOH or a salt or activated form thereof in its side chain.
- a peptide unit is or comprises a sequence selected from DCAWDLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises DCAWDLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from Fc-III.
- a peptide unit is or comprises Fc-III.
- a peptide unit is or comprises a sequence selected from D P L PAWXLGELVW, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises D P L PAWXLGELVW, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises a sequence selected from D P L PAWDLGELVW.
- a peptide unit is or comprises D P L PAWDLGELVW.
- a peptide unit is or comprises a sequence selected from D P L PAWHLGELVW, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises D P L PAWHLGELVW (e.g., FcBP-1), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from FcBP-1.
- a peptide unit is or comprises a sequence selected from D P L PDCAWXLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises D P L PDCAWXLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises a sequence selected from D P L PDCAWHLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises D P L PDCAWHLGELVWCT (e.g., FcBP-2), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from D P L PDCAWDLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises D P L PDCAWDLGELVWCT, wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
- a peptide unit is or comprises a sequence selected from FcBP-2.
- a peptide unit is or comprises a sequence selected from CDCAWXLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises CDCAWXLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising ⁇ COOH or a salt or activated form thereof such as D, E, etc.).
- a peptide unit is or comprises a sequence selected from CDCAWHLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
- a peptide unit is or comprises CDCAWHLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
- a peptide unit is or comprises a sequence selected from CDCAWDLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
- a peptide unit is or comprises CDCAWDLGELVWCTC, wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
- a peptide unit is or comprises a sequence selected from Fc-III-4c.
- a peptide unit is or comprises a sequence selected from FcRM.
- a peptide unit is or comprises a cyclic peptide unit.
- a cyclic peptide unit comprises amide group formed by an amino group of a side chain and the C-terminus ⁇ COOH. It is appreciated by those skilled in the art that in various embodiments, when a peptide unit is connected to another moiety, an amino acid residue of a peptide unit may be connected through various positions, e.g., its backbone, its side chain, etc. In some embodiments, an amino acid residue is modified for connection. In some embodiments, an amino acid residue is replaced with another suitable residue for connection while maintaining one or more properties and/or activities a peptide unit (e.g., binding to an antibody as described herein).
- an amino acid residue is replaced with an amino acid residue with a side chain comprising ⁇ COOH or a salt or activated form thereof (e.g., side chain being ⁇ CH 2 ⁇ COOH or a salt or activated form thereof).
- H may be replaced with D (e.g., in various peptide units comprising WHL).
- a peptide unit is connected to another moiety through ⁇ COOH or a salt or activated form thereof, e.g., through formation of e.g., ⁇ CON(R’) ⁇ .
- R’ is ⁇ H.
- ⁇ COOH is in a side chain of an amino acid residue.
- 1-5 e.g., 1, 2, 3, 4, or 5 amino acid residues may be independently and optionally replaced with another amino acid residue
- 1-5 e.g., 1, 2, 3, 4, or 5 amino acid residues may be independently and optionally deleted
- 1-5 e.g., 1, 2, 3, 4, or 5 amino acid residues may be independently and optionally inserted.
- a peptide moiety is connected to the rest of a molecule through its N-terminus. In some embodiments, it is connected to the rest of a molecule through its C-terminus.
- the total number of replacements, deletions and insertions is no more than 10 (e.g., 0, or no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10). In some embodiments, the total number is 0. In some embodiments, the total number is no more than 1. In some embodiments, the total number is no more than 2. In some embodiments, the total number is no more than 3. In some embodiments, the total number is no more than 4. In some embodiments, the total number is no more than 5.
- an antibody binding moiety comprises or has the structure of DCAWHLGELVWCT or a salt form thereof, wherein the two C residues are linked by a ⁇ S ⁇ S ⁇ . In some embodiments, an antibody binding moiety comprises or has the structure of DCAWHLGELVWCT or a salt form thereof, wherein the N-terminus is capped with R ⁇ C(O) ⁇ .
- ⁇ (Xaa)z ⁇ is or comprises [X 1 ] p1 [X 2 ] p2 -X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 -[X 13 ] p13 - [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 , wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently an amino acid residue, e.g., of an amino acid of formula A-I, and each of p1, p2, p13, p14, p
- each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently an amino acid residue of an amino acid of formula A-I. In some embodiments, each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently a natural amino acid residue.
- X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 are independently an unnatural amino acid residue as described in the present disclosure.
- a peptide unit comprises a functional group in an amino acid residue that can react with a functional group of another amino acid residue.
- a peptide unit comprises an amino acid residue with a side chain which comprises a functional group that can react with another functional group of the side chain of another amino acid residue to form a linkage (e.g., see moieties described in Table A-1, Table 1, etc.).
- one functional group of one amino acid residue is connected to a functional group of another amino acid residue to form a linkage (or bridge).
- Linkages are bonded to backbone atoms of peptide units and comprise no backbone atoms.
- a peptide unit comprises a linkage formed by two side chains of non- neighboring amino acid residues.
- a linkage is bonded to two backbone atoms of two non-neighboring amino acid residues. In some embodiments, both backbone atoms bonded to a linkage are carbon atoms. In some embodiments, a linkage has the structure of L b , wherein L b is L a as described in the present disclosure, wherein L a is not a covalent bond. In some embodiments, L a comprises ⁇ Cy ⁇ . In some embodiments, L a comprises ⁇ Cy ⁇ , wherein ⁇ Cy ⁇ is optionally substituted heteroaryl. In some embodiments, ⁇ Cy ⁇ is . In some embodim a ents, L is .
- such an L a can be formed by a ⁇ N 3 group of the side chain of one amino acid residue, and the ⁇ of the side chain of another amino acid residue.
- a linkage is formed through connection of two thiol groups, e.g., of two cysteine residues.
- L a comprises ⁇ S ⁇ S ⁇ .
- L a is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ .
- a linkage is formed through connection of an amino group (e.g., ⁇ NH 2 in the side chain of a lysine residue) and a carboxylic acid group (e.g., ⁇ COOH in the side chain of an aspartic acid or glutamic acid residue).
- L a comprises ⁇ C(O) ⁇ N(R’) ⁇ .
- L a comprise ⁇ C(O) ⁇ NH ⁇ .
- L a is ⁇ CH 2 CONH ⁇ (CH 2 ) 3 ⁇ .
- L a comprises ⁇ C(O) ⁇ N(R’) ⁇ , wherein R’ is R, and is taken together with an R group on the peptide backbone to form a ring (e.g., in A-34).
- L a is ⁇ (CH 2 ) 2 ⁇ N(R’) ⁇ CO ⁇ (CH 2 ) 2 ⁇ .
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene.
- L a is .
- L a is .
- L a is optionally substituted bivalent C 2 - 20 bivalent aliphatic.
- two amino acid residues bonded to a linkage are separated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more than 15 amino acid residues between them (excluding the two amino acid residues bonded to the linkage).
- the number is 1. In some embodiments, the number is 2. In some embodiments, the number is 3. In some embodiments, the number is 4. In some embodiments, the number is 5. In some embodiments, the number is 6.
- the number is 7. In some embodiments, the number is 8. In some embodiments, the number is 9. In some embodiments, the number is 10. In some embodiments, the number is 11. In some embodiments, the number is 12. In some embodiments, the number is 13. In some embodiments, the number is 14. In some embodiments, the number is 15. [0053] In some embodiments, each of p1, p2, p13, p14, p15 and p16 is 0.
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 ⁇ , wherein: each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; X 6 is Xaa A or Xaa P ; X 9 is Xaa N ; and X 12 is Xaa A or Xaa P .
- each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- X 5 is Xaa A or Xaa P .
- X 5 is Xaa A .
- X 5 is Xaa P .
- X 5 is an amino acid residue whose side chain comprises an optionally substituted saturated, partially saturated or aromatic ring.
- X 5 is .
- X 5 is .
- X 6 is Xaa A . In some embodiments, X 6 is Xaa P . In some embodiments, X 6 is His. In some embodiments, X 12 is Xaa A . In some embodiments, X 12 is Xaa P . In some embodiments, X 9 is Asp. In some embodiments, X 9 is Glu. In some embodiments, X 12 is . In some embodiments, X 12 is . In some embodiments, each of X 7 , X 10 , and X 11 is independently an amino acid residue with a hydrophobic side chain (“hydrophobic amino acid residue”, Xaa H ). In some embodiments, X 7 is Xaa H .
- X 7 is . In some embodiments, X 7 is Val. In some embodiments, X 10 is Xaa H . In some embodiments, X 10 is Met. In some embodiments, X 10 is . In some embodiments, X 11 is Xaa H . In some embodiments, X 11 is . In some embodiments, X 8 is Gly. In some embodiments, X 4 is Pro. In some embodiments, X 3 is Lys. In some embodiments, the ⁇ COOH of X 12 forms an amide bond with the side chain amino group of Lys (X 3 ), and the other amino group of the Lys (X 3 ) is connected to a linker moiety and then an antibody binding moiety.
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 ⁇ , wherein: each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ; L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇
- each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- two non-neighboring amino acid residues are connected by L b .
- X 5 and X 10 are connected by L b .
- X 6 is Xaa A .
- X 6 is Xaa P .
- X 6 is His.
- X 9 is Asp. In some embodiments, X 9 is Glu. In some embodiments, X 12 is Xaa A . In some embodiments, X 12 is . In some embodiments, X 12 is . In some embodiments, X 12 is . In some embodiments, each of X 4 , X 7 , and X 11 is independently Xaa H . In some embodiments, X 4 is Xaa H . In some embodiments, X 4 is Ala. In some embodiments, X 7 is Xaa H . In some embodiments, X 7 is . In some embodiments, X 11 is Xaa H . In some embodiments, X 11 O is .
- X 8 is Gly.
- X 3 is Lys.
- the ⁇ COOH of X 12 forms an amide bond with the side chain amino group of Lys (X 3 ), and the other amino group of the Lys (X 3 ) is connected to a linker moiety and then an antibody binding moiety.
- L b is .
- L b is .
- L b connects two alpha-carbon atoms of two different amino acid residues.
- both X 5 and X 10 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 ⁇ , wherein: each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ; L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇
- each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- two non-neighboring amino acid residues are connected by L b .
- X 2 and X 12 are connected by L b .
- L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ .
- L b is ⁇ CH 2 ⁇ CH 2 ⁇ S ⁇ CH 2 ⁇ . In some embodiments, L b is . In some embodiments, L b is . In some embodiments, L b is . In some embodiments, L b is ⁇ CH 2 CH 2 CO ⁇ N(R’) ⁇ CH 2 CH 2 ⁇ . In some embodiments, R’ are taken together with an R group on the backbone atom that ⁇ N(R’) ⁇ CH 2 CH 2 ⁇ is bonded to form a ring, e.g., as in A-34. In some embodiments, a formed ring is 3-, 4-, 5-, 6-, 7- or 8-membered. In some embodiments, a formed ring is monocyclic. In some embodiments, a formed ring is saturated.
- L b is . In some embodiments, L b connects two alpha-carbon atoms of two different amino acid residues.
- X 4 is Xaa A . In some embodiments, X 4 is Tyr.
- X 5 is Xaa A . In some embodiments, X 5 is Xaa P . In some embodiments, X 5 is His.
- X 8 is Asp. In some embodiments, X 8 is Glu.
- X 11 is Tyr. In some embodiments, both X 2 and X 12 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- each of X 3 , X 6 , X 9 , and X 10 is independently Xaa H .
- X 3 is Xaa H .
- X 3 is Ala.
- X 6 is Xaa H .
- X 6 is Leu.
- X 9 is Xaa H .
- X 9 is Leu.
- X 9 is .
- X 10 is Xaa H .
- X 10 is Val.
- X 10 is .
- X 7 is Gly.
- p1 is 1.
- X 1 is Asp. In some embodiments, p13 is 1. In some embodiments, p14, p15 and p16 are 0. In some embodiments, X 13 is an amino acid residue comprising a polar uncharged side chain (e.g., at physiological pH, “polar uncharged amino acid residue”, Xaa L ). In some embodiments, X 13 is Thr. In some embodiments, X 13 is Val. In some embodiments, p13 is 0. In some embodiments, R c is ⁇ NHCH 2 CH(OH)CH 3 . In some embodiments, R c is (R) ⁇ NHCH 2 CH(OH)CH 3 .
- R c is (S) ⁇ NHCH 2 CH(OH)CH 3 .
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 ⁇ , wherein: each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ; L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇
- each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- two non-neighboring amino acid residues are connected by L b .
- X 2 and X 12 are connected by L b .
- X 4 and X 9 are connected by L b .
- X 4 and X 10 are connected by L b .
- L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ .
- L b is .
- L b is .
- both X 2 and X 12 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- both X 4 and X 10 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- X 4 and X 9 are connected by L b , wherein L b is .
- X 4 and X 9 are connected by L b , wherein L b is .
- X 5 is Xaa A .
- X 5 is Xaa P .
- X 5 is His.
- X 8 is Asp.
- X 8 is Glu.
- X 11 is Tyr.
- X 11 is .
- X 2 and X 12 are connected by L b , wherein L b is ⁇ CH 2 ⁇ S ⁇ CH 2 CH 2 ⁇ .
- L b connects two alpha-carbon atoms of two different amino acid residues.
- each of X 3 , X 6 , and X 9 is independently Xaa H .
- X 3 is Xaa H .
- X 3 is Ala.
- X 6 is Xaa H .
- X 6 is Leu.
- X 6 is .
- X 9 is Xaa H .
- X 9 is Leu. In some embodiments, X 9 is . In some embodiments, X 10 is Xaa H . In some embodiments, X 10 is Val. In some embodiments, X 7 is Gly. In some embodiments, p1 is 1. In some embodiments, X 1 is Xaa N . In some embodiments, X 1 is Asp. In some embodiments, X 1 is Glu. In some embodiments, p13 is 1. In some embodiments, p14, p15 and p16 are 0. In some embodiments, X 13 is Xaa L . In some embodiments, X 13 is Thr. In some embodiments, X 13 is Val.
- ⁇ (Xaa)z ⁇ is or comprises ⁇ X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 X 16 ⁇ , wherein: each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , and X 16 is independently an amino acid residue; at least two amino acid residues are connected through a linkage L b ; L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇
- each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-I as described in the present disclosure.
- two non-neighboring amino acid residues are connected by L b .
- X 2 are connected to X 16 by L b .
- X 4 are connected to X 14 by L b .
- both X 2 and X 16 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- both X 4 and X 14 are Cys, and the two ⁇ SH groups of their side chains form ⁇ S ⁇ S ⁇ (L b is ⁇ CH 2 ⁇ S ⁇ S ⁇ CH 2 ⁇ ).
- L b connects two alpha-carbon atoms of two different amino acid residues.
- X 3 is Asp.
- X 3 is Glu.
- X 5 is Xaa H . In some embodiments, X 5 is Ala. In some embodiments, X 6 is Xaa A . In some embodiments, X 6 is Tyr. In some embodiments, X 7 is Xaa A . In some embodiments, X 7 is Xaa P . In some embodiments, X 7 is His. In some embodiments, X 8 is Xaa H . In some embodiments, X 8 is Ala. In some embodiments, X 9 is Gly. In some embodiments, X 10 is Asp. In some embodiments, X 10 is Glu. In some embodiments, X 11 is Xaa H . In some embodiments, X 11 is Leu.
- X 12 is Xaa H . In some embodiments, X 12 is Val. In some embodiments, X 13 is Xaa A . In some embodiments, X 13 is Tyr. In some embodiments, X 15 is Xaa L . In some embodiments, X 15 is Thr. In some embodiments, X 15 is Val. In some embodiments, p1 is 1. In some embodiments, In some embodiments, X 1 is Xaa N . In some embodiments, X 1 is Asp. In some embodiments, X 1 is Glu.
- an amino acid residue may be replaced by another amino acid residue having similar properties, e.g., one Xaa H (e.g., Val, Leu, etc.) may be replaced with another Xaa H (e.g., Leu, Ile, Ala, etc.), one Xaa A may be replaced with another Xaa A , one Xaa P may be replaced with another Xaa P , one Xaa N may be replaced with another Xaa N , one Xaa L may be replaced with another Xaa L , etc.
- an antibody binding moiety is or comprises optionally substituted moiety of Table A-1.
- a protein binding moiety is or comprises optionally substituted moiety of Table A-1.
- an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises optionally substituted moiety of Table A-1.
- an antibody binding moiety is selected from able A-1.
- a protein binding moiety is selected from able A-1.
- an antibody binding moiety e.g., a universal antibody binding moiety, is selected from able A-1.
- C-terminus and/or N-terminus are optionally capped (e.g., for C-terminus, by converting ⁇ COOH into ⁇ C(O)N(R’) 2 like ⁇ C(O)NH 2 ; for N-terminus, by adding R’C(O) ⁇ like CH 3 C(O) ⁇ to an amino group).
- Table A-1 Exemplary antibody binding moieties.
- A-1 A-2 Exemplary antibody binding moieties.
- an antibody binding moiety is an antibody binding moiety described herein.
- a protein binding moiety is an antibody binding moiety described herein.
- ⁇ COOH and/or amino groups of amino acid residues e.g., those at the C- terminus or N-terminus, is optionally capped.
- a ⁇ COOH group e.g., a C-terminus ⁇ COOH
- is amidated e.g., converted into ⁇ CON(R’) 2 , e.g., ⁇ C(O)NHR (e.g., ⁇ C(O)NH 2 )
- an amino group e.g.
- an antibody binding moiety is or comprises optionally substituted A- 1.
- an antibody binding moiety is or comprises optionally substituted A-2.
- an antibody binding moiety is or comprises optionally substituted A-3.
- an antibody binding moiety is or comprises optionally substituted A-4.
- an antibody binding moiety is or comprises optionally substituted A-5. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-6. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-7. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-8. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-9. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-10. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-11. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-12. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-13.
- an antibody binding moiety is or comprises optionally substituted A-14. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-15. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-16. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-17. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-18. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-19. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-20. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-21. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-22.
- an antibody binding moiety is or comprises optionally substituted A-23. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-24. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-25. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-26. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-27. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-28. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-29. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-30. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-31.
- an antibody binding moiety is or comprises optionally substituted A-32. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-33. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-34. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-35. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-36. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-37. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-38. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-39. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-40.
- an antibody binding moiety is or comprises optionally substituted A-41. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-42. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-43. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-44. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-45. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-46. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-47. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-48. In some embodiments, an antibody binding moiety is or comprises optionally substituted A-49.
- an antibody binding moiety is or comprises optionally substituted A-50. In some embodiments, such an antibody binding moiety is an antibody binding moiety. In some embodiments, such an antibody binding moiety is a universal antibody binding moiety. [0068] In some embodiments, an antibody binding moiety is A-1. In some embodiments, an antibody binding moiety is A-2. In some embodiments, an antibody binding moiety is A-3. In some embodiments, an antibody binding moiety is A-4. In some embodiments, an antibody binding moiety is A-5. In some embodiments, an antibody binding moiety is A-6. In some embodiments, an antibody binding moiety is A-7. In some embodiments, an antibody binding moiety is A-8. In some embodiments, an antibody binding moiety is A-9.
- an antibody binding moiety is A-10. In some embodiments, an antibody binding moiety is A-11. In some embodiments, an antibody binding moiety is A-12. In some embodiments, an antibody binding moiety is A-13. In some embodiments, an antibody binding moiety is A-14. In some embodiments, an antibody binding moiety is A-15. In some embodiments, an antibody binding moiety is A-16. In some embodiments, an antibody binding moiety is A-17. In some embodiments, an antibody binding moiety is A-18. In some embodiments, an antibody binding moiety is A-19. In some embodiments, an antibody binding moiety is A-20. In some embodiments, an antibody binding moiety is A-21. In some embodiments, an antibody binding moiety is A-22.
- an antibody binding moiety is A-23. In some embodiments, an antibody binding moiety is A-24. In some embodiments, an antibody binding moiety is A-25. In some embodiments, an antibody binding moiety is A-26. In some embodiments, an antibody binding moiety is A-27. In some embodiments, an antibody binding moiety is A-28. In some embodiments, an antibody binding moiety is A-29. In some embodiments, an antibody binding moiety is A-30. In some embodiments, an antibody binding moiety is A-31. In some embodiments, an antibody binding moiety is A-32. In some embodiments, an antibody binding moiety is A-33. In some embodiments, an antibody binding moiety is A-34. In some embodiments, an antibody binding moiety is A-35.
- an antibody binding moiety is A-36. In some embodiments, an antibody binding moiety is A-37. In some embodiments, an antibody binding moiety is A-38. In some embodiments, an antibody binding moiety is A-39. In some embodiments, an antibody binding moiety is A-40. In some embodiments, an antibody binding moiety is A-41. In some embodiments, an antibody binding moiety is A-42. In some embodiments, an antibody binding moiety is A-43. In some embodiments, an antibody binding moiety is A-44. In some embodiments, an antibody binding moiety is A-45. In some embodiments, an antibody binding moiety is A-46. In some embodiments, an antibody binding moiety is A-47.
- an antibody binding moiety is A-48. In some embodiments, an antibody binding moiety is A-49. In some embodiments, such an antibody binding moiety is an antibody binding moiety. In some embodiments, such an antibody binding moiety is a universal antibody binding moiety.
- an antibody binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to a linker moiety through the C-terminus of the peptide unit. In some embodiments, it is connected to a linker moiety through the N-terminus of the peptide unit.
- an antibody binding moiety e.g., a universal antibody binding moiety comprises a peptide unit, and is connected to an antibody binding moiety optionally through a linker moiety through the C-terminus of the peptide unit.
- an antibody binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to an antibody binding moiety optionally through a linker moiety through the N- terminus of the peptide unit.
- an antibody binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to an antibody binding moiety optionally through a linker moiety through a side chain of the peptide unit.
- an antibody binding moiety is or comprises (DCAWHLGELVWCT) ⁇ , wherein 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally replaced with another amino acid residue, 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted, and/or 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted.
