WO2022098084A1 - Fc 알파 수용체 결합 항체 - Google Patents
Fc 알파 수용체 결합 항체 Download PDFInfo
- Publication number
- WO2022098084A1 WO2022098084A1 PCT/KR2021/015795 KR2021015795W WO2022098084A1 WO 2022098084 A1 WO2022098084 A1 WO 2022098084A1 KR 2021015795 W KR2021015795 W KR 2021015795W WO 2022098084 A1 WO2022098084 A1 WO 2022098084A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- antibody
- domain
- Prior art date
Links
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 title claims abstract description 131
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 title claims abstract description 131
- 230000027455 binding Effects 0.000 title abstract description 81
- 239000012634 fragment Substances 0.000 claims abstract description 87
- 210000004027 cell Anatomy 0.000 claims abstract description 70
- 238000000034 method Methods 0.000 claims abstract description 49
- 239000000427 antigen Substances 0.000 claims description 100
- 102000036639 antigens Human genes 0.000 claims description 99
- 108091007433 antigens Proteins 0.000 claims description 99
- -1 CD1a Proteins 0.000 claims description 65
- 230000001900 immune effect Effects 0.000 claims description 57
- 150000007523 nucleic acids Chemical class 0.000 claims description 35
- 102000039446 nucleic acids Human genes 0.000 claims description 29
- 108020004707 nucleic acids Proteins 0.000 claims description 29
- 239000013598 vector Substances 0.000 claims description 29
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 27
- 201000010099 disease Diseases 0.000 claims description 25
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 19
- 102000005962 receptors Human genes 0.000 claims description 19
- 108020003175 receptors Proteins 0.000 claims description 19
- 206010028980 Neoplasm Diseases 0.000 claims description 14
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 claims description 12
- 102100034256 Mucin-1 Human genes 0.000 claims description 12
- 201000011510 cancer Diseases 0.000 claims description 12
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 238000006243 chemical reaction Methods 0.000 claims description 10
- 241000894006 Bacteria Species 0.000 claims description 9
- 239000008194 pharmaceutical composition Substances 0.000 claims description 8
- 102100037362 Fibronectin Human genes 0.000 claims description 7
- 108010067306 Fibronectins Proteins 0.000 claims description 7
- 108700020796 Oncogene Proteins 0.000 claims description 7
- 201000001320 Atherosclerosis Diseases 0.000 claims description 6
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 claims description 6
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 claims description 6
- 241000700605 Viruses Species 0.000 claims description 6
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims description 6
- 230000001225 therapeutic effect Effects 0.000 claims description 6
- 208000024827 Alzheimer disease Diseases 0.000 claims description 5
- 208000023275 Autoimmune disease Diseases 0.000 claims description 5
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 claims description 5
- 208000024172 Cardiovascular disease Diseases 0.000 claims description 5
- 102100040751 Casein kinase II subunit alpha Human genes 0.000 claims description 5
- 241000233866 Fungi Species 0.000 claims description 5
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 claims description 5
- 101000892026 Homo sapiens Casein kinase II subunit alpha Proteins 0.000 claims description 5
- 101000892015 Homo sapiens Casein kinase II subunit alpha' Proteins 0.000 claims description 5
- 206010052779 Transplant rejections Diseases 0.000 claims description 5
- 238000012258 culturing Methods 0.000 claims description 5
- 239000000539 dimer Substances 0.000 claims description 5
- 208000016097 disease of metabolism Diseases 0.000 claims description 5
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 claims description 5
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 claims description 5
- 210000002540 macrophage Anatomy 0.000 claims description 5
- 208000030159 metabolic disease Diseases 0.000 claims description 5
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 claims description 5
- 210000000056 organ Anatomy 0.000 claims description 5
- 244000045947 parasite Species 0.000 claims description 5
- 208000024891 symptom Diseases 0.000 claims description 5
- 102100022983 B-cell lymphoma/leukemia 11B Human genes 0.000 claims description 4
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 4
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 claims description 4
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 claims description 4
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 claims description 4
- 101150013553 CD40 gene Proteins 0.000 claims description 4
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 claims description 4
- 102100025473 Carcinoembryonic antigen-related cell adhesion molecule 6 Human genes 0.000 claims description 4
- 108010062540 Chorionic Gonadotropin Proteins 0.000 claims description 4
- 102000011022 Chorionic Gonadotropin Human genes 0.000 claims description 4
- 102000001301 EGF receptor Human genes 0.000 claims description 4
- 108060006698 EGF receptor Proteins 0.000 claims description 4
- 101150029707 ERBB2 gene Proteins 0.000 claims description 4
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 claims description 4
- 102000004862 Gastrin releasing peptide Human genes 0.000 claims description 4
- 108090001053 Gastrin releasing peptide Proteins 0.000 claims description 4
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 claims description 4
- 102100021383 Guanine nucleotide exchange factor DBS Human genes 0.000 claims description 4
- 102000006354 HLA-DR Antigens Human genes 0.000 claims description 4
- 108010058597 HLA-DR Antigens Proteins 0.000 claims description 4
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 4
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 claims description 4
- 101000914326 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 6 Proteins 0.000 claims description 4
- 101000711004 Homo sapiens Cx9C motif-containing protein 