- it is connected to the rest of a molecule through its N- terminus. In some embodiments, it is connected to the rest of a molecule through its C-terminus.
- a side chain of an amino acid residue e.g., various X residues as described in the present disclosure.
- two cysteine residues form a disulfide bond.
- an antibody binding moiety is or D comprises , , , or S S DCAWHLGXLVWCT , wherein X is an amino acid residue bonded to the rest of a compound or agent, and wherein 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally replaced with another amino acid residue, 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted, and/or 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted.
- 1-5 e.g., 1, 2, 3, 4, or 5
- 1-5 amino acid residues may be independently and optionally replaced with another amino acid residue
- 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted
- 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted.
- the total number of replacements, deletions and insertions is no more than 10 (e.g., 0, or no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10). In some embodiments, the total number is 0. In some embodiments, the total number is no more than 1. In some embodiments, the total number is no more than 2. In some embodiments, the total number is no more than 3. In some embodiments, the total number is no more than 4. In some embodiments, the total number is no more than 5. In some embodiments, the total number is no more than 6. In some embodiments, the total number is no more than 7. In some embodiments, the total number is no more than 8. In some embodiments, the total number is no more than 9. In some embodiments, the total number is no more than 10.
- an T antibody binding moiety is or comprises , , S , or , wherein X is an amino acid residue bonded to the rest of a compound or agent.
- X is ⁇ N(R’) ⁇ CH( ⁇ ) ⁇ C(O) ⁇ .
- X is ⁇ N(R’) ⁇ CH( ⁇ L LG1 ⁇ ) ⁇ C(O) ⁇ .
- X is ⁇ N(R’) ⁇ CH( ⁇ L LG1 ⁇ L LG2 ⁇ ) ⁇ C(O) ⁇ .
- X is ⁇ N(R’) ⁇ CH( ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ ) ⁇ C(O) ⁇ . In some embodiments, X is ⁇ N(R’) ⁇ CH( ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ ) ⁇ C(O) ⁇ . In some embodiments, an antibody binding moiety is or D comprises . In some embodiments, an antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises D H . In some embodiments, X is a residue of . In some embodiments, X is a residue of .
- X is H a residue of . In some embodiments, X is a residue of . In some embodiments, X is a residue of . In some embodiments, X is a residue of H . In some embodiments, X is a residue of . In some embodiments, X is a residue of . In some embodiments, X is K. In some embodiments, X is D. In some embodiments, X is a residue of Dab. In some embodiments, X is E. In some embodiments, X is a residue of .
- the present disclosure provides an amino H acid having the structure of , , O , , H , , H , or , or a salt thereof, or an ester thereof, or an activated ester thereof, or a stereoisomer thereof, or an ester or an activated ester of a stereoisomer.
- such antibody binding moieties are antibody binding moieties.
- an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises a small molecule entity, with a molecular weight of, e.g., less than 10000, 9000, 8000, 7000, 6000, 5000, 4000, 3000, 2000, 1500, 1000, etc.
- Suitable such antibody binding moieties include small molecule Fc binder moieties, e.g., those described in US 9,745,339, US 201/30131321, etc.
- an antibody binding moiety is of such a structure that its corresponding compound is a compound described in US 9,745,339 or US 2013/0131321, the compounds of each of which are independently incorporated herein by reference.
- an antibody binding moiety ABT is of such a structure that H ⁇ ABT is a compound described in US 9,745,339 or US 2013/0131321, the compounds of each of which are independently incorporated herein by reference.
- such a compound can bind to an antibody.
- an antibody binding moiety is or comprises optionally substituted . In some embodiments, an antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises optionally substituted . In some embodiments, an antibody binding moiety is or comprises eO . In some embodiments, an antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises optionally substituted . In some embodiments, an antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises optionally substituted . In some embodiments, an antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises optionally substituted . In some embodiments, an antibody binding moiety is or comprises .
- antibody binding moiety is or comprises O . In some embodiments, an antibody binding moiety is or comprises HN . In some embodiments, antibody binding moiety is or comprises optionally substituted . In some embodiments, antibody binding moiety is or comprises optionally substituted . In some embodiments, antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises optionally substituted . In some embodiments, an antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises . In some embodiments, an antibody binding moiety is or comprises optionally substituted . In some embodiments, an antibody binding moiety is or comprises C . In some embodiments, an antibody binding moiety is or comprises optionally substituted .
- an antibody binding moiety is or comprises . In some embodiments, such antibody binding moieties are antibody binding moieties. [0073] In some embodiments, antibody binding moiety is or comprises , wherein each variable is independently as described herein. In some embodiments, m is 4 to 13. In some embodiments, an antibody binding moiety is or comprises , wherein b is 1-20, and each other variable is independently as described herein. In some embodiments, b is 4-13. In some embodiments, an antibody binding moiety, e.g., R c ⁇ (Xaa)z ⁇ , is or comprises . In some embodiments, an antibody binding moiety, e.g., R c ⁇ (Xaa)z ⁇ , is or comprises .
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises .
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇ , is or comprises . In some embodiments, an antibody binding moiety, e.g., R c -(Xaa)z-, is or comprises . In some embodiments, an antibody binding moiety, e.g., R c -(Xaa)z-, is or comprises . In some embodiments, an antibody binding moiety, e.g.,
- R c -(Xaa)z- is or comprises .
- an antibody binding moiety, e.g., R c -(Xaa)z- is or comprises .
- an antibody binding moiety, e.g., R c -(Xaa)z- is or comprises .
- an antibody binding moiety, e.g., R c -(Xaa)z- is or comprises O O .
- an antibody binding moiety, e.g., R c ⁇ (Xaa)z ⁇ is or comprises .
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- ⁇ NH ⁇ is bonded to a R c group.
- R c is R ⁇ C(O) ⁇ .
- R c is CH 3 C(O) ⁇ . In some embodiments, such antibody binding moieties are antibody binding moieties.
- an antibody binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises .
- an antibody binding H (R moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises .
- an antibody binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises .
- an antibody binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises
- an antibody binding moiety e.g., ( or R c ⁇ (Xaa)z ⁇ , is or comprises . In some embodiments, an antibody binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises
- an antibody binding ( moiety, e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises .
- an antibody binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises . In some embodiments, such antibody binding moieties are antibody binding moieties. [0075] In some embodiments, an antibody binding moiety, e.g., R c ⁇ (Xaa)z ⁇ , is or comprises a Z33 peptide moiety. In some embodiments, an antibody binding moiety, e.g., R c ⁇ (Xaa)z ⁇ , is or comprises ⁇ FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD ⁇ NH 2 or a fragment thereof.
- an antibody binding moiety e.g., R c ⁇ (Xaa)z ⁇
- an antibody binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises a moiety of a peptide such as FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC, RGNCAYHRGQLVWCTYH, RGNCAYHKGQLVWCTYH, RGNCKYHRGQLVWCTYH, RGNCAWHRGKLVWCTYH, RGNCKWHRGELVWCTYH, RGNCKWHRGQLVWCTYH, RGNCKYHLGELVWCTYH, RGNCKYHLGQLVWCTYH, DCKWHLGELVWCT, DCKYHLGELVWCT, DCKWHRGELVWCT, DCKWHRGELVWCT, DCKWHLGQLVWCT, DCKYHL
- a peptide such as Z33, FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC, RGNCAYHRGQLVWCTYH, RGNCKYHRGQLVWCTYH, RGNCAYHKGQLVWCTYH, RGNCAWHRGKLVWCTYH, RGNCKWHRGQLVWCTYH, RGNCKWHRGELVWCTYH, RGNCKYHLGELVWCTYH, RGNCKYHLGQLVWCTYH, DCKWHLGELVWCT, DCKYHLGELVWCT, DCKWHRGELVWCT, DCKWHLGQLVWCT, DCKYHRGELVWCT, DCKYHRGELVWCT, DCKYHLGQLVWCT, DCKWHRGQLVWCT, DCKYHRGQLVWCT, FNKQCQRRFYEALHDPNLNEEQRNARIRSIRDDC, FNMQC
- one or more amino acid residues of a sequence may be independently and optionally replaced (e.g., 1-5), deleted (e.g., 1-5) and/or inserted (e.g., 1-5) as described herein.
- an antibody binding moiety e.g., ( or R c ⁇ (Xaa)z ⁇ , is or comprises ⁇ CXYHXXXLVWC ⁇ , ⁇ XCXYHXXXLVWC ⁇ , ⁇ CXYHXXXLVWCX ⁇ , ⁇ X 0-3 CXYHXXXLVWCX 0-3 ⁇ , ⁇ XCXYHXXXLVWCXXX ⁇ XXXCXYHXXLVWCXX ⁇ , wherein each X is independently an amino acid residue, and the two C residues optionally form a disulfide bond.
- X 8 (the X after H) is Orn. In some embodiments, X 8 is Dab. In some embodiments, X 8 is Lys(Ac). In some embodiments, X 8 is Orn(Ac). In some embodiments, X 8 is Dab(Ac). In some embodiments, X 8 is Arg. In some embodiments, X 8 is Nle. In some embodiments, X 8 is Nva. In some embodiments, X 8 is Val. In some embodiments, X 8 is Tle. In some embodiments, X 8 is Leu. In some embodiments, X 8 is Ala(tBu). In some embodiments, X 8 is Cha. In some embodiments, X 8 is Phe.
- an antibody binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises DCAWHLGELVWCT.
- a C-terminus and/or a N-terminus of a protein agent/peptide agent moiety are independently capped (e.g., RC(O) ⁇ such as CH 3 C(O) ⁇ for N-terminus, N(R') 2 such as NH 2 for C-terminus, etc.).
- such antibody binding moieties are antibody binding moieties.
- a residue may be modified or replaced for connection with another moiety, e.g., in some embodiments, H may be replaced with an amino acid residue comprises a side chain that contain ⁇ COOH or a salt or activated form thereof (e.g., D).
- an antibody binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises (X 1-3 )-C-(X 2 )-H-(Xaa1)-G-(Xaa2)-L-V-W-C-(X 1-3 ), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa1 is R, L, L, D, E, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is L, D, E, N, or Q.
- Xaa1 is a lysine residue, a cysteine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a glutamic acid residue or an aspartic acid residue.
- Xaa1 is an arginine residue or a leucine residue.
- Xaa2 is a lysine residue, a glutamine residue, or an aspartic acid residue.
- such antibody binding moieties are antibody binding moieties.
- an antibody binding moiety, e.g., or R c ⁇ (Xaa)z ⁇ is or comprises (X1-3)-C-(Xaa3)-(xaa4)-H-(Xaa1)-G-(Xaa2)-L-V-W-C-(Xaa5)-(Xaa6)-(Xaa7), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa3 is an alanine residue or a lysine residue.
- Xaa4 is a tryptophan residue or a tyrosine residue.
- Xaa1 is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
- Xaa5 is a threonine residue or a lysine residue.
- Xaa6 is a tyrosine residue, a lysine residue, or absent.
- Xaa7 is a histidine residue, a lysine residue, or absent.
- antibody binding moieties are antibody binding moieties.
- an antibody binding moiety e.g., or R c ⁇ (Xaa)z ⁇ , is or comprises D-C-(Xaa3)-(Xaa4)-H-(Xaa1)-G-(Xaa2)-L-V-W-C-(Xaa5)-(Xaa6)-(Xaa7), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa3 is an alanine residue or a lysine residue.
- Xaa4 is a tryptophan residue or a tyrosine residue.
- Xaal is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
- Xaa5 is a threonine residue or a lysine residue.
- Xaa6 is a tyrosine residue, a lysine residue, or absent.
- Xaa7 is a histidine residue, a lysine residue, or absent.
- such antibody binding moieties are antibody binding moieties.
- an antibody binding moiety e.g., or R c -(Xaa)z-, is or comprises D-C-(Xaa3)-(Xaa4)-H-(Xaal)-G-(Xaa2)-L-V-W-C-T, wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa3 is an alanine residue or a lysine residue.
- Xaa4 is a tryptophan residue or a tyrosine residue.
- Xaal is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
- such antibody binding moieties are antibody binding moieties.
- an antibody binding moiety e.g., or R c -(Xaa)z-, is or comprises R-G-N-C-(Xaa3)-(Xaa4)-H-(Xaal)-G-(Xaa2)-L-V-W-C-(Xaa5)- (Xaa6)-(Xaa7), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
- Xaa3 is an alanine residue or a lysine residue.
- Xaa4 is a tryptophan residue or a tyrosine residue.
- Xaal is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
- Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
- Xaa5 is a threonine residue or a lysine residue.
- Xaa6 is a tyrosine residue, a lysine residue, or absent.
- Xaa7 is a histidine residue, a lysine residue, or absent.
- antibody binding moieties are antibody binding moieties.
- antibody binding moieties e.g., various antibody binding moieties described above, are protein binding moieties.
- antibody binding moieties are antibody binding moieties.
- LG is or comprises such an antibody binding moiety.
- LG is or comprises a protein binding moiety.
- LG is or comprises an antibody binding moiety.
- antibody binding moieties e.g., antibody binding moieties, and useful technologies for developing and/or assessing such moieties are described in, e.g., Alves, Langmuir 2012, 28, 9640 ⁇ 9648; Choe et al., Materials 2016, 9, 994; doi:10.3390/ma9120994; Gupta et al., Nature Biomedical Engineering, vol.3, 2019, 917–929; Muguruma, et al., ACS Omega 2019, 4, 14390 ⁇ 14397, doi: 10.1021/acsomega.9b01104; Yamada, et al., Angew Chem Int Ed Engl.2019 Apr 16;58(17):5592- 5597, doi: 10.1002/anie.201814215; Kruljec, et al., Bioconjug Chem.2017, 28(8): 2009-2030, doi: 10.1021/acs.bioconjchem.7b00335 (
- an antibody binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety) is an affinity substance described in AU 2018259856 or WO 2018199337, the affinity substance of each of which is incorporated herein by reference.
- an antibody binding moiety e.g., an antibody binding moiety
- an adapter protein agent e.g., as described in Hui, et al., Bioconjugate Chem.2015, 26, 1456 ⁇ 1460, doi: 10.1021/acs.bioconjchem.5b00275.
- adapter proteins do not require reactive residues (e.g., BPA) to achieve one or more or all advantages.
- antibody binding moiety e.g., an antibody binding moiety is or comprises a triazine moiety, e.g., one described in US 2009/0286693.
- an antibody binding moiety e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in US 2009/0286693, the compounds of which are independently incorporated herein by reference.
- an antibody binding moiety e.g., an antibody binding moiety
- ABT is of such a structure that H ⁇ ABT is a compound described in US 2009/0286693, the compounds of which are independently incorporated herein by reference.
- such a compound can bind to an antibody.
- such a compound can bind to Fc region of an antibody.
- an antibody binding moiety e.g., an antibody binding moiety is or comprises a triazine moiety, e.g., one described in Teng, et al., A strategy for the generation of biomimetic ligands for affinity chromatography. Combinatorial synthesis and biological evaluation of an IgG binding ligand, J. Mol. Recognit. 1999;12:67-75 ("Teng").
- an antibody binding moiety e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in Teng, the compounds of which are independently incorporated herein by reference.
- an antibody binding moiety e.g., an antibody binding moiety, ABT is of such a structure that H-ABT is a compound described in Teng, the compounds of which are independently incorporated herein by reference.
- H-ABT is a compound described in Teng, the compounds of which are independently incorporated herein by reference.
- such a compound can bind to an antibody.
- such a compound can bind to Fc region of an antibody.
- an antibody binding moiety e.g., an antibody binding moiety is a triazine moiety, e.g., one described in Uttamchandani, et al., Microarrays of Tagged Combinatorial Triazine Libraries in the Discovery of Small-Molecule Ligands of Human IgG, J Comb Chem. 2004 Nov- Dec;6(6):862-8 ("Uttamchandani").
- an antibody binding moiety e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in Uttamchandani, the compounds of which are independently incorporated herein by reference.
- an antibody binding moiety e.g., an antibody binding moiety, ABT is of such a structure that H-ABT is a compound described in Uttamchandani, the compounds of which are independently incorporated herein by reference.
- H-ABT is a compound described in Uttamchandani, the compounds of which are independently incorporated herein by reference.
- such a compound can bind to an antibody.
- such a compound can bind to Fc region of an antibody.
- an antibody binding moiety binds to one or more binding sites of protein A. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein G. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein L. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein Z. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein LG. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein LA. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein AG. In some embodiments, an antibody binding moiety is described in Choe, W., Durgannavar,
- an antibody binding moiety e.g., an antibody binding moiety can bind to a nucleotide-binding site.
- an antibody binding moiety e.g., an antibody binding moiety is a small molecule moiety that can bind to a nucleotide-binding site.
- a small molecule is tryptamine.
- an antibody binding moiety, e.g., an antibody binding moiety, ABT is of such a structure that H-ABT is tryptamine.
- an antibody binding moiety is a moiety (e.g., small molecule moiety, peptide moiety, nucleic acid moiety, etc.) that can selectively bind to IgG, and when used in provided technologies can provide and/or stimulate ADCC and/or ADCP.
- an antibody binding moiety is a moiety (e.g., small molecule moiety, peptide moiety, nucleic acid moiety, etc.) that can bind to IgG and optionally can compete with known antibody binders, e.g., protein A, protein G, protein L, etc.
- antibodies of various properties and activities may be targeted by antibody binding moieties described in the present disclosure.
- such antibodies include antibodies administered to a subject, e.g., for therapeutic purposes.
- antibody binding moieties described herein may bind antibodies toward different antigens and are useful for conjugating moieties of interest with various antibodies.
- an antibody binding moiety e.g., an antibody binding moiety
- a meditope agent is described in, e.g., US 2019/0111149.
- an antibody binding moiety e.g., an antibody binding moiety
- an antibody binding moiety e.g., an antibody binding moiety
- an antibody binding moiety e.g., an antibody binding moiety
- an antibody binding moiety e.g., an antibody binding moiety
- an antibody binding moiety, e.g., an antibody binding moiety binds to lgG3.
- an antibody binding moiety binds to lgG4. In some embodiments, an antibody binding moiety, e.g., an antibody binding moiety, binds to IgGl, lgG2 and/or lgG4. In some embodiments, an antibody binding moiety, e.g., an antibody binding moiety, binds to IgGl, lgG2 and lgG4.
- antibody binding moiety is utilized in a reference technology a non- antibody binding moiety.
- CH 3 C(0)- is utilized in a reference technology a non- antibody binding moiety.
- CH 3 C(0)NH- is utilized in a reference technology a non-antibody binding moiety.
- CH 3 C(0)NHCH 2 - is utilized in a reference technology a non-antibody binding moiety.
- CH 3 CH 2 - is utilized in a reference technology a non-antibody binding moiety.
- CH 3 CH 2 NH- is utilized in a reference technology a non-antibody binding moiety.
- CH 3 CH 2 NHC(0)- is utilized in a reference technology a non-antibody binding moiety.
- antibody binding moieties bind to targets (e.g., antibody agents for antibody binding moieties) with a Kd that is about 1 mM-1 pM or less.
- a Kd is about 1 mM, 0.5 mM, 0.2 mM, 0.1 mM, 0.05 mM, 0.02 mM, 0.01 mM, 0.005 mM, 0.002 mM, 0.001 mM, 500 nM, 200 nM, 100 nM, 50 nM, 20 nM, 10 nM, 5 nM, 2 nM, 1 nM, 0.5 nM, 0.2 nM, 0.1 nM, or less.
- Kd is about 1 mM or less.
- Kd is about 0.5 mM or less.
- Kd is about 0.1 mM or less.
- Kd is about 0.05 mM or less. In some embodiments, Kd is about 0.01 mM or less. In some embodiments, Kd is about 0.005 mM or less. In some embodiments, Kd is about 0.001 mM or less. In some embodiments, Kd is about 500 nM or less. In some embodiments, Kd is about 200 nM or less. In some embodiments, Kd is about 100 nM or less. In some embodiments, Kd is about 50 nM or less. In some embodiments, Kd is about 20 nM or less. In some embodiments, Kd is about 10 nM or less. In some embodiments, Kd is about 5 nM or less. In some embodiments, Kd is about 2 nM or less. In some embodiments, Kd is about 1 nM or less. For example, in some embodiments, antibody binding moieties bind to IgG antibody agents with Kd described herein.
- antibodies of various properties and activities may be recruited by antibody binding moieties described in the present disclosure.
- such antibodies include antibodies administered to a subject, e.g., for therapeutic purposes.
- antibodies recruited by antibody binding moieties comprise antibodies toward different antigens.
- antibodies recruited by antibody binding moieties comprise antibodies whose antigens are not present on the surface or cell membrane of target cells.
- antibodies recruited by antibody binding moieties comprise antibodies which are not targeting antigens present on surface or cell membrane of targets.
- antigens on surface of target cells may interfere with the structure, conformation, and/or one or more properties and/or activities of recruited antibodies which bind such antigens.
- provided technologies comprise universal antibody binding moieties which recruit antibodies of diverse specificities, and no more than 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
- one advantage of the present disclosure is that provided technologies comprising universal antibody binding moieties can utilize diverse pools of antibodies such as those present in serum.
- universal antibody binding moieties of the present disclosure are contacted with a plurality of antibodies, wherein no more than 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 99% percent of the plurality of antibodies are toward the same antigen, protein, lipid, carbohydrate, etc.
- recruited antibodies are those in IVIG.
- IVIG may be administered prior to, concurrently with or subsequently to an agent or composition.
- antibodies of various types of immunoglobulin structures may be recruited.
- one or more subclasses of IgG are recruited.
- recruited antibodies comprise IgGl.
- recruited antibodies comprise lgG2.
- recruited antibodies comprise lgG3.
- recruited antibodies comprise lgG4.
- recruited antibodies are or comprise IgGl and lgG2.
- recruited antibodies are or comprise IgGl, lgG2 and lgG4.
- recruited antibodies are or comprise IgGl, lgG2, lgG3 and lgG4.
- recruited antibodies may interact various types of receptors, e.g., those expressed by various types of immune cells.
- recruited antibodies can effectively interact various types of Fc receptors and provide desired immune activities.
- recruited antibodies can recruit immune cells.
- recruited antibodies can effectively interact with hFcyRIIIA.
- recruited antibodies can effectively interact with hFcyRIIIA on macrophages.
- macrophages are recruited to provide ADCC and/or ADCP activities toward a virus, e.g., a SARS-CoV-2 virus, and/or cells infected thereby.
- NK cells are recruited to provide immune activities.
- recruited antibodies can effectively interact with hFc ⁇ RIIA.
- recruited antibodies can effectively interact with hFc ⁇ RIIA on dendritic cells.
- antibody moieties in agents of the present disclosure comprise one or more properties, structures and/or activities of recruited antibodies described herein.
- Amino Acids [0097]
- provided compounds and agents may comprise one or more amino acid moieties, e.g., in antibody binding moieties, linker moieties, etc. Amino acid moieties can either be those of natural amino acids or unnatural amino acids.
- an amino acid has the structure of formula A-I: NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH, A-I or a salt thereof, wherein: each of R a1 , R a2 and R a3 is independently ⁇ L a ⁇ R’ or an amino acid side chain; each of L a1 and L a2 is independently L a ; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C
- an amino acid residue e.g., of an amino acid having the structure of formula A-I, has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ .
- each amino acid residue in a peptide independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ .
- the present disclosure provides a derivative of an amino acid of formula A-I or a salt thereof.
- a derivative is an ester.
- the present disclosure provides a compound of formula NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOR CT or salt thereof, wherein R CT is R’ and each other variable is independently as described herein.
- R CT is R.
- R CT is optionally substituted aliphatic.
- R CT is t- butyl.
- L a1 is a covalent bond.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH.
- L a2 is ⁇ CH 2 SCH 2 ⁇ .
- L a2 is a covalent bond.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ COOH.
- an amino acid residue has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ .
- L a1 is ⁇ CH 2 CH 2 S ⁇ .
- L a1 is ⁇ CH 2 CH 2 S ⁇ , wherein the CH 2 is bonded to NH(R a1 ).
- L a1 is a covalent bond and L a2 is a covalent bond.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ COOH.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ CH(R a2 ) ⁇ COOH.
- a compound of formula A-I is of the structure NH(R a1 ) ⁇ CH(R a3 ) ⁇ COOH.
- a compound of formula A-I is of the structure NH 2 ⁇ CH(R a2 ) ⁇ COOH. In some embodiments, a compound of formula A-I is of the structure NH 2 ⁇ CH(R a3 ) ⁇ COOH. In some embodiments, an amino acid residue has the structure of ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ . In some embodiments, an amino acid residue has the structure of ⁇ N(R a1 ) ⁇ CH(R a2 ) ⁇ CO ⁇ . In some embodiments, an amino acid residue has the structure of ⁇ N(R a1 ) ⁇ CH(R a3 ) ⁇ CO ⁇ .
- an amino acid residue has the structure of ⁇ NH ⁇ CH(R a2 ) ⁇ CO ⁇ . In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ CH(R a3 ) ⁇ CO ⁇ .
- L a is a covalent bond. In some embodiments, L a is optionally substituted C 1-6 bivalent aliphatic. In some embodiments, L a is optionally substituted C 1-6 alkylene. In some embodiments, L a is ⁇ CH 2 ⁇ . In some embodiments, L a is ⁇ CH 2 CH 2 ⁇ . In some embodiments, L a is ⁇ CH 2 CH 2 CH 2 ⁇ .
- L a is bivalent optionally substituted C 1-20 aliphatic, wherein one or more methylene units are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ , and/or ⁇ O ⁇ . In some embodiments, L a is bivalent optionally substituted C 1-20 aliphatic, wherein one or more methylene units are independently replaced with ⁇ C(O)N(R’) ⁇ , ⁇ Cy ⁇ , and ⁇ O ⁇ .
- L a is bivalent optionally substituted C 1-20 aliphatic, wherein two or more methylene units are independently replaced with ⁇ C(O)N(R’) ⁇ , and ⁇ Cy ⁇ in addition to other optional replacements.
- ⁇ Cy ⁇ is optionally substituted.
- ⁇ Cy ⁇ is optionally substituted with an electron- withdrawing group as described herein.
- ⁇ Cy ⁇ is substituted with one or more ⁇ F.
- ⁇ Cy ⁇ is optionally substituted 1,3-phenylene.
- ⁇ Cy ⁇ is F optionally substituted 1,4-phenylene.
- L a is or comprises ome e mbodiments, L a is or comprises a n some embodiments, L is or comprises O . In some embodiments, L a is or comprises ome embodiments, L a is or comprises n some embodiments, L a is or comprises I n some embodiments, L a is or c O omprises some embodiments, F L a is or comprises In some embodiments, L a is or comprises In some F embodiments, L a is or comprises In some F embodiments, L a is or comprises In some embodiments, L a is or comprises O F F N N H .
- L a is or comprises In some O F embodiments, L a is or comprises In some embodiments, L a is or comprises I n some embodiments, L a is or comprises In some embodiments, L a is or N H comprises In some embodiments, L a is or comprises In some O embodiments, L a is or comprises In some embodiments, L a is or comprises O .
- R’ is R.
- R a1 is R, wherein R is as described in the present disclosure.
- R a1 is R, wherein R methyl.
- R a2 is R, wherein R is as described in the present disclosure.
- R a3 is R, wherein R is as described in the present disclosure. In some embodiments, each of R a1 , R a2 , and R a3 is independently R, wherein R is as described in the present disclosure. [0105] In some embodiments, R a1 is hydrogen. In some embodiments, R a1 is a protective group. In some embodiments, R a1 is ⁇ Fmoc. In some embodiments, R a1 is ⁇ Dde. [0106] In some embodiments, each of R a1 , R a2 and R a3 is independently ⁇ L a ⁇ R’. [0107] In some embodiments, R a2 is hydrogen. In some embodiments, R a3 is hydrogen.
- R a1 is hydrogen, and at least one of R a2 and R a3 is hydrogen. In some embodiments, R a1 is hydrogen, one of R a2 and R a3 is hydrogen, and the other is not hydrogen. In some embodiments, R a2 is ⁇ L a ⁇ R and R a3 is ⁇ H. In some embodiments, R a3 is ⁇ L a ⁇ R and R a2 is ⁇ H. In some embodiments, R a2 is ⁇ CH 2 ⁇ R and R a3 is ⁇ H. In some embodiments, R a3 is ⁇ CH 2 ⁇ R and R a2 is ⁇ H.
- R a2 is R and R a3 is ⁇ H. In some embodiments, R a3 is R and R a2 is ⁇ H. [0108] In some embodiments, R a2 is ⁇ L a ⁇ R, wherein R is as described in the present disclosure. In some embodiments, R a2 is ⁇ L a ⁇ R, wherein R is an optionally substituted group selected from C 3-30 cycloaliphatic, C 5-30 aryl, 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R a2 is ⁇ L a ⁇ R, wherein R is an optionally substituted group selected from C 6-30 aryl and 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R a2 is a side chain of an amino acid.
- R a2 is a side chain of a standard amino acid.
- R a3 is ⁇ L a ⁇ R, wherein R is as described in the present disclosure.
- R a3 is ⁇ L a ⁇ R, wherein R is an optionally substituted group selected from C 3-30 cycloaliphatic, C 5-30 aryl, 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R a3 is ⁇ L a ⁇ R, wherein R is an optionally substituted group selected from C 6-30 aryl and 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- R a3 is a side chain of an amino acid. In some embodiments, R a3 is a side chain of a standard amino acid. [0110] In some embodiments, one or R a2 and R a3 is ⁇ H. In some embodiments, one or R a2 and R a3 is ⁇ L a ⁇ R, wherein L a is as described herein. In some embodiments, L a is not a covalent bond.
- one or more methylene units of L a are independently and optionally replaced as described herein, e.g., with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ O ⁇ , ⁇ C(O) ⁇ N(R’) ⁇ and/or ⁇ Cy ⁇ , etc.
- L a is or comprises ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ and ⁇ Cy ⁇ .
- L a is or comprises ⁇ C(O)N(R’) ⁇ and ⁇ Cy ⁇ .
- ⁇ Cy ⁇ is substituted and one or more substituents are independently an electron-withdrawing group.
- an amino acid side chain is R a2 or R a3 . In some embodiments, an amino acid side chain is or comprises ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H. In some embodiments, an amino acid side chain is or comprises ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H. In some embodiments, an amino acid side chain is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ H. In some embodiments, an amino acid side chain is or comprises ⁇ L LG4 ⁇ H. In some H embodiments, such a side chain is . In some embodiments, such a side chain is H . In some embodiments, such a side chain is .
- R is an optionally substituted C 1-6 aliphatic. In some embodiments, R is an optionally substituted C 1-6 alkyl. In some embodiments, R is ⁇ CH 3 . In some embodiments, R is optionally substituted pentyl. In some embodiments, R is n-pentyl. [0113] In some embodiments, R is a cyclic group. In some embodiments, R is an optionally substituted C 3-30 cycloaliphatic group. In some embodiments, R is cyclopropyl.
- R is an optionally substituted aromatic group, and an amino acid residue of an amino acid of formula A-I is a Xaa A .
- R a2 or R a3 is ⁇ CH 2 ⁇ R, wherein R is an optionally substituted aryl or heteroaryl group.
- R is optionally substituted phenyl.
- R is phenyl.
- R is optionally substituted phenyl.
- R is 4-trifluoromethylphenyl.
- R is 4-phenylphenyl.
- R is optionally substituted 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, R is optionally substituted 5-14 membered heteroaryl having 1-5 heteroatoms independently selected N from oxygen, nitrogen, and sulfur. In some embodiments, R is S . In some embodiments, R is optionally substituted pyridinyl. In some embodiments, R is 1- pyridinyl. In some embodiments, R is 2- pyridinyl. In some embodiments, R is 3- pyridinyl. In some embodiments, R is [0115] In some embodiments, R’ is ⁇ COOH.
- a compound of and an amino acid residue of an amino acid of formula A-I is a Xaa N .
- R’ is ⁇ NH 2 .
- a compound of an amino acid residue of an amino acid of formula A-I is a Xaa P .
- R a2 or R a3 is R, wherein R is C 1-20 aliphatic as described in the present disclosure.
- a compound of an amino acid residue of an amino acid of formula A-I is a Xaa H .
- R is ⁇ CH 3 .
- R is ethyl.
- R is propyl.
- R is n-propyl. In some embodiments, R is butyl. In some embodiments, R is n-butyl. In some embodiments, R is pentyl. In some embodiments, R is n-pentyl. In some embodiments, R is cyclopropyl. [0118] In some embodiments, two or more of R a1 , R a2 , and R a3 are R and are taken together to form an optionally substituted ring as described in the present disclosure.
- R a1 and one of R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having no additional ring heteroatom other than the nitrogen atom to which R a1 is bonded to.
- a formed ring is a 5-membered ring as in proline.
- R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring as described in the present disclosure.
- R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having one or more nitrogen ring atom.
- R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having one and no more than one ring heteroatom which is a nitrogen atom.
- a ring is a saturated ring.
- an amino acid is a natural amino acid.
- an amino acid is an unnatural amino acid.
- an amino acid is an alpha-amino acid.
- an amino acid is a beta-amino acid.
- a compound of formula A-I is a natural amino acid.
- a compound of formula A-I is an unnatural amino acid.
- an amino acid comprises a hydrophobic side chain.
- an amino acid with a hydrophobic side chain is A, V, I, L, M, F, Y or W.
- an amino acid with a hydrophobic side chain is A, V, I, L, M, or F.
- an amino acid with a hydrophobic side chain is A, V, I, L, or M.
- an amino acid with a hydrophobic side chain is A, V, I, or L.
- a hydrophobic side chain is R wherein R is C 1-10 aliphatic.
- R is C 1-10 alkyl.
- R is methyl.
- R is ethyl. In some embodiments, R is propyl. In some embodiments, R is butyl. In some embodiments, R is pentyl. In some embodiments, R is n-pentyl.
- an amino acid with a hydrophobic side chain is NH 2 CH(CH 2 CH 2 CH 2 CH 2 CH 3 )COOH. In some embodiments, an amino acid with a hydrophobic side chain is (S)-NH 2 CH(CH 2 CH 2 CH 2 CH 2 CH 3 )COOH. In some embodiments, an amino acid with a hydrophobic side chain is (R)-NH 2 CH(CH 2 CH 2 CH 2 CH 2 CH 3 )COOH.
- a hydrophobic side chain is ⁇ CH 2 R wherein R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is phenyl substituted with one or more hydrocarbon group. In some embodiments, R is 4-phenylphenyl. In some embodiments, an amino acid with a hydrophobic side chain is NH 2 CH(CH 2 ⁇ 4-phenylphenyl)COOH. In some embodiments, an amino acid with a hydrophobic side chain is (S)-NH 2 CH(CH 2 ⁇ 4-phenylphenyl)COOH.
- an amino acid with a hydrophobic side chain is (R)-NH 2 CH(CH 2 ⁇ 4-phenylphenyl)COOH.
- an amino acid comprises a positively charged side chain (e.g., at physiological pH) as described herein.
- such an amino acid comprises a basic nitrogen in its side chain.
- such an amino acid is Arg, His or Lys.
- such an amino acid is Arg.
- such an amino acid is His.
- such an amino acid is Lys.
- an amino acid comprises a negatively charged side chain (e.g., at physiological pH) as described herein.
- such an amino acid comprises a ⁇ COOH in its side chain.
- such an amino acid is Asp.
- such an amino acid is Glu.
- an amino acid comprises a side chain comprising an aromatic group as described herein.
- such an amino acid is Phe, Tyr, Trp, or His.
- such an amino acid is Phe.
- such an amino acid is Tyr.
- such an amino acid is Trp.
- such an amino acid is His.
- such an amino acid is NH 2 ⁇ CH(CH 2 ⁇ 4-phenylphenyl) ⁇ COOH.
- such an amino acid is (S)-NH 2 ⁇ CH(CH 2 ⁇ 4-phenylphenyl) ⁇ COOH. In some embodiments, such an amino acid is (R)-NH 2 ⁇ CH(CH 2 ⁇ 4-phenylphenyl) ⁇ COOH. H [0126] In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In O H some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In some embodiments, an amino acid is or a salt thereof. In some O H embodiments, an amino acid is or a salt thereof.
- an amino acid is or a salt thereof.
- a provided H compound is .
- the present disclosure provides polypeptide agents comprising one or more amino acid residues described in the present disclosure.
- Agents of the present disclosure may be prepared or isolated in general by synthetic and/or semi-synthetic methods or recombinant methods in accordance with the present disclosure. Certain technologies are described in the Examples.
- polypeptide agents e.g., cellular receptor binding moiety peptide agents, maybe be prepared using biological expression systems.
- provided agents are prepared synthetically.
- provided agents are prepared using certain technologies described in WO2019/023501, which is incorporated herein in its entirety by reference.
- Various technologies e.g., those for preparing antibody-drug conjugates, may be utilized in preparation of MATE agents.
- conjugation is not selective with respect to amino acid residue sites, and product compositions usually contain various different types of agents which may differ from each other with respect to number of target binding moieties conjugated and/or conjugation sites.
- the present disclosure provides technologies that can be utilized for selective conjugation of target binding moieties at particular amino acid residue sites.
- the present disclosure provides a method, comprising: contacting a first agent comprising a cellular receptor binding moiety linked to a first reactive group optionally through a first linker with a second agent comprising an antibody moiety linked to a second reactive group optionally through a second linker, wherein the first reactive group reacts with a second reactive group, and forming a product agent comprising a cellular receptor binding moiety and an antibody binding moiety optionally through a linker.
- the present disclosure provides a method comprising: contacting a first composition comprising a plurality of first agents each independently comprising a cellular receptor binding moiety linked to a first reactive group optionally through a first linker moiety with a second composition comprising a plurality of second agents each independently comprising an antibody moiety optionally linked to a second reactive group optionally through a second linker moiety, wherein a product composition comprising a plurality of product agents each independently comprising a cellular receptor binding moiety and an antibody binding moiety optionally through a linker is formed.
- a first composition is a composition comprising a first agent as described herein.
- second agents independently comprise second reactive groups.
- a second composition is a composition comprising a plurality of agents as described herein, wherein each cellular receptor binding moiety is independently a reactive group as described herein.
- a second composition is an antibody composition, wherein antibodies in the composition are not chemically modified.
- a second composition is an IVIG preparation.
- a product composition is a composition comprising a plurality of agents as described herein, wherein each cellular receptor binding moiety is independently a cellular receptor binding moiety as described herein. [0132]
- a cellular receptor binding moiety in a product agent is a cellular receptor binding moiety in a first agent.
- an antibody moiety in a product agent is an antibody moiety in a second agent.
- a second agent is an antibody agent, e.g., a monoclonal antibody, an antibody in a polyclonal antibody, an antibody in an IVIG preparation, etc.
- a second reactive group is a function group of an amino acid residue, e.g., ⁇ NH2 of Lys, ⁇ SH of Cys, etc.
- a second reactive group is ⁇ NH2 of a Lys residue, e.g., of a residue selected from K246 and K248 of an IgG1 heavy chain amino acid residues corresponding thereto, K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto, and K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto.
- the present disclosure provides selective reactions at particular amino acid residues of antibody moieties.
- a second reactive group is installed to an antibody moiety optionally through a linker. In some embodiments, a second reactive group is installed to an antibody moiety through a linker.
- a second reactive group is selectively linked to certain location(s) of an antibody moiety, e.g., certain location(s) selected from K246 and K248 of an IgG1 heavy chain amino acid residues corresponding thereto, K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto, and K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto.
- the present disclosure provides selective reactions at particular amino acid residues of antibody moieties.
- the present disclosure provides agents each independently comprising an antibody binding moiety that binds to an antibody agent, a reactive group, a cellular receptor binding moiety, and optionally one or more linker moieties linking such groups/moieties.
- agents are useful as reaction partners (e.g., first agents) for conjugating moieties of interest, e.g., target binding moieties, reactive groups (e.g., second reactive groups) to agents comprising antibody moieties (e.g., second agents).
- the present disclosure provides agents for conjugating moieties of interest to antibody moieties in various agents or antibody agents (e.g., monoclonal antibody agents, polyclonal antibody agents, antibody agents of IVIG preparations, etc.).
- agents each comprise a cellular receptor binding moiety, a reactive group, an antibody binding moiety, and optionally one or more linker moieties (linkers) linking such moieties.
- an antibody binding moiety is part of a leaving group that is released upon contacting such an agent (e.g., a first agent) with an antibody moiety (e.g., of a second agent) and reacting a reactive group of such an agent (e.g., a first reactive group of a first agent) with a reactive group of an antibody moiety (e.g., a second reactive group of a second agent, such as ⁇ NH2 of a Lys residue of an antibody protein).
- an agent e.g., a first agent
- an antibody moiety e.g., of a second agent
- a reactive group of such an agent e.g., a first reactive group of a first agent
- a reactive group of an antibody moiety e.g., a second reactive group of a second agent, such as ⁇ NH2 of a Lys residue of an antibody protein.
- a provided agent e.g., a first agent
- LG is a compound of formula R-I or a salt thereof: LG ⁇ RG ⁇ LRM ⁇ TBT, (R-I) or a salt thereof, wherein: LG is a group comprising an antibody binding moiety; RG is a reactive group; LRM is a linker; and TBT is a cellular receptor binding moiety.
- LG is or comprises an antibody binding moiety as described herein, and a linker which links an antibody binding moiety and RG.
- a moiety generally refers to a part of a molecule, e.g., in an ester RCOOR’, the alcohol moiety is RO ⁇ .
- a moiety of an agent retains one or more or all desirable structural features, properties, functions, and/or activities of a compound.
- a cellular receptor binding moiety can bind to a target, optionally in a comparable fashion, as its corresponding target binding agent;
- a target agent moiety maintains one or more desired structural features, properties, functions, and/or properties comparable to its corresponding target agent;
- an antibody agent moiety maintains one or more desired structural features, properties, functions, and/or properties (e.g., 3-dimension structure, antigen specificity, antigen-binding capacity, and/or immunological functions, etc.) comparable to its corresponding antibody agent.
- a moiety of an agent e.g., a target agent moiety, a peptide agent moiety, an antibody agent moiety, etc. is a monovalent (for a monovalent moiety), bivalent (for a bivalent moiety), or polyvalent (for a polyvalent moiety) radical of an agent, e.g., a target agent (for a target agent moiety), a peptide agent (for a peptide agent moiety), an antibody agent (for an antibody agent moiety), etc.
- a monovalent radical is formed by removing a monovalent part (e.g., hydrogen, halogen, another monovalent group like alkyl, aryl, etc.) from a compound/agent.
- a bivalent or polyvalent radical is formed by removing one or more monovalent (e.g., hydrogen, halogen, monovalent groups like alkyl, aryl, etc.), bivalent and/or polyvalent parts from a compound/agent.
- radicals are formed by removing hydrogen atoms.
- a moiety is monovalent.
- a moiety is bivalent.
- a moiety is polyvalent.
- LG is or comprises R LG ⁇ L LG ⁇ , wherein R LG is or comprises an antibody binding moiety, and L LG is a linker moiety as described herein.
- LG is ABT-L LG ⁇ .
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇ , wherein each of L LG1 and L LG2 is independently a linker moiety as described herein.
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ , wherein each of L LG1 , L LG2 and L LG3 is independently as linker moiety described herein.
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ , wherein each of L LG1 , L LG2 , L LG3 and L LG4 is independently a linker moiety as described herein.
- L LG1 is bonded to R LG .
- L LG1 is bonded to cellular receptor binding moiety.
- L LG is ⁇ L LG1 ⁇
- a reactive group comprises L LG2 , L LG3 and L LG4 .
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇
- a reactive group comprises L LG3 and L LG4 .
- L LG is ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇
- a reactive group comprises L LG4 .
- each of L LG1 , L LG2 , L LG3 and L LG4 is independently L as described herein. [0138]
- first agents e.g., wherein MOIs are target binding moieties
- second agents e.g., which are antibody agents comprising reactive amino acid residues such as amino groups as second reactive groups and/or second agents comprising second reactive groups introduced to antibody agents
- first agents e.g., wherein MOIs are reactive groups such as second reactive groups
- an antibody binding moiety is released after a reaction.
- LG is released after a reaction.
- a leaving group is released as part of a compound having the structure of LG ⁇ H or a salt thereof.
- an antibody binding moiety is released as part of a compound having the structure of LG ⁇ H or a salt thereof.
- LG is released as part of a compound having the structure of LG ⁇ H or a salt thereof.
- a released compound has the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof.
- an antibody binding moiety is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof.
- an antibody binding moiety is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein R LG is or comprises an antibody binding moiety.
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG , and L LG is ⁇ L LG1 ⁇ , ⁇ L LG1 ⁇ L LG2 ⁇ , ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ , or ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ .
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG1 ⁇ .
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG1 ⁇ L LG2 .
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 .
- LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ H or a salt thereof, wherein LG is R LG ⁇ L LG1 ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 .
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1-100 group comprising one or more aliphatic moieties, aryl moieties, heteroaliphatic moieties each independently having 1-20 heteroatoms, heteroaromatic moieties each independently having 1-20 heteroatoms, or any combinations of any one or more of such moieties, wherein one or more methylene units of the group are optionally and independently replaced with C 1-6 alkylene, C 1-6 alkenylene, a bivalent C 1-6 heteroaliphatic group having 1-5 heteroatoms, C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1-100 aliphatic or heteroaliphatic group 1- 20 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , ⁇ C(O)O ⁇ , ⁇ P
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1 , C 2 , C 3 , C 4 , C 5 , C 10 , C 15 , C 20 , C 25 , C 30 , C 40 , C 50 , C 60 , C 1-2 , C 1-5 , C 1-10 , C 1-15 , C 1-20 , C 1-30 , C 1-40 , C 1-50 , C 1-60 , C 1-70 , C 1-80 , or C 1-90 aliphatic or heteroaliphatic group 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1 , C 2 , C 3 , C 4 , C 5 , C 10 , C 15 , C 20 , C 25 , C 30 , C 40 , C 50 , C 60 , C 1-2 , C 1-5 , C 1-10 , C 1-15 , C 1-20 , C 1-30 , C 1-40 , C 1-50 , C 1-60 , C 1-70 , C 1-80 , or C 1-90 aliphatic or heteroaliphatic group 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C ⁇ C ⁇ , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1 , C 2 , C 3 , C 4 , C 5 , C 10 , C 15 , C 20 , C 25 , C 30 , C 40 , C 50 , C 60 , C 1-2 , C 1-5 , C 1-10 , C 1-15 , C 1-20 , C 1-30 , C 1-40 , C 1-50 , C 1-60 , C 1-70 , C 1-80 , or C 1-90 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O)
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1 , C 2 , C 3 , C 4 , C 5 , C 10 , C 15 , C 20 , C 25 , C 30 , C 40 , C 50 , C 60 , C 1-2 , C 1-5 , C 1-10 , C 1-15 , C 1-20 , C 1-30 , C 1-40 , C 1-50 , C 1-60 , C 1-70 , C 1-80 , or C 1-90 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O)
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1-10 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ Cy ⁇ , or ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C(R’) 2 ⁇ ) n ] ⁇ , wherein n is 1-10.
- L is a covalent bond, or a bivalent optionally substituted, linear or branched C 1-10 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , or ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C(R’) 2 ⁇ ) n ] ⁇ , wherein n is 1-10.
- L comprises no ⁇ C(O)O ⁇ . In some embodiments, L comprises no ⁇ C(O) ⁇ N(R’) ⁇ . In some embodiments, L comprises no ⁇ S ⁇ . In some embodiments, L comprises no ⁇ S ⁇ Cy ⁇ . In some embodiments, L comprises no ⁇ S ⁇ S ⁇ . In some embodiments, L does not contain one or more or any of ⁇ C(O)O ⁇ , ⁇ C(O) ⁇ N(R’) ⁇ , ⁇ S ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L does not contain one or more or any of ⁇ C(O)O ⁇ , ⁇ C(O) ⁇ N(R’) ⁇ , ⁇ S ⁇ Cy ⁇ , and ⁇ S ⁇ S ⁇ .
- L does not contain one or more or any of ⁇ C(O)O ⁇ , ⁇ S ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L does not contain one or more or any of ⁇ C(O)O ⁇ , ⁇ S ⁇ Cy ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L contains none of ⁇ C(O)O ⁇ , ⁇ S ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L contains none of ⁇ C(O)O ⁇ , ⁇ S ⁇ Cy ⁇ , and ⁇ S ⁇ S ⁇ . In some embodiments, L contains none of ⁇ C(O)O ⁇ and ⁇ S ⁇ S ⁇ . [0140] In some embodiments, L is a covalent bond.
- L is not a covalent bond.
- L LG1 is a covalent bond. In some embodiments, L LG1 is not a covalent bond. In some embodiments, L LG1 is or comprises ⁇ (CH 2 CH 2 O)n ⁇ . In some embodiments, L LG1 is or comprises ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L LG1 is ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L LG1 is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L LG1 is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein.
- L LG1 is ⁇ CH 2 ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 3 NH ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 ) 3 NH ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ C(O) ⁇ (CH 2 ) 3 NH ⁇ C(O) ⁇ .
- L LG1 is ⁇ C(O) ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ C(O) ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L LG1 is ⁇ NHC(O) ⁇ (CH 2 ) 3 NH ⁇ C(O) ⁇ . In some embodiments, a ⁇ CH 2 ⁇ is bonded to an antibody binding moiety. [0143] In some embodiments, L LG1 is ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ C(O) ⁇ .
- L LG1 is ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ C(O)NH ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ C(O)NH ⁇ CH 2 ⁇ . In some embodiments, ⁇ CH 2 CH 2 ⁇ is bonded to an antibody binding moiety. [0144] In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O)n ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O)n ⁇ CH 2 ⁇ CH 2 ⁇ .
- L LG1 is ⁇ (CH 2 CH 2 O)n ⁇ CH 2 ⁇ CH 2 ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O) 2 ⁇ CH 2 ⁇ CH 2 ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O) 4 ⁇ CH 2 ⁇ CH 2 ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ (CH 2 CH 2 O) 8 ⁇ CH 2 ⁇ CH 2 ⁇ C(O) ⁇ . In some embodiments, ⁇ C(O) ⁇ is bonded to an antibody binding moiety. [0145] In some embodiments, L LG1 is ⁇ N(R’) ⁇ .
- L LG1 is ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )]n ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )]n ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )]n ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )]n ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3.
- n is 4. In some embodiments, n is 5. In some embodiments, L LG1 is ⁇ NH ⁇ CH 2 CH 2 ⁇ O ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ CH 2 CH 2 ⁇ O ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . [0146] In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 2 ⁇ .
- L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 2 ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 2 ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 2 ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . [0147] In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 3 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 3 ⁇ CH 2 CH 2 ⁇ .
- L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 3 ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 3 ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 4 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 4 ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 4 ⁇ CH 2 CH 2 ⁇ NH ⁇ .
- L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 4 ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 5 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 5 ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 5 ⁇ CH 2 CH 2 ⁇ NH ⁇ . In some embodiments, L LG1 is ⁇ NH ⁇ [( ⁇ CH 2 CH 2 ⁇ O ⁇ )] 5 ⁇ CH 2 CH 2 ⁇ NH ⁇ C(O) ⁇ .
- L LG1 is ⁇ CH 2 ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 NH ⁇ . In some embodiments, L LG1 is ⁇ CH 2 CH 2 NH ⁇ (CO) ⁇ . In some embodiments, ⁇ CH 2 ⁇ is bonded to an antibody binding moiety. [0149] In some embodiments, L LG1 is ⁇ CH 2 ⁇ . In some embodiments, L LG1 is ⁇ CH 2 C(O) ⁇ . In some embodiments, L LG1 is ⁇ CH 2 C(O)NH ⁇ .
- L LG1 is ⁇ CH 2 (CO)NHCH 2 ⁇ . In some embodiments, ⁇ CH 2 ⁇ C(O) ⁇ is bonded to an antibody binding moiety at ⁇ CH 2 ⁇ .
- L LG2 is a covalent bond. In some embodiments, L LG2 is not a covalent bond. In some embodiments, L LG2 is ⁇ N(R’)C(O) ⁇ . In some embodiments, L LG2 is ⁇ NHC(O) ⁇ . In some embodiments, L LG2 is ⁇ (CH 2 )n ⁇ N(R’)C(O) ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted.
- L LG2 is ⁇ (CH 2 )n ⁇ OC(O) ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted. In some embodiments, L LG2 is ⁇ (CH 2 )n ⁇ OC(O)N(R’) ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted. In some embodiments, L LG2 is ⁇ (CH 2 )n ⁇ OC(O)NH ⁇ , wherein ⁇ (CH 2 )n ⁇ is optionally substituted. In some embodiments, n is 1-10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3.
- ⁇ (CH 2 )n ⁇ is substituted. In some embodiments, ⁇ (CH 2 )n ⁇ is unsubstituted.
- L LG2 is ⁇ CH 2 N(CH 2 CH 2 CH 2 S(O) 2 OH) ⁇ C(O) ⁇ . In some embodiments, L LG2 is ⁇ C(O) ⁇ NHCH 2 ⁇ . In some embodiments, L LG2 is ⁇ C(O) ⁇ NHCH 2 CH 2 ⁇ . In some embodiments, L LG2 is ⁇ C(O)O ⁇ CH 2 ⁇ . In some embodiments, L LG2 is ⁇ NH ⁇ C(O)O ⁇ CH 2 ⁇ . In some embodiments, ⁇ C(O) ⁇ is bonded to L LG3 .
- L LG2 is ⁇ NH ⁇ , ⁇ NHC(O) ⁇ , ⁇ (CH 2 )n ⁇ NHC(O) ⁇ , ⁇ (CH 2 )n ⁇ OC(O) ⁇ , ⁇ (CH 2 )n ⁇ OC(O)NH ⁇ , ⁇ C(O) ⁇ NHCH 2 ⁇ , ⁇ C(O) ⁇ NHCH 2 CH 2 ⁇ , ⁇ C(O)O ⁇ CH 2 ⁇ , or ⁇ NH ⁇ C(O)O ⁇ CH 2 ⁇ .
- L LG2 is ⁇ N(R’) ⁇ . In some embodiments, L LG2 is ⁇ N(R) ⁇ . In some embodiments, L LG2 is ⁇ NH ⁇ . [0152] In some embodiments, L LG2 is optionally substituted bivalent C 1-6 aliphatic. In some embodiments, L LG2 is ⁇ CH 2 ⁇ . In some embodiments, L LG2 is ⁇ CH 2 NH ⁇ . In some embodiments, L LG2 is ⁇ CH 2 NH ⁇ C(O) ⁇ . In some embodiments, L LG2 is ⁇ CH 2 NH ⁇ C(O) ⁇ CH 2 ⁇ . [0153] In some embodiments, L LG3 is or comprises an optionally substituted aryl ring.
- L LG3 is or comprises an optionally substituted phenyl ring. In some embodiments, L LG3 is a phenyl ring substituted with one or more electron-withdrawing groups. As appreciated by those skilled in the art, various electron-withdrawing groups are known in the art and may be utilized in accordance with the present disclosure. In some embodiments, an electron-withdrawing group is halogen. In some embodiments, an electron-withdrawing group is ⁇ F. In some embodiments, it is ⁇ Cl. In some embodiments, it is ⁇ Br. In some embodiments, it is ⁇ I.
- X is a heteroatom.
- Y is a heteroatom.
- each of X and Y is independently a heteroatom.
- Y is O.
- Y is S.
- X is C.
- X is N.
- X is P.
- X is S.
- an electron- withdrawing group is ⁇ C(O) ⁇ L ⁇ R’. In some embodiments, an electron-withdrawing group is ⁇ C(O) ⁇ R’. In some embodiments, it is ⁇ NO 2 . In some embodiments, it is ⁇ S(O) ⁇ L ⁇ R’. In some embodiments, it is ⁇ S(O) ⁇ R’. In some embodiments, it is ⁇ S(O) 2 ⁇ L ⁇ R’. In some embodiments, it is ⁇ S(O) 2 ⁇ O ⁇ R’.
- it is ⁇ S(O) 2 ⁇ N(R’) 2 . In some embodiments, it is ⁇ P(O)( ⁇ L ⁇ R’) 2 . In some embodiments, it is ⁇ P(O)(R’) 2 . In some embodiments, it is ⁇ P(O)(OR’) 2 . In some embodiments, it is ⁇ P(O)[N(R’) 2 ] 2 .
- L LG3 is ⁇ L LG3a ⁇ L LG3b ⁇ , wherein L LG3a is a covalent bond or ⁇ C(O)O ⁇ CH 2 ⁇ , wherein ⁇ CH 2 ⁇ is optionally substituted, and L LG3b is an optionally substituted aryl ring.
- L LG3a is bonded to L LG2
- L LG3b is bonded to L LG4 .
- L LG3a is a covalent bond.
- L LG3a is ⁇ C(O)O ⁇ CH 2 ⁇ , wherein ⁇ CH 2 ⁇ is optionally substituted.
- L LG3a is ⁇ C(O)O ⁇ CH 2 ⁇ , wherein ⁇ CH 2 ⁇ is substituted. In some embodiments, L LG3a is ⁇ C(O)O ⁇ CH 2 ⁇ , wherein ⁇ CH 2 ⁇ is unsubstituted.
- a first group, an antibody binding moiety, and/or LG is released as part of a compound having the structure of R LG ⁇ L LG1 ⁇ L LG2 ⁇ H or a salt thereof.
- L LG3b is an optionally substituted phenyl ring. In some embodiments, at least one substituent is an electron-withdrawing group as described herein.
- L LG3 is , wherein s is 0-4, each R s is independently halogen, ⁇ NO 2 , ⁇ L ⁇ R’, ⁇ C(O) ⁇ L ⁇ R’, ⁇ S(O) ⁇ L ⁇ R’, ⁇ S(O) 2 ⁇ L ⁇ R’, or ⁇ P(O)( ⁇ L ⁇ R’) 2 .
- C1 is bonded to L LG4 .
- L LG3 is In some embodiments, L LG3 is In some embodiments, L LG3 is . In some embodiments, L LG3 is . In some embodiments, L LG3 is LG3 In some embodiments, L is .
- L LG3b is wherei s n s is 0-4, each R is independently halogen, ⁇ NO 2 , ⁇ L ⁇ R’, ⁇ C(O) ⁇ L ⁇ R’, ⁇ S(O) ⁇ L ⁇ R’, ⁇ S(O) 2 ⁇ L ⁇ R’, or ⁇ P(O)( ⁇ L ⁇ R’) 2 .
- C1 L G4 In some embodiments, L LG3 ( is bonded to L . b is . In some embodiments, L LG3b is . In some embodiments, L LG3b is . In some embodiments, L LG3b is . In some embodiments, L LG3b is . In some embodiments, L LG3b is . In some embodiments, L LG3b is .
- L LG3b is .
- s is 0. In some embodiments, s is 1-4. In some embodiments, s is 1. In some embodiments, s is 2. In some embodiments, s is 3. In some embodiments, s is 4. [0161] In some embodiments, s is 1-4, and at least one R s is an electron-withdrawing group, e.g., an electron-withdrawing group described above. In some embodiments, at least one R s is ⁇ NO 2 . In some embodiments, at least one R s is ⁇ F. In some embodiments, each R s is independently an electron- withdrawing group. In some embodiments, each R s is ⁇ NO 2 .
- each R s is ⁇ F.
- an electron-withdrawing group or R s is at C2. In some embodiments, an electron-withdrawing group or R s is at C3. In some embodiments, an electron-withdrawing group or R s is at C4. In some embodiments, an electron-withdrawing group or R s is at C2 and C5.
- L LG3 is . In some embodiments, L LG3 is . In some embodiments, L LG3 is . In some embodiments, L LG3 is . In some embodiments, L LG3 is . In some embodiments, L LG3 is . In some embodiments, L LG3 is . In some embodiments, L LG3 is . In some embodiments, L LG3 is .
- L LG3 is . [0164] In some embodiments, L LG3b is . In some embodiments, L LG3b is In some embodiments, L LG3b is In some embodiments, L LG3b is In some embodiments, L LG3b is . In some embodiments, L LG3b is . In some embodiments, L LG3b is . In some embodiments, L LG3b is . O [0165] In some embodiments, L LG3b is optionally substituted . In some embodiments, the nitrogen atom is bound to L LG4 which is ⁇ O ⁇ .
- the nitrogen atom is bound to L LG4 which is ⁇ O ⁇ , and ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ C(O) ⁇ .
- ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ O ⁇ C(O) ⁇ .
- ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ S ⁇ C(O) ⁇ .
- L LG4 is a covalent bond.
- L LG4 is not a covalent bond.
- L LG4 is ⁇ O ⁇ .
- L LG4 is ⁇ N(R’) ⁇ .
- L LG4 is ⁇ NH ⁇ . In some embodiments, L LG4 is ⁇ N(CH 3 ) ⁇ . In some embodiments, L LG4 is ⁇ N(R’) ⁇ , and L LG3 is ⁇ O ⁇ . In some embodiments, R’ is optionally substituted C 1-6 alkyl. In some embodiments, L LG4 is ⁇ S ⁇ . [0168] As described herein, in some embodiments, R LG is or comprises an antibody binding moiety. In some embodiments, R LG is or comprises a protein binding moiety. In some embodiments, R LG is or comprises an antibody binding moiety. In some embodiments, R LG is an antibody binding moiety. In some embodiments, R LG is a protein binding moiety.
- R LG is an antibody binding moiety.
- R LG is , R c ⁇ (Xaa)z ⁇ , a nucleic acid moiety, or a small ( molecule moiety.
- R LG is or comprises as described herein.
- R LG is or comprises R c ⁇ (Xaa)z ⁇ as described herein.
- R LG is or comprises a small molecule moiety.
- R LG is or comprises a peptide agent.
- R LG is or comprises a nucleic acid agent.
- R LG is or comprises an aptamer agent.
- an antibody binding moiety is or comprises ( as described herein.
- a protein binding moiety is or comprises as described herein. In some embodiments, an antibody binding moiety is or comprises ( as described herein. In some embodiments, an antibody binding moiety is or comprises R c ⁇ (Xaa)z ⁇ as described herein. In some embodiments, a protein binding moiety is or comprises R c ⁇ (Xaa)z ⁇ as described herein. In some embodiments, an antibody binding moiety is or comprises R c ⁇ (Xaa)z ⁇ as described herein. [0170] In some embodiments, target binding moieties may be conjugated to antibody moieties optionally through linker moieties utilizing technologies described in US 2020/0190165 in accordance with the present disclosure.
- leaving groups include but are not limited to, halogens (e.g. fluoride, chloride, bromide, iodide), sulfonates (e.g. mesylate, tosylate, benzenesulfonate, brosylate, nosylate, triflate), diazonium, and the like.
- an oxygen protecting group includes, for example, carbonyl protecting groups, hydroxyl protecting groups, etc.
- Hydroxyl protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference.
- suitable hydroxyl protecting groups include, but are not limited to, esters, allyl ethers, ethers, silyl ethers, alkyl ethers, arylalkyl ethers, and alkoxyalkyl ethers.
- esters include formates, acetates, carbonates, and sulfonates.
- Specific examples include formate, benzoyl formate, chloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, p-chlorophenoxyacetate, 3- phenylpropionate, 4-oxopentanoate, 4,4-(ethylenedithio)pentanoate, pivaloate (trimethylacetyl), crotonate, 4-methoxy-crotonate, benzoate, p-benylbenzoate, 2,4,6-trimethylbenzoate, carbonates such as methyl, 9-fluorenylmethyl, ethyl, 2,2,2-trichloroethyl, 2-(trimethylsilyl)ethyl, 2-(phenylsulfonyl)ethyl, vinyl, allyl, and p-nitrobenzyl.
- silyl ethers examples include trimethylsilyl, triethylsilyl, t- butyldimethylsilyl, t-butyldiphenylsilyl, triisopropylsilyl, and other trialkylsilyl ethers.
- Alkyl ethers include methyl, benzyl, p-methoxybenzyl, 3,4-dimethoxybenzyl, trityl, t-butyl, allyl, and allyloxycarbonyl ethers or derivatives.
- Alkoxyalkyl ethers include acetals such as methoxymethyl, methylthiomethyl, (2- methoxyethoxy)methyl, benzyloxymethyl, beta-(trimethylsilyl)ethoxymethyl, and tetrahydropyranyl ethers.
- arylalkyl ethers include benzyl, p-methoxybenzyl (MPM), 3,4-dimethoxybenzyl, O- nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p-cyanobenzyl, and 2- and 4-picolyl.
- Amino protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference. Suitable amino protecting groups include, but are not limited to, aralkylamines, carbamates, cyclic imides, allyl amines, amides, and the like.
- Examples of such groups include t-butyloxycarbonyl (BOC), ethyloxycarbonyl, methyloxycarbonyl, trichloroethyloxycarbonyl, allyloxycarbonyl (Alloc), benzyloxocarbonyl (CBZ), allyl, phthalimide, benzyl (Bn), fluorenylmethylcarbonyl (Fmoc), formyl, acetyl, chloroacetyl, dichloroacetyl, trichloroacetyl, phenylacetyl, trifluoroacetyl, benzoyl, and the like.
- agents may contain one or more stereocenters, and may be present as a racemic or diastereomeric mixture.
- One of skill in the art will also appreciate that there are many methods known in the art for the separation of isomers to obtain stereoenriched or stereopure isomers of those compounds, including but not limited to HPLC, chiral HPLC, fractional crystallization of diastereomeric salts, kinetic enzymatic resolution (e.g. by fungal-, bacterial-, or animal-derived lipases or esterases), and formation of covalent diastereomeric derivatives using an enantioenriched reagent.
- reaction partners are generally contacted with each other under conditions and for a time sufficient for production of the desired results, e.g., formation of product agents and compositions thereof to desired extents.
- reaction conditions/reaction times may be assessed and utilized if they are suitable for desired purposes in accordance with the present disclosure; certain such conditions, reaction times, assessment, etc. are described in the Examples.
- an agent formed e.g., a product MATE agent, has the structure of formula M-I or M-II, or a salt thereof.
- a cellular receptor binding moiety in a product agent is the same as a cellular receptor binding moiety in a reaction partner (e.g., a first agent comprising a cellular receptor binding moiety) utilized to prepare a product agent.
- a reaction partner e.g., a first agent comprising a cellular receptor binding moiety
- an antibody moiety in a product agent is the same as an antibody moiety in a reaction partner (e.g., a second agent comprising an antibody moiety) utilized to prepare a product agent.
- linker moieties (or a part thereof) connected to target binding moieties and/or antibody moieties may be transferred from reaction partners (e.g., L RM of formula R-I or a salt thereof).
- a linker moiety in a product agent (may be referred to as L PM ; e.g., L in formula M-I or M-II) is or comprises a linker moiety in a reaction partner (e.g., one between a reactive group and a cellular receptor binding moiety, e.g., L RM ).
- L PM is or comprises L RM .
- L PM is ⁇ L RM ⁇ L RG2 ⁇ .
- L RG2 is ⁇ C(O) ⁇ . In some embodiments, L RG2 is ⁇ C(O) ⁇ , and is bonded to ⁇ NH ⁇ of a target agent moiety, e.g., ⁇ NH ⁇ in a side chain of a lysine residue of a protein moiety, which in some embodiments, is an antibody moiety.
- Reaction partners e.g., compounds of formula R-I or salts thereof, typically do not contain moieties that can react with reactive groups under conditions under which reactive groups react with target agents.
- reactions between such moieties and reactive groups are significantly slower and/or less efficient compared to reactions between reactive groups and target agents.
- reactions between such moieties and reactive groups do not significantly reduce (e.g., no more than about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, etc. of reduction) efficiencies, yields, rates, and/or conversions, etc., of reactions between reactive groups and target agents.
- reactive groups react with amino groups (e.g., ⁇ NH 2 groups) of target agents (e.g., protein agents such as antibody agents).
- reaction partners e.g., compounds of formula R-I or salts thereof, do not contain amine groups.
- compounds of formula R-I or salts thereof or portions thereof, such as R LG , L LG , L LG1 , L LG2 , L LG3 , L LG4 , L RG1 , L RG2 , L RM , and/or MOI
- amine groups e.g., primary amine groups, are capped (e.g., by introduction of acyl groups (e.g., R ⁇ C(O) ⁇ (e.g., acetyl)) to form amide groups) to prevent or reduce undesired reactions.
- reactions are performed in buffer systems.
- buffer systems of present disclosure maintains structures and/or functions of target agents, cellular receptor binding moiety, etc.
- a buffer is a phosphate buffer.
- a buffer is a PBS buffer.
- a buffer is a borate buffer.
- buffers of the present disclosure provide and optionally maintain certain pH value or range.
- a useful pH is about 7-9, e.g., 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 9.0, etc.
- a pH is 7.4.
- a pH is 7.5. In some embodiments, a pH is 7.8. In some embodiments, a pH is 8.0. In some embodiments, a pH is 8.2. In some embodiments, a pH is 8.3. [0182] Provided technologies can provide various advantages.
- connection of a cellular receptor binding moiety in a reaction partner e.g., a compound comprising a reactive group located between an antibody binding moiety and a cellular receptor binding moiety (e.g., a compound of formula R-I or a salt thereof)
- an agent comprising an antibody moiety e.g., a second agent such as an antibody agent
- no separate reactions/steps are performed to remove antibody binding moieties.
- provided technologies can avoid separate steps for antibody binding moiety removal and can improve overall efficiency (e.g., by simplify operations, increasing overall yield, etc.), reduce manufacturing cost, improve product purity (e.g., by avoiding exposure to antibody binding moiety removal conditions, which typically involve one or more of reduction, oxidation, hydrolysis (e.g., of ester groups), etc., conditions and may damage target agent moieties (e.g., for protein agent moieties, protein amino acid residues, overall structures, and/or post- translational modifications (e.g., glycans of antibodies) thereof.
- target agent moieties e.g., for protein agent moieties, protein amino acid residues, overall structures, and/or post- translational modifications (e.g., glycans of antibodies) thereof.
- provided technologies among other things can provided improved efficiency (e.g., in terms of reaction rates and/or conversion percentages), increased yield, increased purity/homogeneity, and/or enhanced selectivity, particularly compared to reference technologies wherein a reaction partner containing no antibody binding moieties is used, without introducing step(s) for antibody binding moiety removal (e.g., antibody binding moiety is removed in the same step as cellular receptor binding moiety conjugation).
- the present disclosure provides products of provided processes, which, among other things, contain low levels of damage to antibody moieties compared to processes comprising steps which are performed for antibody binding moiety removal but not for substantial conjugation of moieties of interest (e.g. target binding moieties).
- provided product agent compositions have high homogeneity (e.g., with respect to the number of cellular receptor binding moiety per antibody moiety, and/or positions of amino acid residues in antibody moieties conjugated to moieties of interest) compared to reference product compositions (e.g., those from technologies without using antibody binding moieties, or utilizing extra step(s) for antibody binding moiety removal (e.g., not utilizing reaction partners described herein which comprise a reactive group located between an antibody binding moiety and a cellular receptor binding moiety).
- reference product compositions e.g., those from technologies without using antibody binding moieties, or utilizing extra step(s) for antibody binding moiety removal (e.g., not utilizing reaction partners described herein which comprise a reactive group located between an antibody binding moiety and a cellular receptor binding moiety).
- the present disclosure provides a product agent which is an agent comprising an antibody moiety, a cellular receptor binding moiety and optionally a linker moiety linking an antibody binding moiety and a cellular receptor binding moiety. In some embodiments, the present disclosure provides compositions of such agents. [0185] In some embodiments, the present disclosure provides a composition comprising a plurality of agents, wherein each agent independently comprises: an antibody moiety, a cellular receptor binding moiety, and optionally a linker moiety linking an antibody binding moiety and a cellular receptor binding moiety. [0186] In some embodiments, product agents are MATE agents. In some embodiments, an antibody agent moiety comprises IgG Fc region.
- an antibody moiety is connected to a cellular receptor binding moiety through an amino group optionally through a linker. In some embodiments, it is through a lysine residue wherein the amino group of the side chain is connected to a cellular receptor binding moiety optionally through a linker (e.g., forming ⁇ NH ⁇ C(O) ⁇ as part of an amide group, a carbamate group, etc.).
- linker e.g., forming ⁇ NH ⁇ C(O) ⁇ as part of an amide group, a carbamate group, etc.
- selected locations of antibody moieties are utilized for conjugation. For example, in some embodiments, K246 or K248 of an antibody agent (EU numbering, or corresponding residues) are conjugation locations.
- a conjugation location is K246 of heavy chain (unless otherwise specified, locations herein include corresponding residues in, e.g., modified sequence (e.g., longer, shorter, rearranged, etc., sequences)).
- a location is K248 of heavy chain.
- a location is K288 or K290 of heavy chain.
- a location is K288 of heavy chain.
- a location is K290 of heavy chain.
- a location is K317.
- an antibody moiety is a moiety of an IgG1 antibody or a fragment thereof.
- an antibody moiety is a moiety of an IgG2 antibody or a fragment thereof. In some embodiments, an antibody moiety is a moiety of an IgG4 antibody or a fragment thereof. In some embodiments, a composition comprises a plurality of MATE agents, wherein antibody moieties of the plurality of MATE agents are independently an antibody moiety of an IgG1, IgG2, or IgG4 antibody, or a fragment thereof. [0188] In some embodiments, antibody heavy chains are selectively conjugated/labeled over light chains.
- the present disclosure can provide controlled cellular receptor binding moiety (e.g., a cellular receptor binding moiety)/antibody moiety ratios (e.g., for cellular receptor binding moiety being peptide cellular receptor binding moiety, peptide cellular receptor binding moiety /antibody ratio (PAR)).
- controlled cellular receptor binding moiety e.g., a cellular receptor binding moiety
- antibody moiety ratios e.g., for cellular receptor binding moiety being peptide cellular receptor binding moiety, peptide cellular receptor binding moiety /antibody ratio (PAR)
- a ratio is about 0.1-10, 0.5-6, etc., e.g., about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, or 0.9 to about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6, 7, 8, 9, 10, about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6, 7, 8, 9, 10, etc.).
- a ratio is of moieties of interest conjugated to antibody moiety and antibody moieties conjugated to moieties of interest (e.g., when a ratio is in the context of a ratio of an agent). In some embodiments, a ratio is of moieties of interest conjugated to antibody moieties and all antibodies in a composition (e.g., when a ratio is in the context of a ratio of a composition). In some embodiments, a ratio is about 0.1-6. In some embodiments, a ratio is about 0.5-2.5. In some embodiments, a ratio is about 0.5-2. In some embodiments, a ratio is about 1-2. In some embodiments, a ratio is about 1.5-2.
- a ratio is about 1.5-2 for IgG1, IgG2 and/or IgG4 antibodies or fragments thereof.
- a ratio is about 1.5-2.5.
- a ratio is about 0.1.
- a ratio is about 0.2.
- a ratio is about 0.3.
- a ratio is about 0.4.
- a ratio is about 0.5.
- a ratio is about 0.6.
- a ratio is about 0.7.
- a ratio is about 0.8.
- a ratio is about 0.9.
- a ratio is about 1. In some embodiments, a ratio is about 1.1. In some embodiments, a ratio is about 1.2. In some embodiments, a ratio is about 1.3. In some embodiments, a ratio is about 1.4. In some embodiments, a ratio is about 1.5. In some embodiments, a ratio is about 1.6. In some embodiments, a ratio is about 1.7. In some embodiments, a ratio is about 1.8. In some embodiments, a ratio is about 1.9. In some embodiments, a ratio is about 2. In some embodiments, a ratio is about 2.1. In some embodiments, a ratio is about 2.2. In some embodiments, a ratio is about 2.3. In some embodiments, a ratio is about 2.4.
- a ratio is about 2.5. In some embodiments, a ratio is about 1.8 for a composition wherein antibody moieties of a plurality of agents are those of an IVIG preparation. In some embodiments, a ratio of target binding moieties and antibody moieties is about 1.5-2 wherein antibody moieties of a plurality of agents are those of IgG1. In some embodiments, a ratio of target binding moieties and antibody moieties is about 1.5-2 wherein antibody moieties of a plurality of agents are those of IgG2. In some embodiments, a ratio of target binding moieties and antibody moieties is about 1.5-2 wherein antibody moieties of a plurality of agents are those of IgG4. In some embodiments, a ratio is about 1.9-2.
- agents e.g., agents of formula M-I or M-II, or a salt thereof
- substantially all conjugation sites of antibody moieties have the same modifications (e.g., all share the same moieties of interest optionally connected through the same linker moieties).
- no conjugation sites bear different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
- about 10%-100% of all, or substantially all, moieties of interest e.g., target binding moieties, conjugated to antibody moieties of a particular type of antibodies (e.g., IgG1) or fragments thereof are conjugated to one or more particularly sites, typically one or two particularly sites (e.g., K246 and K248 of an IgG1 heavy chain and amino acid residues corresponding thereto).
- about 10%-100% of all, or substantially all, moieties of interest, e.g., target binding moieties, conjugated to antibody moieties of IgG2 antibodies or fragments thereof are at K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto.
- about 10%-100% of all, or substantially all, moieties of interest, e.g., target binding moieties, conjugated to antibody moieties of IgG2 antibodies or fragments thereof are at K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto.
- about 10%-100% of all, or substantially all, moieties of interest are conjugated to antibody moieties of IgG1, IgG2, and/or IgG4 antibodies, or fragments thereof (e.g., for conjugation products with IgG1 antibodies or fragments thereof (antibody moieties being of IgG1 antibodies or fragments thereof), IgG2 antibodies or fragments thereof (antibody moieties being of IgG2 antibodies or fragments thereof), IgG4 antibodies or fragments thereof (antibody moieties being of IgG4 antibodies or fragments thereof), or for conjugation products with IVIG (when certain provided technologies described herein are utilized, selective conjugation with IgG1, IgG2 and IgG4).
- a percentage is about 10% or more. In some embodiments, a percentage is about 20% or more. In some embodiments, a percentage is about 25% or more. In some embodiments, a percentage is about 30% or more. In some embodiments, a percentage is about 40% or more. In some embodiments, a percentage is about 50% or more. In some embodiments, a percentage is about 60% or more. In some embodiments, a percentage is about 65% or more. In some embodiments, a percentage is about 70% or more. In some embodiments, a percentage is about 75% or more. In some embodiments, a percentage is about 80% or more. In some embodiments, a percentage is about 85% or more. In some embodiments, a percentage is about 90% or more.
- a composition comprises a plurality of agents (e.g., MATE agents, agents of formula M-I or M-II, or a salt thereof), each independent comprising a cellular receptor binding moiety, an antibody moiety, and optionally a linker moiety linking a cellular receptor binding moiety and an antibody moiety.
- agents e.g., MATE agents, agents of formula M-I or M-II, or a salt thereof
- substantially all target binding moieties of a plurality of agents are the same.
- substantially all target binding moieties of a plurality of agents comprise peptide moieties of a common amino acid sequence.
- substantially all target binding moieties of a plurality of agents are peptide moieties of a common amino acid sequence.
- substantially all conjugation sites of antibody moieties in a plurality of agents have the same modifications (e.g., all share the same moieties of interest optionally connected through the same linker moieties).
- no conjugation sites of a plurality of agents bear different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
- a plurality of agents do not contain agents that share the same (or substantially the same) antibody moieties but different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
- agents that share the same (or substantially the same) antibody moieties but different modifications e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties
- are intermediates of multiple-step preparations e.g., comprising steps for removal of antibody binding moieties in addition to steps for cellular receptor binding moiety conjugation
- the present disclosure provides a composition
- a composition comprising a plurality of agents each of which independently comprising: an antibody moiety, a cellular receptor binding moiety, and optionally a linker moiety linking the antibody moiety and the cellular receptor binding moiety; wherein antibody moieties of agents of the plurality comprise a common amino acid sequence, and agents of the plurality share a common cellular receptor binding moiety independently at at least one common amino acid residue of the common amino acid sequence; and wherein about 1%-100% of all agents that comprise an antibody moiety that comprise the common amino acid sequence and the cellular receptor binding moiety are agents of the plurality.
- the present disclosure provides a composition comprising a plurality of agents each of which independently comprising: an antibody moiety, a cellular receptor binding moiety, and optionally a linker moiety linking an antibody moiety and a cellular receptor binding moiety; wherein agents of the plurality share the same or substantially the same antibody moiety, and a cellular receptor binding moiety at at least one common location; and wherein about 1%-100% of all agents that comprise the antibody moiety and the cellular receptor binding moiety are agents of the plurality.
- an antibody moiety is a moiety of an IgG1 antibody or a fragment thereof.
- an antibody moiety is a moiety of an IgG2 antibody or a fragment thereof. In some embodiments, an antibody moiety is a moiety of an IgG3 antibody or a fragment thereof. In some embodiments, an antibody moiety is a moiety of an IgG4 antibody or a fragment thereof. In some embodiments, about 1-100% of all moieties of interest are at common location(s). In some embodiments, a cellular receptor binding moiety is a cellular receptor binding moiety as described herein. In some embodiments, agents of a plurality are each independently of formula M-I or M-II, or a salt thereof. [0196] In some embodiments, antibody moieties of agents of a plurality comprise a common amino acid sequence.
- antibody moieties of agents of a plurality comprise a common amino acid sequence in a Fc region. In some embodiments, antibody moieties of agents of a plurality comprise a common Fc region. In some embodiments, antibody moieties of agents of a plurality can bind a common antigen specifically. In some embodiments, antibody moieties are monoclonal antibody moieties. In some embodiments, antibody moieties are polyclonal antibody moieties. In some embodiments, antibody moieties bind to two or more different antigens. In some embodiments, antibody moieties bind to two or more different proteins. In some embodiments, antibody moieties are IVIG moieties.
- a cellular receptor binding moiety in an agent of a plurality is a cellular receptor binding moiety.
- each cellular receptor binding moiety is independently a cellular receptor binding moiety.
- a composition comprises a plurality of agents, antibody moieties of agents of the plurality comprise a common amino acid sequence, and agents of a plurality share a common cellular receptor binding moiety independently linked to a common amino acid residue in the common amino acid sequence, each independently and optionally through a linker; and wherein about 1%-100% of all agents that comprise an antibody moiety that comprises a common amino acid sequence and a common cellular receptor binding moiety independently comprise a common cellular receptor binding moiety linked to a common amino acid residue independently and optionally through a linker.
- a composition comprises a plurality of agents, antibody moieties of agents of a plurality comprise a common amino acid sequence, and agents of a plurality share a common cellular receptor binding moiety independently linked to a common amino acid residue in the common amino acid sequence, each independently through a common linker; and wherein about 1%-100% of all agents that comprise an antibody moiety that comprises a common amino acid sequence and a common cellular receptor binding moiety independently comprise a common cellular receptor binding moiety linked to a common amino acid residue independently and through a common linker.
- a composition comprises a plurality of agents, antibody moieties of agents of a plurality comprise a common amino acid sequence, and agents of a plurality share a common cellular receptor binding moiety independently linked to a common amino acid residue in the common amino acid sequence, each independently and optionally through a linker; and wherein about 1%-100% of all agents that comprise an antibody moiety that comprises a common amino acid sequence and a common cellular receptor binding moiety are agents of a plurality.
- a composition comprises a plurality of agents, wherein antibody moieties of agents of a plurality comprise a common amino acid sequence, and agents of a plurality share a common cellular receptor binding moiety independently linked to a common amino acid residue in the common amino acid sequence, each independently through a common linker; and wherein about 1%-100% of all agents that comprise an antibody moiety that comprises a common amino acid sequence, a common cellular receptor binding moiety, and a common linker are agents of a plurality.
- “at least one” or “one or more” is 1-1000, 1-500, 1-200, 1-100, 1-90, 1-80, 1-70, 1-60, 1-50, 1-40, 1-30, 1-20, 1-10, 1-5, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more. In some embodiments, it is one. In some embodiments, it is two or more. In some embodiments, it is about 3. In some embodiments, it is about 4. In some embodiments, it is about 5. In some embodiments, it is about 6. In some embodiments, it is about 7. In some embodiments, it is about 8. In some embodiments, it is about 9. In some embodiments, it is about 10.
- a common amino acid sequence comprises 1-1000, 1-500, 1-400, 1- 300, 1-200, 1-100, 1-50, 10-1000, 10-500, 10-400, 10-300, 10-200, 10-100, 10-50, 20-1000, 20-500, 20- 400, 20-300, 20-200, 20-100, 20-50, 50-1000, 50-500, 50-400, 50-300, 50-200, 50-100, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, 250, 300, 400, 500, 600 or more amino acid residues.
- a length is at least 5 amino acid residues. In some embodiments, a length is at least 10 amino acid residues. In some embodiments, a length is at least 50 amino acid residues. In some embodiments, a length is at least 100 amino acid residues. In some embodiments, a length is at least 150 amino acid residues. In some embodiments, a length is at least 200 amino acid residues. In some embodiments, a length is at least 300 amino acid residues. In some embodiments, a length is at least 400 amino acid residues. In some embodiments, a length is at least 500 amino acid residues. In some embodiments, a length is at least 600 amino acid residues.
- a common amino acid sequence is at least 10%-100%, 50%-100%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%,, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of an amino acid sequence of an antibody moiety, a protein agent moiety, etc. In some embodiments, it is 10% or more. In some embodiments, it is 20% or more. In some embodiments, it is 30% or more. In some embodiments, it is 40% or more. In some embodiments, it is 50% or more. In some embodiments, it is 60% or more. In some embodiments, it is 70% or more. In some embodiments, it is 80% or more.
- one and only one amino acid residue is linked to a common cellular receptor binding moiety, e.g., a common cellular receptor binding moiety.
- two and only two amino acid residues are linked to a common cellular receptor binding moiety, e.g., a common cellular receptor binding moiety.
- two or more amino acid residues are linked to a common cellular receptor binding moiety, e.g., a common cellular receptor binding moiety.
- each common cellular receptor binding moiety e.g., a common cellular receptor binding moiety, is independently linked to an amino acid residue in a common amino acid sequence.
- a common amino acid sequence comprises one or more amino acid residues selected from K246 and K248 of an IgG1 heavy chain and amino acid residues corresponding thereto, K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto, and K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto.
- a common amino acid sequence comprises one or more amino acid residues selected from K246 and K248 of an IgG1 heavy chain and amino acid residues corresponding thereto. In some embodiments, a common amino acid sequence comprises one or more amino acid residues selected from K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto. In some embodiments, a common amino acid sequence comprises one or more amino acid residues selected from K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto. In some embodiments, a cellular receptor binding moiety is connected to such an amino acid residue (unless explicitly noted, optionally through a linker moiety).
- each cellular receptor binding moiety is connected to such an amino acid residue each optionally and independently through a linker moiety.
- antibody moieties share a high percentage of amino acid sequence homology. In some embodiments, it is about 50%-100%. In some embodiments, it is 50%. In some embodiments, it is 60%. In some embodiments, it is 70%. In some embodiments, it is 80%. In some embodiments, it is 90%. In some embodiments, it is 91%. In some embodiments, it is 50%. In some embodiments, it is 92%. In some embodiments, it is 93%. In some embodiments, it is 94%. In some embodiments, it is 95%. In some embodiments, it is 96%.
- it is 97%. In some embodiments, it is 98%. In some embodiments, it is 99%. In some embodiments, it is 100%. In some embodiments, it is at least 50%. In some embodiments, it is at least 60%. In some embodiments, it is at least 70%. In some embodiments, it is at least 80%. In some embodiments, it is at least 90%. In some embodiments, it is at least 91%. In some embodiments, it is at least 50%. In some embodiments, it is at least 92%. In some embodiments, it is at least 93%. In some embodiments, it is at least 94%. In some embodiments, it is at least 95%. In some embodiments, it is at least 96%. In some embodiments, it is at least 97%.
- a percentage used herein e.g., about 1%-100%, is about 10% or more. In some embodiments, a percentage is about 20% or more. In some embodiments, a percentage is about 25% or more. In some embodiments, a percentage is about 30% or more. In some embodiments, a percentage is about 40% or more. In some embodiments, a percentage is about 50% or more. In some embodiments, a percentage is about 60% or more. In some embodiments, a percentage is about 65% or more. In some embodiments, a percentage is about 70% or more. In some embodiments, a percentage is about 75% or more.
- a percentage is about 80% or more. In some embodiments, a percentage is about 85% or more. In some embodiments, a percentage is about 90% or more. In some embodiments, a percentage is about 95% or more. In some embodiments, a percentage is about 100%.
- antibody moiety of agents of a plurality comprise a common Fc region or a fragment thereof.
- moieties of interest of agents of a plurality are at particular locations. In some embodiments, all moieties of interest are at amino acid residues of a common amino acid sequence. In some embodiments, all moieties of interest are at common locations of amino acid residues of a common amino acid sequence.
- the number of common locations is 1. In some embodiments, it is 2. In some embodiments, it is 3. In some embodiments, it is 4. In some embodiments, antibody moieties comprise two heavy chains or fragments thereof, and the number of common locations is 2 (one on each chain). In some embodiments, common locations are selected from K246 and K248 of an IgG1 heavy chain and amino acid residues corresponding thereto, K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto, and K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto. [0207] In some embodiments, agents of a plurality share a common cellular receptor binding moiety independently at at least one location.
- agents of a plurality share a common cellular receptor binding moiety and linker independently at at least one location.
- moieties of interest at two or more or all locations comprise a common cellular receptor binding moiety.
- moieties of interest are the same.
- agents share a common modification at least one common amino acid residue.
- agents of a plurality share a common modification at each location which is connected to a cellular receptor binding moiety and optionally a linker.
- agents of a plurality the same ⁇ L PM ⁇ TBT at each location that is connected to a linker moiety.
- a location is selected from K246, K248, K288, K290, K317 of antibody agents and locations corresponding thereto. In some embodiments, a location is selected from K246 and K248, and locations corresponding thereto. In some embodiments, a location is selected from K288 and K290, and locations corresponding thereto. In some embodiments, a location is K246 or a location corresponding thereto. In some embodiments, a location is K248 or a location corresponding thereto. In some embodiments, a location is K288 or a location corresponding thereto. In some embodiments, a location is K290 or a location corresponding thereto.
- a location is K317 or a location corresponding thereto. In some embodiments, a location is K185 of light chain or a location corresponding thereto. In some embodiments, a location is K187 of light chain or a location corresponding thereto. In some embodiments, a location is K133 of heavy chain or a location corresponding thereto. In some embodiments, a location is K246 or K248 of heavy chain or a location corresponding thereto. In some embodiments, a location is K414 of heavy chain or a location corresponding thereto.
- a common sequence is a sequence that is about or at least about 10-100, 20-50, e.g., about or at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, amino acid residues in length, and comprises one or more of such residues or residues corresponding thereto.
- a common sequence is a sequence that is about or at least about 10-100, 20-50, e.g., about or at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, amino acid residues in length, and comprises one, two or more residues selected from K246 and K248 of an IgG1 heavy chain and amino acid residues corresponding thereto, K251 and K253 of an IgG2 heavy chain and amino acid residues corresponding thereto, and K239 and K241 of an IgG4 heavy chain and amino acid residues corresponding thereto. [0210] In some embodiments, about 1%-100% of all agents that comprise an antibody moiety and a cellular receptor binding moiety are agents of a plurality.
- about 1%-100% of all agents that comprise an antibody moiety that comprises a common amino acid sequence and a cellular receptor binding moiety are agents of a plurality. In some embodiments, about 1%-100% of all agents that comprise an antibody moiety that comprise a common amino acid sequence or can bind to a common antigen and a cellular receptor binding moiety are agents of a plurality. In some embodiments, about 1%-100% of all agents that comprise an antibody moiety are agents of a plurality. In some embodiments, about 1%-100% of all agents that comprise an antibody moiety that comprise the common amino acid sequence are agents of a plurality.
- about 1%-100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence are agents of a plurality. In some embodiments, about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen are agents of a plurality. In some embodiments, a percentage is about 5%-100%. In some embodiments, a percentage is about 10%-100%. In some embodiments, a percentage is about 20%-100%. In some embodiments, a percentage is about 25%-100%. In some embodiments, a percentage is about 30%- 100%. In some embodiments, a percentage is about 40%-100%. In some embodiments, a percentage is about 50%-100%. In some embodiments, it is about 5%.
- it is about 10%. In some embodiments, it is about 20%. In some embodiments, it is about 25%. In some embodiments, it is about 30%. In some embodiments, it is about 40%. In some embodiments, it is about 50%. In some embodiments, it is about 60%. In some embodiments, it is about 70%. In some embodiments, it is about 80%. In some embodiments, it is about 90%. In some embodiments, it is about 91%. In some embodiments, it is about 50%. In some embodiments, it is about 92%. In some embodiments, it is about 93%. In some embodiments, it is about 94%. In some embodiments, it is about 95%. In some embodiments, it is about 96%. In some embodiments, it is about 97%.
- it is about 98%. In some embodiments, it is about 99%. In some embodiments, it is about 100%. In some embodiments, it is at least about 5%. In some embodiments, it is at least about 10%. In some embodiments, it is at least about 20%. In some embodiments, it is at least about 25%. In some embodiments, it is at least about 30%. In some embodiments, it is at least about 40%. In some embodiments, it is at least about 50%. In some embodiments, it is at least about 60%. In some embodiments, it is at least about 70%. In some embodiments, it is at least about 80%. In some embodiments, it is at least about 90%. In some embodiments, it is at least about 91%. In some embodiments, it is at least about 50%.
- it is at least about 92%. In some embodiments, it is at least about 93%. In some embodiments, it is at least about 94%. In some embodiments, it is at least about 95%. In some embodiments, it is at least about 96%. In some embodiments, it is at least about 97%. In some embodiments, it is at least about 98%. In some embodiments, it is at least about 99%.
- each agent of the plurality does not contain ⁇ S ⁇ Cy ⁇ , wherein ⁇ Cy ⁇ is optionally substituted 5-membered monocyclic ring, does not contain ⁇ S ⁇ S ⁇ which is not formed by cysteine residues and does not contain ⁇ SH or salt form thereof that is not of a cysteine residue.
- each agent of the plurality does not contain ⁇ S ⁇ CH 2 ⁇ CH 2 ⁇ .
- each agent of the plurality does not contain a moiety that can specifically bind to an antibody agent.
- a composition is substantially free from a moiety that can specifically bind to an antibody agent.
- provided agents, compounds, etc. e.g., those of formula R-I, M-I, M- II, etc. and salts thereof have high purity.
- a percentage is about 5%-100%. In some embodiments, a percentage is about 10%-100%. In some embodiments, a percentage is about 20%-100%. In some embodiments, a percentage is about 25%-100%. In some embodiments, a percentage is about 30%-100%. In some embodiments, a percentage is about 40%-100%. In some embodiments, a percentage is about 50%-100%. In some embodiments, it is about 5%. In some embodiments, it is about 10%. In some embodiments, it is about 20%. In some embodiments, it is about 25%.
- it is about 30%. In some embodiments, it is about 40%. In some embodiments, it is about 50%. In some embodiments, it is about 60%. In some embodiments, it is about 70%. In some embodiments, it is about 80%. In some embodiments, it is about 90%. In some embodiments, it is about 91%. In some embodiments, it is about 50%. In some embodiments, it is about 92%. In some embodiments, it is about 93%. In some embodiments, it is about 94%. In some embodiments, it is about 95%. In some embodiments, it is about 96%. In some embodiments, it is about 97%. In some embodiments, it is about 98%. In some embodiments, it is about 99%. In some embodiments, it is about 100%.
- it is at least about 5%. In some embodiments, it is at least about 10%. In some embodiments, it is at least about 20%. In some embodiments, it is at least about 25%. In some embodiments, it is at least about 30%. In some embodiments, it is at least about 40%. In some embodiments, it is at least about 50%. In some embodiments, it is at least about 60%. In some embodiments, it is at least about 70%. In some embodiments, it is at least about 80%. In some embodiments, it is at least about 90%. In some embodiments, it is at least about 91%. In some embodiments, it is at least about 50%. In some embodiments, it is at least about 92%. In some embodiments, it is at least about 93%.
- the present disclosure provides product agent compositions comprising product agents (e.g., agents of formula M-I or M-II, or a salt thereof).
- product agents e.g., agents of formula M-I or M-II, or a salt thereof.
- a product agent composition (e.g., a formed agent composition from certain methods) comprises a product agent comprising an antibody moiety and a cellular receptor binding moiety and optionally a linker (e.g., an agent of formula M-I or M-II, or a salt thereof), a released antibody binding moiety (e.g., a compound comprising R LG ⁇ (L LG1 ) 0-1 ⁇ (L LG2 ) 0-1 ⁇ (L LG3 ) 0-1 ⁇ (L LG4 ) 0-1 ⁇ ) or a compound comprising a released antibody binding moiety (e.g., a compound having the structure of R LG ⁇ (L LG1 ) 0-1 ⁇ (L LG2 ) 0-1 ⁇ (L LG3 ) 0-1 ⁇ (L LG4 ) 0- 1 ⁇ H or a salt thereof), and a reaction partner (e.g., a compound of formula R-I or a salt thereof).
- a linker e.
- released antibody binding moieties may bind to antibody moieties in target agents and/or formed product agents.
- Various technologies are available to separate released antibody binding moieties from antibody moieties in accordance with the present disclosure, for example, in some embodiments, contacting a composition with a composition comprising glycine at certain pH.
- each agent of a plurality is independently such a product agent.
- Reactive Group [0214]
- provided agents, compounds, e.g., those useful as reaction partners such as first agents, comprise reactive groups (e.g., RG).
- reactive groups are located between antibody binding moieties (e.g., ABT) and moieties of interest (e.g., MOI), and are optionally and independently linked to antibody binding moieties and moieties of interest via linkers.
- RG is a reaction group as described herein.
- reactive groups when utilized in agents that comprise no antibody binding moieties react slowly and provide low level of, in some embodiments, substantially no conjugation of moieties of interest with target agents.
- combination of reactive groups with antibody binding moieties in the same agents can, among other things, promote reactions between reactive groups and target agents, enhance reaction efficiency, reduce side reactions, and/or improve reaction selectivity (e.g., in terms of target sites wherein conjugation of moieties of interest with target agents occurs).
- Reactive groups in agents can react with various types of groups in target agents.
- reactive groups in agents selectively react with amino groups of target agents, e.g., ⁇ NH 2 groups on side chains of lysine residues of proteins.
- reactive groups when utilized in agents selectively react with particular sites of target agents, e.g., as shown in examples herein, one or more of K246, K248, K288, K290, K317, etc. of IgG1, K251, K 253, etc. for IgG2, K239, K241 for IgG4, etc.
- a site is K246 or K248 of an antibody heavy chain.
- sites are K246 and/or K248 of an antibody heavy chain.
- a site is K246 of an antibody heavy chain.
- a site is K248 of an antibody heavy chain.
- a site is K288 or K290 of an antibody heavy chain. In some embodiments, a site is K288 of an antibody heavy chain. In some embodiments, a site is K290 of an antibody heavy chain. In some embodiments, a site is K317. In some embodiments, a site is K414 of an antibody heavy chain. In some embodiments, a site is K185 of an antibody light chain. In some embodiments, a site is K187 of an antibody light chain. In some embodiments, sites are K251 and/or K253 of an IgG2 heavy chain. In some embodiments, a site is K251 of an IgG2 heavy chain. In some embodiments, a site is K253 of an IgG2 heavy chain.
- sites are K239 and/or K241 of an IgG4 heavy chain. In some embodiments, a site is K239 of an IgG4 heavy chain. In some embodiments, a site is K241 of an IgG4 heavy chain. In some embodiments, conjugation selectively occurs at one or more heavy chain sites over light chain sites. In some embodiments, for technologies without antibody binding moieties, conjugation occurs at light chain sites more than heavy chain sites.
- a reactive group e.g., RG
- a reactive group, e.g., RG is or comprises an electrophilic group, e.g., a Michael acceptor.
- a reactive group e.g., RG
- a reactive group is or comprises ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each of L RG1 and L RG2 is independently L as described herein.
- a reactive group e.g., RG
- a reactive group is or comprises ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group, e.g., RG is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group e.g., RG
- a reactive group is or comprises ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group e.g., RG
- a reactive group is or comprises ⁇ L LG4 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group, e.g., RG is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- a reactive group e.g., RG
- a reactive group is or comprises ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG2 ⁇ , wherein each variable is as described herein.
- L LG4 is ⁇ O ⁇ .
- L LG4 is ⁇ N(R) ⁇ .
- L LG4 is ⁇ NH ⁇ .
- L LG3 is or comprises an optionally substituted aryl ring.
- L LG3 is or comprises a phenyl ring.
- an aryl or phenyl ring is substituted.
- a substituent is an electron-withdrawing group as described herein, e.g., ⁇ NO 2 , ⁇ F, etc.
- L RG1 is a covalent bond. In some embodiments, L RG1 is not a covalent bond. In some embodiments, L RG1 is ⁇ S(O) 2 ⁇ . [0222] In some embodiments, L RG2 is ⁇ C(O) ⁇ . In some embodiments, a reactive group is or comprises ⁇ L LG4 ⁇ C(O) ⁇ , wherein each variable is as described herein.
- a reactive group is or comprises ⁇ L LG3 ⁇ L LG4 ⁇ C(O) ⁇ , wherein each variable is as described herein. In some embodiments, a reactive group is or comprises ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ C(O) ⁇ , wherein each variable is as described herein.
- each of R RG1 , R RG2 , R RG3 and R RG4 is independently R’. In some embodiments, one or more of R RG1 , R RG2 , R RG3 and R RG4 is independently ⁇ H. In some embodiments, L RG3 is ⁇ C(O) ⁇ . In some embodiments, L RG3 is ⁇ C(O)O ⁇ . In some embodiments, ⁇ O ⁇ , ⁇ N(R’) ⁇ , etc. of L RG3 is bonded to L PM . [0224] In some embodiments, R RG1 is ⁇ H. In some embodiments, R RG3 is ⁇ H.
- R RG2 and R RG4 are taken together with their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is an optionally substituted 3-10 membered monocyclic or bicyclic ring having 0-5 heteroatoms.
- a formed ring is an optionally substituted 3-10 membered cycloaliphatic ring.
- a formed ring is an optionally substituted 3-8 membered cycloaliphatic ring. In some embodiments, a formed ring is an optionally substituted 5-8 membered cycloaliphatic ring. In some embodiments, a formed ring is an optionally substituted 5-membered cycloaliphatic ring. In some embodiments, a formed ring is an optionally substituted 6-membered cycloaliphatic ring. In some embodiments, a formed ring is an optionally substituted 7-membered cycloaliphatic ring. In some embodiments, a formed ring is substituted. In some embodiments, a formed ring is not substituted.
- a reactive group is a structure selected from the Table below.
- ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is a structure selected from Table below.
- ⁇ L LG2 ⁇ L LG3 ⁇ L LG4 ⁇ L RG1 ⁇ is a structure selected from the Table below.
- ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ O ⁇ C(O) ⁇ .
- ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ S ⁇ C(O) ⁇ .
- ⁇ L LG4 ⁇ L RG1 ⁇ L RG2 ⁇ is ⁇ S ⁇ C(O) ⁇ .
- ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ N( ⁇ ) ⁇ C(O) ⁇ , wherein N is a ring atom of an optionally substituted heteroaryl ring.
- ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ N( ⁇ ) ⁇ C(O) ⁇ , wherein N is a ring atom of L LG4 which is or comprises an optionally substituted heteroaryl ring.
- ⁇ L LG4 ⁇ L RG2 ⁇ is ⁇ N( ⁇ ) ⁇ C(O) ⁇ O ⁇ , wherein N is a ring atom of L LG4 which is or comprises an optionally substituted heteroaryl ring.
- L RG2 is optionally substituted ⁇ CH 2 ⁇ C(O) ⁇ , wherein ⁇ CH 2 ⁇ is bonded to an electron-withdrawing group comprising or connected to an antibody binding moiety.
- L RG2 is optionally substituted ⁇ CH 2 ⁇ bonded to an electron-withdrawing group comprising or connected to an antibody binding moiety.
- L RG1 is an electron-withdrawing group.
- L RG1 is ⁇ C(O) ⁇ . In some embodiments, L RG1 is ⁇ S(O) ⁇ . In some embodiments, L RG1 is ⁇ S(O) 2 ⁇ . In some embodiments, L RG1 is ⁇ P(O(OR) ⁇ . In some embodiments, L RG1 is ⁇ P(O(SR) ⁇ . In some embodiments, L RG1 is ⁇ P(O(N(R) 2 ) ⁇ . In some embodiments, L RG1 is ⁇ OP(O(OR) ⁇ . In some embodiments, L RG1 is ⁇ OP(O(SR) ⁇ . In some embodiments, L RG1 is ⁇ OP(O(N(R) 2 ) ⁇ .
- L RG2 is optionally substituted ⁇ CH 2 ⁇ C(O) ⁇ , wherein ⁇ CH 2 ⁇ is bonded to a leaving group comprising or connected to an antibody binding moiety. In some embodiments, L RG2 is optionally substituted ⁇ CH 2 ⁇ bonded to a leaving group comprising or connected to an antibody binding moiety. In some embodiments, L RG1 is ⁇ O ⁇ C(O) ⁇ . In some embodiments, L RG1 is ⁇ OS(O) 2 ⁇ . In some embodiments, L RG1 is ⁇ OP(O(OR) ⁇ . In some embodiments, L RG1 is ⁇ OP(O(SR) ⁇ .
- L RG1 is ⁇ OP(O(N(R) 2 ) ⁇ .
- a reactive group reacts with an amino group of a target agent. In some embodiments, an amino group is ⁇ NH 2 of the side chain of a lysine residue.
- a target agent is a protein agent. In some embodiments, a target agent is an antibody agent. In some embodiments, a reactive group reacts with an amino acid residue of such protein or antibody agent. In some embodiments, an amino acid residue is a lysine residue. In some embodiments, a reactive group reacts with ⁇ NH 2 of the side chain of a lysine residue.
- a reactive group is or comprises ⁇ C(O) ⁇ O ⁇ , it reacts with ⁇ NH 2 (e.g., of the side chain of a lysine residue), and forms an amide group ⁇ C(O) ⁇ O ⁇ with the ⁇ NH 2 .
- reactive groups e.g., a first reactive group, a second reactive group, etc.
- agents such as first agents comprise first reactive groups linked to target binding moieties optionally through linker moieties, and do not contain antibody binding moieties.
- the present disclosure provides methods for preparing a composition comprising a plurality of agents, wherein each agent independently comprises: an antibody moiety, a cellular receptor binding moiety, and optionally a linker moiety linking an antibody moiety and a cellular receptor binding moiety; which method comprise: contacting a plurality of agents each of which independently comprises a reactive group with a plurality of antibody agents.
- an agent comprising a reactive group comprises an antibody binding moiety, a cellular receptor binding moiety and optionally a linker.
- agents comprising a reactive group share the same cellular receptor binding moiety.
- agents agent comprising a reactive group share the same structure.
- antibody molecules are of such structures, properties and/or activities to provide antibody moieties in agents described herein.
- a plurality of antibody molecules comprise two or more IgG subclasses.
- a plurality of antibody molecules comprise IgG1.
- a plurality of antibody molecules comprise IgG2.
- a plurality of antibody molecules comprise IgG4.
- a plurality of antibody molecules comprise IgG1 and IgG2.
- a plurality of antibody molecules comprise IgG1, IgG2 and IgG4.
- a plurality of antibody molecules comprise IgG1, IgG2, IgG3 and IgG4.
- a plurality of antibody molecules are IVIG antibody molecules.
- provided agents comprise a reactive group, e.g., .
- ⁇ C(O) ⁇ is connected to a cellular receptor binding moiety, or a moiety comprising ⁇ (Xaa)y ⁇ , optionally through a linker and the other end is connected to an antibody binding moiety.
- reacts with an amino group of another moiety e.g., an antibody moiety, forming an amide group with the moiety and releasing a moiety which is or comprises antibody binding moiety.
- an amino group is ⁇ NH 2 of a lysine side chain.
- ⁇ C(O) ⁇ is connected to a cellular receptor binding moiety, or a moiety comprising ⁇ (Xaa)y ⁇ , optionally through a linker and the other end is connected to R’ or an optional substituent.
- provided agents comprise optionally substituted .
- Such reactive groups may be useful for conjugation with detection, diagnosis or therapeutic agents.
- Those skilled in the art will appreciate that a variety of agents, and many technologies (e.g., click chemistry, reactions based on functional groups such as amino groups (e.g., amide formation), hydroxyl groups, carboxyl groups, etc.) can be utilized for conjugation in accordance with the present disclosure.
- antibody binding moieties bind to Fc regions of antibodies. In some embodiments, reactions occur at residues at Fc regions. In some embodiments, target binding moieties are conjugated to residues of Fc regions, optionally through linker moieties. In some embodiments, a residue is a Lys residue. In some embodiments, an antibody is or comprises IgG1. In some embodiments, an antibody is or comprises IgG2. In some embodiments, an antibody is or comprises IgG4. In some embodiments, an antibody composition utilized in a method comprises IgG1 and IgG2. In some embodiments, an antibody composition utilized in a method comprises IgG1, IgG2 and IgG4.
- an antibody composition utilized in a method comprises IgG1, IgG2, IgG3 and IgG4.
- a product is or comprises IgG1.
- a product is or comprises IgG2.
- a product is or comprises IgG4.
- a product composition comprises IgG1 and IgG2.
- a product composition comprises IgG1, IgG2 and IgG4.
- a product composition comprises IgG1, IgG2, IgG3 and IgG4.
- provided agents comprising antibody moieties provide one or more or substantially all antibody immune activities, e.g.
- provided agents comprising antibody moieties do not significantly reduce one or more or substantially all relevant antibody immune activities. In some embodiments, provided agents comprising antibody moieties improve one or more or substantially all relevant antibody immune activities (e.g., compared to antibody moieties by themselves). In some embodiments, provided agents provides comparable or better stability compared to antibody moieties by themselves (e.g., residence time in blood). In some embodiments, antibody moieties in provided agents can bind to FcRy of immune cells (e.g., various FcRy of immune effector cells for desired immune activities; typically at comparable or better levels).
- antibody moieties in provided agents have comparable Fab/antigen binding capabilities. In some embodiments, antibody moieties in provided agents have comparable Fab/antigen binding capabilities. In some embodiments, antibody moieties in provided agents provide FcRn binding. In some embodiments, antibody moieties in provided agents provide FcRn binding, e.g., for antibody recycle and/or prolonged half-life. In some embodiments, provided technologies are particularly useful for modifying blood-derived IgG products as provided technologies are suitable for and can utilize all IgG subclasses. [0242] In some embodiments, a provided method comprises one of the steps described below.
- linker Moieties In some embodiments, reacts with an amino group of a lysine side chain to form an amide bond with an antibody molecule, and releases or a salt form thereof.
- Linker Moieties [0243]
- moieties are optionally connected to each other through linker moieties.
- a reactive group e.g., RG
- a linker e.g., L RM .
- a moiety may also comprise one or more linkers, e.g., L LG1 , L LG2 , L LG3 , L LG4 , etc., to link various portions.
- L LG is a linker moiety described herein.
- L LG1 is a linker moiety described herein.
- L LG2 is a linker moiety described herein.
- L LG3 is a linker moiety described herein.
- L LG4 is a linker moiety described herein.
- L RM is a linker moiety described herein.
- L PM is L as described herein.
- L PM is a linker moiety described herein. In some embodiments, L PM is L as described herein.
- Linker moieties of various types and/or for various purposes, e.g., those utilized in antibody- drug conjugates, etc., may be utilized in accordance with the present disclosure.
- Linker moieties can be either bivalent or polyvalent depending on how they are used. In some embodiments, a linker moiety is bivalent. In some embodiments, a linker is polyvalent and connecting more than two moieties.
- a linker moiety e.g., L z (wherein z represents superscript text; e.g., L PM , L RM , L LG , L LG1 , etc.), is or comprises L.
- L is a covalent bond, or a bivalent or polyvalent optionally substituted, linear or branched C 1-100 group comprising one or more aliphatic, aryl, heteroaliphatic having 1-20 heteroatoms, heteroaromatic having 1-20 heteroatoms, or any combinations thereof, wherein one or more methylene units of the group are optionally and independently replaced with C 1-6 alkylene, C 1-6 alkenylene, a bivalent C 1-6 heteroaliphatic group having 1-5 heteroatoms, C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ ,
- each amino acid residue is independently a residue of an amino acid having the structure of formula A-I or a salt thereof. In some embodiments, each amino acid residue independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ or a salt form thereof.
- L is bivalent. In some embodiments, L is a covalent bond.
- L is a bivalent or optionally substituted, linear or branched group selected from C 1-00 aliphatic and C 1-100 heteroaliphatic having 1-50 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with C 1-6 alkylene, C 1-6 alkenylene, a bivalent C 1-6 heteroaliphatic group having 1-5 heteroatoms, C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇ S(O) ⁇ , ⁇ S(O) 2
- L is a bivalent or optionally substituted, linear or branched group selected from C 1-20 aliphatic and C 1-20 heteroaliphatic having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with C 1-6 alkylene, C 1-6 alkenylene, a bivalent C 1-6 heteroaliphatic group having 1-5 heteroatoms, C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇ ,
- L is a bivalent or optionally substituted, linear or branched group selected from C 1-20 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , ⁇ C(O)O ⁇ , ⁇ P(O)(OR’) ⁇ , ⁇ P(O)(OR’)
- L is a bivalent or optionally substituted, linear or branched C 1-20 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , ⁇ C(O)O ⁇ , an amino acid residue or ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C
- L is a bivalent or optionally substituted, linear or branched group C 1-100 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with C C , ⁇ Cy ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ O ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ C(O)C(R’) 2 N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , an amino acid residue or ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C(R’) 2 ⁇ ) n ] ⁇ .
- L is a bivalent or optionally substituted, linear or branched group C 1-50 aliphatic wherein one or more methylene units of the group are optionally and independently replaced as described herein. In some embodiments, L is a bivalent or optionally substituted, linear or branched group C 1-40 aliphatic wherein one or more methylene units of the group are optionally and independently replaced as described herein. In some embodiments, L is a bivalent or optionally substituted, linear or branched group C 1-20 aliphatic wherein one or more methylene units of the group are optionally and independently replaced as described herein.
- L is a bivalent or optionally substituted, linear or branched group C 1-10 aliphatic wherein one or more methylene units of the group are optionally and independently replaced as described herein. In some embodiments, L is a bivalent or optionally substituted, linear or branched group C 1-100 alkylene wherein one or more methylene units of the group are optionally and independently replaced as described herein. In some embodiments, L is a bivalent or optionally substituted, linear or branched group C 1-50 alkylene wherein one or more methylene units of the group are optionally and independently replaced as described herein.
- L is a bivalent or optionally substituted, linear or branched group C 1-40 alkylene wherein one or more methylene units of the group are optionally and independently replaced as described herein. In some embodiments, L is a bivalent or optionally substituted, linear or branched group C 1-20 alkylene wherein one or more methylene units of the group are optionally and independently replaced as described herein. In some embodiments, L is a bivalent or optionally substituted, linear or branched group C 1-10 alkylene wherein one or more methylene units of the group are optionally and independently replaced as described herein.
- a linker moiety e.g., L, L PM , L RM , etc., comprises an acidic group, e.g., ⁇ S(O) 2 OH.
- L is or comprises ⁇ [( ⁇ O ⁇ C(R’) 2 ⁇ C(R’) 2 ⁇ ) n ] ⁇ .
- L is or comprises ⁇ [( ⁇ O ⁇ CH 2 ⁇ CH 2 ⁇ ) n ] ⁇ .
- L is ⁇ [( ⁇ CH 2 ⁇ CH 2 ⁇ O) 6 ] ⁇ CH 2 ⁇ CH 2 ⁇ .
- L is ⁇ [( ⁇ CH 2 ⁇ CH 2 ⁇ O) 8 ] ⁇ CH 2 ⁇ CH 2 ⁇ .
- ⁇ CH 2 ⁇ CH 2 ⁇ O ⁇ is bonded to an antibody binding moiety at a ⁇ CH 2 ⁇ .
- ⁇ CH 2 ⁇ CH 2 ⁇ O ⁇ is bonded to a cellular receptor binding moiety at a ⁇ CH 2 ⁇ .
- L PM is such L as described herein.
- L RM is such L as described herein.
- a linker moiety e.g., L
- L is or comprises, one or more ⁇ (CH 2 )n ⁇ O ⁇ , wherein each n is independently 1-20. In some embodiments, it is or comprises one or more ⁇ [(CH 2 )n ⁇ O]m ⁇ , wherein each n is independently 1-20, and m is 1-100. In some embodiments, it comprises two or more ⁇ [(CH 2 )n ⁇ O]m ⁇ , wherein each n is independently 1-20, and each m is 1-100.
- n is independently 1-20, and each m is independently 1-100, and where each p is independently 1 to 10.
- n is 1-10.
- n is 1-5.
- each n is 2.
- m is 1-50.
- m is 1-40.
- m is 1-30. In some embodiments, m is 1-20. In some embodiments, m is 1-10. In some embodiments. In some embodiments, m is 1. In some embodiments, m is 2. In some embodiments, m is 3. In some embodiments, m is 4. In some embodiments, m is 5. In some embodiments, m is 6. In some embodiments, m is 7. In some embodiments, m is 8. In some embodiments, m is 9. In some embodiments, m is 10. In some embodiments, m is 11. In some embodiments, m is 12. In some embodiments, m is 13. In some embodiments, m is 14. In some embodiments, m is 15. In some embodiments, m is 16. In some embodiments, m is 17.
- a linker moiety, or L is or comprises ⁇ (CH 2 CH 2 O)n ⁇ , wherein each ⁇ CH 2 ⁇ is independently and optionally substituted and n is 1-20. In some embodiments, a linker moiety, or L, is or comprises ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently 1-10, and each ⁇ CH 2 ⁇ is independently and optionally substituted. [0254] In some embodiments, a linker moiety is trivalent or polyvalent.
- a linker moiety is L as described herein and L is trivalent or polyvalent. In some embodiments, L is trivalent. For example, in some embodiments, L is ⁇ CH 2 ⁇ N( ⁇ CH 2 ⁇ ) ⁇ C(O) ⁇ .
- a linker moiety e.g., L
- a linker moiety, e.g., L, L RM , etc. is or comprises a reactive group as described herein.
- an agent comprises an antibody binding moiety and a cellular receptor binding moiety linked through a linker which is or comprises a reactive group.
- a reactive group can react with a lysine residue of an antibody in an aqueous buffer as described herein.
- a reactive group is or comprises ⁇ C(O) ⁇ O ⁇ .
- a reactive group is or comprises ⁇ C(O) ⁇ O ⁇ , wherein ⁇ O ⁇ is bonded to an optionally substituted aryl group.
- a reactive group is or comprises ⁇ C(O) ⁇ O ⁇ , wherein ⁇ O ⁇ is bonded to an aryl group substituted with one or more electron-withdrawing groups.
- one or more or each electron-withdrawing group is independently selected from ⁇ NO 2 and ⁇ F.
- an aryl group has the structure of , wherein R s is halogen, ⁇ NO 2 , -F, ⁇ L ⁇ R’, ⁇ C(O) ⁇ L ⁇ R’, ⁇ S(O) ⁇ L ⁇ R’, ⁇ S(O) 2 ⁇ L ⁇ R’, or ⁇ P(O)( ⁇ L ⁇ R’) 2 .
- an aryl group has the structure of , wherein each R s is independently halogen, ⁇ NO 2 , -F, ⁇ L ⁇ R’, ⁇ C(O) ⁇ L ⁇ R’, ⁇ S(O) ⁇ L ⁇ R’, ⁇ S(O) 2 ⁇ L ⁇ R’, or ⁇ P(O)( ⁇ L ⁇ R’) 2 .
- an aryl group is .
- an aryl group is .
- C1 is bound to the ⁇ O ⁇ of ⁇ C(O) ⁇ O ⁇ .
- a cellular receptor binding moiety is at the side of ⁇ C(O) ⁇ and an antibody binding moiety is at the side of ⁇ O ⁇ .
- a linker moiety e.g., L, L RM , etc., comprises a reactive group, wherein upon contact with an antibody, the reactive group reacts with a group of the antibody and conjugates a cellular receptor binding moiety, or a moiety comprising ⁇ (Xaa)y ⁇ , to the antibody optionally through a linker.
- a reactive group is or comprises O , wherein the ⁇ C(O) ⁇ is connected to a cellular receptor binding moiety, or a moiety comprising ⁇ (Xaa)y ⁇ , optionally through a linker.
- a reactive group is or comprises , wherein the ⁇ C(O) ⁇ is connected to a cellular receptor binding moiety, or a moiety comprising ⁇ (Xaa)y ⁇ , optionally through a linker and the other end of the reactive group is connected to an antibody binding moiety.
- L is or comprises a bioorthogonal or enzymatic reaction product moiety.
- L is or comprise an optionally substituted triazole moiety (which is optionally part of a bi- or poly-cyclic ring system).
- L is or comprises LPXTG.
- L is or comprises LPETG.
- L is or comprises LPXT(G)n, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- L is or comprises LPET(G)n, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- a linker moiety e.g., L, L RM , etc., does not contain a reactive group.
- a linker moiety e.g., L, L RM , etc.
- a linker moiety does not contain a reactive group that readily reacts with proteins under aqueous conditions with pH about 6-9 (e.g., physiological conditions).
- a linker moiety e.g., L, L RM , etc.
- a linker moiety e.g., L, L RM , etc.
- a linker moiety e.g., L, L RM , etc.
- a linker moiety comprises no ⁇ S ⁇ S ⁇ .
- a linker moiety, e.g., L, L RM , etc. comprises no ⁇ S ⁇ bonded to a beta carbon of a carbonyl group or a double or triple bond conjugated to a carbonyl group.
- a linker moiety, e.g., L, L RM , etc. comprises no .
- a linker moiety, e.g., L, L RM , etc. comprises no ⁇ S ⁇ .
- an agent comprises a linker which is not a covalent bond.
- a linker has a length of (shortest path between linked moieties) about 1-200, 1-150, 1- 100, 1-90, 1-80, 1-70, 1-60, 1-50, 1-40, 1-30, 10-200, 10-150, 10-100, 10-90, 10-80, 10-70, 10-60, 10-50, 10-40, 10-30, 20-200, 20-150, 20-100, 20-90, 20-80, 20-70, 20-60, 20-50, 20-40, 20-30, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 atoms or bonds.
- provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups (except one or more reactive groups and/or moieties therein) that could be cleaved under conditions that would not substantially damage or transform target agents and/or agents comprising target agent moieties (e.g., conjugation products comprising target agent moieties).
- provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups (except one or more reactive groups and/or moieties therein) that could be cleaved under conditions that would not render target agents and/or agents comprising target agent moieties (e.g., conjugation products comprising target agent moieties) for one or more uses (e.g., for use as diagnostic agents, therapeutic agents, etc.).
- provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups which can be cleaved under bioorthogonal conditions.
- provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups except those which can be cleaved without substantively damaging and/or transforming proteins.
- a cleavage group is a cleavable linker or a cleavable portion described in US 2020/0190165, the cleavable linkers and cleavable portions of each of which is incorporated herein by reference.
- a cleavage group is: , wherein: a wavy line orthogonal to the bond indicates a potential cleavage site, R 2a , R 2b and R 2c are the same or different and each is independently: (i) a hydrogen atom or a halogen atom; (ii) a monovalent hydrocarbon group; (iii) aralkyl; (iv) a monovalent heterocyclic group; (v) R c ⁇ O ⁇ , R c ⁇ C(O) ⁇ , R c ⁇ O ⁇ C(O) ⁇ , or R c ⁇ C(O) ⁇ O ⁇ , wherein R c is hydrogen or a monovalent hydrocarbon group; (vi) ⁇ NR d R e , ⁇ NR d R e ⁇ C(O) ⁇ , ⁇ NR d R e ⁇ C(O)O ⁇ , ⁇ NR d ⁇ C(O) ⁇ , ⁇ NR d ⁇ C(O)O ⁇ , or
- a linker moiety comprises no ⁇ S ⁇ . In some embodiments, a linker moiety comprises no ⁇ S ⁇ S ⁇ (optionally except a disulfide moiety formed by two amino acid residues, in some embodiments, optionally except a disulfide moiety formed by two cysteine residues). In some embodiments, a linker moiety comprises no ⁇ S ⁇ Cy ⁇ . In some embodiments, a linker moiety comprises no ⁇ S ⁇ CH 2 ⁇ Cy ⁇ . In some embodiments, a linker moiety comprises no ⁇ C(O) ⁇ O ⁇ . In some embodiments, a linker moiety comprises no ⁇ C(O) ⁇ S ⁇ .
- a linker moiety comprises no ⁇ C(O) ⁇ CH 2 ⁇ , wherein the ⁇ CH 2 ⁇ is bonded to a benzylic carbon, wherein the phenyl ring of the benzyl group is substituted with ⁇ NO 2 ⁇ at o-position.
- a linker moiety comprise no ⁇ C(O) ⁇ N( ⁇ ) ⁇ moiety, wherein N is a ring atom of a heteroaryl ring.
- a linker moiety does not contain any of these groups.
- L RM is such a linker moiety.
- L PM is such a linker moiety.
- L LG is such a linker moiety.
- an agent of the present disclosure does not contain one or more or all of such moieties.
- an agent comprises no cleavable groups whose cleavage can release LG except one or more optionally in RG.
- an agent comprises no ⁇ S ⁇ S ⁇ , acetal or imine groups except in RG or TBT.
- an agent comprises no ⁇ S ⁇ S ⁇ , acetal or imine groups except that the agent may have ⁇ S ⁇ S ⁇ formed by two amino acid residues.
- an agent comprises no ⁇ S ⁇ S ⁇ , acetal or imine groups except that the agent may have ⁇ S ⁇ S ⁇ formed by cysteine residues. In some embodiments, an agent comprises no ⁇ S ⁇ S ⁇ , acetal or imine groups.
- L is a covalent bond. In some embodiments, L is a bivalent optionally substituted, linear or branched C 1-100 aliphatic group wherein one or more methylene units of the group are optionally and independently replaced. In some embodiments, L is a bivalent optionally substituted, linear or branched C 6-100 arylaliphatic group wherein one or more methylene units of the group are optionally and independently replaced.
- L is a bivalent optionally substituted, linear or branched C 5-100 heteroarylaliphatic group having 1-20 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced.
- L is a bivalent optionally substituted, linear or branched C 1-100 heteroaliphatic group having 1-20 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced.
- a linker moiety e.g., L
- L is or comprises one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more) polyethylene glycol units.
- a linker moiety is or comprises ⁇ (CH 2 CH 2 O) n ⁇ , wherein n is as described in the present disclosure.
- one or more methylene units of L are independently replaced with ⁇ (CH 2 CH 2 O) n ⁇ .
- n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, n is 6. In some embodiments, n is 7. In some embodiments, n is 8. In some embodiments, n is 9. In some embodiments, n is 10. In some embodiments, n is 11. In some embodiments, n is 12.
- n is 13. In some embodiments, n is 14. In some embodiments, n is 15. In some embodiments, n is 16. In some embodiments, n is 17. In some embodiments, n is 18. In some embodiments, n is 19. In some embodiments, n is 20.
- a linker moiety e.g., L
- one or more can be 1-100, 1-50, 1-40, 1-30, 1-20, 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more.
- one or more methylene units of L are independently replaced with an amino acid residue.
- one or more methylene units of L are independently replaced with an amino acid residue, wherein the amino acid residue is of an amino acid of formula A-I or a salt thereof.
- one or more methylene units of L are independently replaced with an amino acid residue, wherein each amino acid residue independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ or a salt form thereof.
- a linker moiety comprises one or more moieties, e.g., amino, carbonyl, etc., that can be utilized for connection with other moieties.
- a linker moiety comprises one or more ⁇ NR’ ⁇ , wherein R’ is as described in the present disclosure.
- ⁇ NR’ ⁇ improves solubility.
- ⁇ NR’ ⁇ serves as connection points to another moiety.
- R’ is ⁇ H.
- one or more methylene units of L are independently replaced with ⁇ NR’ ⁇ , wherein R’ is as described in the present disclosure.
- a linker moiety e.g., L
- one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ .
- a linker moiety, e.g., L comprises a ⁇ NR’ ⁇ group, which can be utilized for connections with a moiety.
- one or more methylene units of L are independently replaced with ⁇ N(R’) ⁇ .
- a linker moiety e.g., L
- one or more methylene units of L are independently replaced with ⁇ C(O)N(R’) ⁇ .
- a linker moiety e.g., L
- one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ .
- ⁇ C(R’) 2 ⁇ is ⁇ CHR’ ⁇ .
- R’ is ⁇ (CH 2 ) 2 C(O)NH(CH 2 ) 11 COOH.
- R’ is ⁇ (CH 2 ) 2 COOH.
- R’ is ⁇ COOH.
- a linker moiety is or comprises one or more ring moieties, e.g., one or more methylene units of L are replaced with ⁇ Cy ⁇ .
- a linker moiety, e.g., L comprises an aryl ring.
- a linker moiety, e.g., L comprises an heteroaryl ring.
- a linker moiety comprises an aliphatic ring.
- a linker moiety, e.g., L comprises an heterocyclyl ring.
- a linker moiety, e.g., L comprises a polycyclic ring.
- a ring in a linker moiety, e.g., L is 3-20 membered.
- a ring is 5-membered.
- a ring is 6-membered.
- a ring in a linker is product of a cycloaddition reaction (e.g., click chemistry, and variants thereof) utilized to link different moieties together.
- a linker moiety e.g., L
- a linker moiety is or comprises .
- a methylene unit of L is replaced with
- a methylene unit of L is replaced with ⁇ Cy ⁇ .
- ⁇ Cy ⁇ is [0276]
- a linker moiety (e.g., L) is or comprises ⁇ CO)y ⁇ .
- L is or comprises —[(CH 2 )nO]mCy[(CH 2 )nO]mNH, or L is — [(CH 2 )nO]mCy[(CH 2 )nO]mNHC(O)[(CH 2 )nO]mNH- , or L is — [(CH 2 )nO]mCy[(CH 2 )nO]m ⁇ NHC(O)[(CH 2 )nO]m ⁇ pNH-, where n, m, and p are independently chosen at each occurrence from 1-20, from 1-12, or 2-10.
- each n is 2, m is independently chosen at each occurrence from an integer from 2-10, or in some embodiments m is independently chosen from an integer from 2-6 and Cy is In some embodiments, a methylene unit of L is replaced with ⁇ Cy ⁇ . In some embodiments, ⁇ Cy ⁇ is . In some embodiments, ⁇ Cy ⁇ is . In some embodiments, ⁇ Cy ⁇ is . [0277] In some embodiments, a linker moiety, e.g., L, in a provided agent, e.g., a compound in N Table 1, comprises . In some embodiments, is N or in the structure. In some embodiments, is . In some embodiments, is .
- a linker moiety is as described in Table 1.
- L is L 1 as described in the present disclosure.
- L is L b as described in the present disclosure.
- L RM is a covalent bond.
- L RM is not a covalent bond.
- L RM is or comprises ⁇ (CH 2 CH 2 O)n ⁇ .
- L RM is or comprises ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L RM is ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L RM is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L RM is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein.
- L PM is a covalent bond. In some embodiments, L PM is not a covalent bond. In some embodiments, L PM is or comprises ⁇ (CH 2 CH 2 O)n ⁇ . In some embodiments, L PM is or comprises ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L PM is ⁇ (CH 2 )n ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 )n ⁇ , wherein each n is independently as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted.
- L PM is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein, and each ⁇ CH 2 ⁇ is independently optionally substituted. In some embodiments, L PM is ⁇ (CH 2 ) 2 ⁇ O ⁇ (CH 2 CH 2 O)n ⁇ (CH 2 ) 2 ⁇ , wherein n is as described herein. [0281] In some embodiments, L PM (e.g., in a product of a first and a second agents) is or comprises a reaction product moiety formed a first reactive moiety and a second reactive moiety.
- a linker moiety (e.g., L PM in a product of a first and a second agents) is or comprises
- a methylene unit of a linker moiety, e.g., L or a linker moiety that can be L (e.g., L RM , L PM , etc.) is replaced with ⁇ Cy ⁇ .
- ⁇ Cy ⁇ is optionally substituted .
- ⁇ Cy ⁇ is .
- L is –[(CH2)nO]mCH2Cy[(CH2)nO]m- or ⁇
- ⁇ Cy ⁇ is .
- ⁇ Cy ⁇ is .
- ⁇ Cy ⁇ is .
- Cellular Receptor Binding Moiety Various receptor binding moieties, according to embodiments of present invention, are described in WO2019/199621A1 published October 17, 2019, WO2019/199634 published October 17, 2019, International Application No. PCT/US2020/055053 filed October 9, 2020, and International Application No. PCT/US2020/055053 filed October 9, 2020, each of which is incorporated herein in its entirety by reference.
- the cellular receptor binding moiety may include an ASGPR binding group connected through an amine group.
- ASGPR asialoglycoprotein receptor (ASGPR) binding group” refers to a binding group which binds to hepatocyte asialoglycoprotein receptor.
- This binding group is also a component of the presently claimed bifunctional compounds as a cellular receptor binding moiety which is covalently bound to the antibody binding moiety through a linker group or directly.
- the ASGPR group selectively binds to hepatocyte asialoglycoprotein receptor on the surface of hepatocytes. It is through this moiety that bifunctional compounds complexed with circulating protein (e.g., galactose-deficient IgA1) bind to hepatocytes. Once bound to the hepatocyte, the circulating protein is taken into the hepatocytes or other cells via a phagocytosis mechanism, wherein the circulating protein is degraded through lysosomal degradation.
- circulating protein e.g., galactose-deficient IgA1
- the amine group may be a primary alkyl amine group or secondary alkyl amine group, each of which is optionally substituted on the amine group with a C 1 -C 3 alkyl group.
- the cellular receptor binding moiety may include an ASGPR binding group according to the chemical structure: O or O wherein X is 1-4 atoms in length and comprises O, S, N(R N1 ) or C(R N1 )(R N1 ) groups such that when X is 1 atom in length, X is O, S, N(R N1 ) or C(R N1 )(R N1 ), when X is 2 atoms in length, no more than 1 atom of X is O, S or N(R N1 ), when X is 3 or 4 atoms in length, no more than 2 atoms of X are O, S or N(R N1 ); wherein R N1 is H or a C 1 -C 3 alkyl group optionally substituted with
- the cellular receptor binding moiety may include an ASGPR binding group according to the chemical structure: wherein X is 1-4 atoms in length and comprises O, S, N(R N1 ) or C(R N1 )(R N1 ) groups such that when X is 1 atom in length, X is O, S, N(R N1 ) or C(R N1 )(R N1 ), when X is 2 atoms in length, no more than 1 atom of X is O, S or N(R N1 ), when X is 3 or 4 atoms in length, no more than 2 atoms of X are O, S or N(R N1 ); wherein each R N1 is independently H or a C 1 -C 3 alkyl group optionally substituted with from 1-3 halo groups, preferably F (R N1 is preferably H or methyl, more often H); R 1 and R 3 are each independently H, -(CH 2 ) K OH, -(CH 2 ) K
- R 1 and R 3 are each independently a group, where is a C 3 -C 8 saturated carbocyclic group;
- R C is absent, H, C 1 -C 4 alkyl which is optionally substituted with from 1-3 halo (preferably fluoro) groups or 1-2 hydroxyl groups, or a group according to the structure: where R 4 , R 5 and R 6 are each independently, H, halo (F, Cl, Br, I), CN, NR N1 R N2 , -(CH 2 ) K OH, -(CH 2 ) K OC 1 -C 4 alkyl, which is optionally substituted with from 1-3 halo (F, Cl, Br, I, preferably F) groups, C 1 -C 3 alkyl, which is optionally substituted with from 1-3 halo (F, Cl, Br, I, preferably F) groups, -O-C 1 -C 3 -alkyl, which is optionally substituted with from 1-3 halo, preferably F groups
- TA R is a group, a group, a group or a group, or R TA is a group which is optionally substituted with up to three, preferably 1 C 1 -C 3 alkyl groups which are optionally substituted with up to three halo (preferably F) groups, or R TA is a group, wherein R N , R N1 and R N2 are each independently H or a C 1 -C 3 alkyl group which is optionally substituted with from one to three halo groups, preferably F, or one or two hydroxyl groups and wherein each -(CH 2 ) K group is optionally substituted with 1-4, preferably 1 or 2, C 1 -C 3 alkyl groups which are optionally substituted with from 1-3 fluoro groups or 1-2 hydroxyl groups; and K is independently 0-4 (0, 1, 2, 3 or 4), preferably 0 or 1, or a pharmaceutically acceptable salt, stereoisomer, solvate or polymorph thereof.
- X is -O-C(R N1 )(R N1 ), C(R N1 )(R N1 )-O-, -S-C(R N1 )(R N1 ), C(R N1 )(R N1 )-S-, N(R N1 )-C(R N1 )(R N1 ), C(R N1 )(R N1 )-N(R N1 ) or C(R N1 )(R N1 )-C(R N1 )(R N1 ) when X is 2 atoms in length, X is -O-C(R N1 )(R N1 )-C(R N1 )(R N1 ), C(R N1 )(R N1 )-O-C(R N1 )(R N1 )-, -O-C(R N1 )(R N1 )-O-, -O-C(R N1 )(R N1
- X is OCH 2 or CH 2 O and R N1 is H.
- the cellular receptor binding moiety may include an ASGPR binding group according to the chemical structure: or where R 1 , R 2 and R 3 are the same as in Claim 9, or a pharmaceutically acceptable salt, stereoisomer, solvate or polymorph thereof.
- the cellular receptor binding moiety may have the following structure: where R A is a C 1 -C 3 alkyl group which is optionally substituted with 1-5 halo (preferably fluoro) groups (preferably R A is a methyl or ethyl group which is optionally substituted with from 1-3 fluoro groups); Z A is -(CH 2 ) IM, -O-(CH 2 ) IM , S-(CH 2 ) IM , NR M -(CH 2 ) IM, C(O)-(CH 2 ) IM - , a PEG group containing from 1 to 8 preferably 1-4 ethylene glycol residues or a -C(O)(CH 2 ) IM NR M group (preferably a PEG containing group comprising from 1 to 8 ethylene glycol, preferably 2-4 ethylene glycol residues) where IM and R M are the same as above; and Z B is absent, (CH 2 ) IM , C(O)-(CH
- R A may be a methyl or ethyl group which is optionally substituted with from 1-3 fluoro groups.
- Z A may be a PEG group containing from 1 to 4 ethylene glycol residues.
- the methyl or ethyl group may be substituted with from 1-3 fluoro groups.
- the ASGPR binding group may be N-acetyl-D-galactosamine.
- the cellular receptor binding moiety may be a low density lipoprotein receptor-related protein 1 (LRP1), a low density lipoprotein receptor (LDLR), a Fc ⁇ RI binding group, a FcRN binding group, a transferrin receptor binding group, or a macrophage scavenger receptor binding group.
- LRP1 low density lipoprotein receptor-related protein 1
- LDLR low density lipoprotein receptor
- Fc ⁇ RI binding group Fc ⁇ RI binding group
- FcRN binding group FcRN binding group
- transferrin receptor binding group a transferrin receptor binding group
- macrophage scavenger receptor binding group a macrophage scavenger receptor binding group.
- Proper protein section and turnover is a necessary process for maintaining homeostasis. Newly synthesized proteins targeted for secretion are first trafficked to the endoplasmic reticulum, where they are post-translationally modified with N-linked glycan chains terminating in sialic acids.
- ASGPR asialoglycoprotein receptor
- Non-glycosylated proteins e.g., immunoglobulins
- Gd-IgA1 galactose-deficient IgA1
- a bifunctional molecule for degrading circulating Gd- IgA1 that takes advantage of ASGPR as an entryway for proteins into the endosomal-lysosomal degradation pathway.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Urology & Nephrology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2023555333A JP2024509282A (ja) | 2021-03-10 | 2022-03-10 | ガラクトース欠損免疫グロブリンの二官能性分解剤 |
| IL305665A IL305665A (en) | 2021-03-10 | 2022-03-10 | Bifunctional degraders of galactose-deficient immunoglobulins |
| MX2023010424A MX2023010424A (es) | 2021-03-10 | 2022-03-10 | Degradadores bifuncionales de inmunoglobulina deficientes en galactosa. |
| CA3211335A CA3211335A1 (en) | 2021-03-10 | 2022-03-10 | Bifunctional degraders of galactose-deficient immunoglobulins |
| US18/548,113 US20240309114A1 (en) | 2021-03-10 | 2022-03-10 | Bifunctional degraders of galactose-deficient immunoglobulins |
| CN202280020292.8A CN116997337A (zh) | 2021-03-10 | 2022-03-10 | 半乳糖缺陷型免疫球蛋白的双官能降解剂 |
| BR112023017702A BR112023017702A2 (pt) | 2021-03-10 | 2022-03-10 | Degradadores bifuncionais de imunoglobulinas deficientes em galactose |
| EP22767951.1A EP4304579A1 (en) | 2021-03-10 | 2022-03-10 | Bifunctional degraders of galactose-deficient immunoglobulins |
| KR1020237033102A KR20230154900A (ko) | 2021-03-10 | 2022-03-10 | 갈락토스-결핍 면역글로불린의 이중기능성 분해제 |
| AU2022232620A AU2022232620A1 (en) | 2021-03-10 | 2022-03-10 | Bifunctional degraders of galactose-deficient immunoglobulins |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163159383P | 2021-03-10 | 2021-03-10 | |
| US63/159,383 | 2021-03-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022192478A1 true WO2022192478A1 (en) | 2022-09-15 |
Family
ID=83227063
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/019658 Ceased WO2022192478A1 (en) | 2021-03-10 | 2022-03-10 | Bifunctional degraders of galactose-deficient immunoglobulins |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20240309114A1 (https=) |
| EP (1) | EP4304579A1 (https=) |
| JP (1) | JP2024509282A (https=) |
| KR (1) | KR20230154900A (https=) |
| CN (1) | CN116997337A (https=) |
| AU (1) | AU2022232620A1 (https=) |
| BR (1) | BR112023017702A2 (https=) |
| CA (1) | CA3211335A1 (https=) |
| IL (1) | IL305665A (https=) |
| MX (1) | MX2023010424A (https=) |
| WO (1) | WO2022192478A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024228935A1 (en) * | 2023-04-29 | 2024-11-07 | Biohaven Therapeutics Ltd. | Bifunctional degraders of galactose-deficient immunoglobulins |
| US12258332B2 (en) | 2021-07-14 | 2025-03-25 | Lycia Therapeutics, Inc. | ASGPR cell surface receptor binding compounds and conjugates |
| EP4351658A4 (en) * | 2021-05-17 | 2026-04-15 | Biohaven Therapeutics Ltd | COMPOSITIONS COMPRISING COMBINED THERAPY AMPLIFIERS |
| WO2026083257A1 (en) | 2024-10-14 | 2026-04-23 | Biohaven Therapeutics Ltd. | Antigen-specific degraders of immunoglobulin a and their uses |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090317381A1 (en) * | 2005-11-18 | 2009-12-24 | Tufts Medical Center | Clearance of abnormal iga1 in iga1 deposition diseases |
| WO2015177668A1 (en) * | 2014-05-19 | 2015-11-26 | Pfizer Inc. | Substituted-6,8-dioxabicyclo[3.2.1]octane-2,3-diol compounds as targeting agents of asgpr |
| US20180256732A1 (en) * | 2013-05-02 | 2018-09-13 | Glykos Finland Oy | Glycoprotein-toxic payload conjugates |
| WO2019199634A1 (en) * | 2018-04-09 | 2019-10-17 | Yale University | Bifunctional small molecules to target the selective degradation of circulating proteins |
| US20200121762A1 (en) * | 2014-02-21 | 2020-04-23 | Ecole Polytechnique Federale De Lausanne (Epfl) | Glycotargeting therapeutics |
-
2022
- 2022-03-10 WO PCT/US2022/019658 patent/WO2022192478A1/en not_active Ceased
- 2022-03-10 BR BR112023017702A patent/BR112023017702A2/pt unknown
- 2022-03-10 EP EP22767951.1A patent/EP4304579A1/en active Pending
- 2022-03-10 CA CA3211335A patent/CA3211335A1/en active Pending
- 2022-03-10 JP JP2023555333A patent/JP2024509282A/ja active Pending
- 2022-03-10 MX MX2023010424A patent/MX2023010424A/es unknown
- 2022-03-10 KR KR1020237033102A patent/KR20230154900A/ko active Pending
- 2022-03-10 AU AU2022232620A patent/AU2022232620A1/en active Pending
- 2022-03-10 CN CN202280020292.8A patent/CN116997337A/zh active Pending
- 2022-03-10 US US18/548,113 patent/US20240309114A1/en active Pending
- 2022-03-10 IL IL305665A patent/IL305665A/en unknown
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090317381A1 (en) * | 2005-11-18 | 2009-12-24 | Tufts Medical Center | Clearance of abnormal iga1 in iga1 deposition diseases |
| US20180256732A1 (en) * | 2013-05-02 | 2018-09-13 | Glykos Finland Oy | Glycoprotein-toxic payload conjugates |
| US20200121762A1 (en) * | 2014-02-21 | 2020-04-23 | Ecole Polytechnique Federale De Lausanne (Epfl) | Glycotargeting therapeutics |
| WO2015177668A1 (en) * | 2014-05-19 | 2015-11-26 | Pfizer Inc. | Substituted-6,8-dioxabicyclo[3.2.1]octane-2,3-diol compounds as targeting agents of asgpr |
| WO2019199634A1 (en) * | 2018-04-09 | 2019-10-17 | Yale University | Bifunctional small molecules to target the selective degradation of circulating proteins |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4351658A4 (en) * | 2021-05-17 | 2026-04-15 | Biohaven Therapeutics Ltd | COMPOSITIONS COMPRISING COMBINED THERAPY AMPLIFIERS |
| US12258332B2 (en) | 2021-07-14 | 2025-03-25 | Lycia Therapeutics, Inc. | ASGPR cell surface receptor binding compounds and conjugates |
| WO2024228935A1 (en) * | 2023-04-29 | 2024-11-07 | Biohaven Therapeutics Ltd. | Bifunctional degraders of galactose-deficient immunoglobulins |
| WO2026083257A1 (en) | 2024-10-14 | 2026-04-23 | Biohaven Therapeutics Ltd. | Antigen-specific degraders of immunoglobulin a and their uses |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240309114A1 (en) | 2024-09-19 |
| MX2023010424A (es) | 2023-09-18 |
| EP4304579A1 (en) | 2024-01-17 |
| KR20230154900A (ko) | 2023-11-09 |
| CA3211335A1 (en) | 2022-09-15 |
| IL305665A (en) | 2023-11-01 |
| JP2024509282A (ja) | 2024-02-29 |
| BR112023017702A2 (pt) | 2023-12-12 |
| AU2022232620A1 (en) | 2023-09-21 |
| CN116997337A (zh) | 2023-11-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2022192478A1 (en) | Bifunctional degraders of galactose-deficient immunoglobulins | |
| JP7754361B2 (ja) | 可溶性タンパク質に対する親和性物質、切断性部分および反応性基を有する化合物またはその塩 | |
| CN113227124B (zh) | 具有针对抗体的亲和性物质、切割性部分及反应性基团的化合物或其盐 | |
| US20240173427A1 (en) | Glypican 3 antibodies and conjugates thereof | |
| KR20210020015A (ko) | 항체에 대한 친화성 물질 및 생체 직교성 관능기를 갖는 화합물 또는 이의 염 | |
| JP2023116497A (ja) | シクロデキストリンタンパク質薬物コンジュゲート | |
| WO2022155347A1 (en) | Camptothecine antibody-drug conjugates and methods of use thereof | |
| JP7846624B2 (ja) | ペプチド含有リンカーとの部位特異的抗体-薬物コンジュゲート | |
| JP2021528431A (ja) | Il−17に結合するためのペプチドリガンド | |
| EP4110405A1 (fr) | Conjugués anticorps-médicament anti-cd56 et leur utilisation en thérapie | |
| JP2018502045A (ja) | タンパク薬物複合体で使用するためのリンカーに関連する材料および方法 | |
| WO2012093733A1 (ja) | 抗シグナルペプチド抗体の製造方法 | |
| AU2023241225A1 (en) | Antibody-conjugates for targeting of tumours expressing trop-2 | |
| US20240383961A1 (en) | Conjugated antibodies for treating diseases | |
| KR101536037B1 (ko) | 아포리포단백질을 포함하는 항체-약물 결합체 | |
| JP2025531032A (ja) | 抗体薬物複合体の医薬組成物 | |
| WO2022097500A1 (ja) | ペプチド架橋剤及び当該架橋剤で架橋された架橋ペプチド | |
| RU2857183C2 (ru) | Производное полиэтиленгликоля, композиция, содержащая такое производное, и способ получения конъюгата биоактивного полипептида с использованием такого производного | |
| JP7714024B2 (ja) | ポリエチレングリコール誘導体、それを含む組成物、及びそれを利用した生理活性ポリペプチド結合体の製造方法 | |
| WO2013125769A1 (ko) | 아포리포단백질을 포함하는 항체-약물 결합체 | |
| US20240400644A1 (en) | Fusion proteins comprising 071 core peptide and use thereof | |
| WO2025137580A1 (en) | Class ii hla with inter-chain disulfide bond | |
| CN121175323A (zh) | 复合物、药物组合物、疫苗及其应用 | |
| KR20250051793A (ko) | 항-her2 항체-면역 작용제 접합체의 약학적 조성물 및 이의 응용 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22767951 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 305665 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2023/010424 Country of ref document: MX Ref document number: 2022232620 Country of ref document: AU Ref document number: AU2022232620 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3211335 Country of ref document: CA Ref document number: P6002261/2023 Country of ref document: AE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280020292.8 Country of ref document: CN Ref document number: 2023555333 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12023552503 Country of ref document: PH |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023017702 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 803755 Country of ref document: NZ |
|
| ENP | Entry into the national phase |
Ref document number: 2022232620 Country of ref document: AU Date of ref document: 20220310 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20237033102 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202317065113 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202392543 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022767951 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022767951 Country of ref document: EP Effective date: 20231010 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202306700R Country of ref document: SG |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023017702 Country of ref document: BR Free format text: APRESENTE TRADUCAO DO RELATORIO DESCRITIVO E DESENHOS, SE HOUVER, CONFORME PEDIDO INTERNACIONAL INICIALMENTE DEPOSITADO, POIS O MESMO NAO FOI APRESENTADO ATE O MOMENTO. A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207. |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01Y Ref document number: 112023017702 Country of ref document: BR Free format text: ANULADA A PUBLICACAO CODIGO 1.5 NA RPI NO 2757 DE 07/11/2023 POR TER SIDO INDEVIDA. |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023017702 Country of ref document: BR Free format text: EFETUAR, EM ATE 60 (SESSENTA) DIAS, O PAGAMENTO DE GRU CODIGO DE SERVICO 260 PARA A REGULARIZACAO DO PEDIDO, CONFORME ART. 2O 1O DA RESOLUCAO/INPI/NO 189/2017 E NOTA DE ESCLARECIMENTO PUBLICADA NA RPI 2421 DE 30/05/2017, UMA VEZ QUE A PETICAO NO 870230096816 DE 01/11/2023 APRESENTA DOCUMENTOS REFERENTES A 2 SERVICOS DIVERSOS (TRADUCAO DOS DOCUMENTOS APRESENTADOS NO DEPOSITO E MODIFICACOES NO QUADRO REIVINDICATORIO E RESUMO) TENDO SIDO PAGA SOMENTE 1 RETRIBUICAO. DEVERA SER PAGA MAIS 1 (UMA) GRU CODIGO DE SERVICO 260 E A GRU CODIGO DE SERVICO 207 REFERENTE A RESPOSTA DESTA EXIGENCIA. |
|
| ENP | Entry into the national phase |
Ref document number: 112023017702 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230831 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523450632 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523450632 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523450632 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523450632 Country of ref document: SA |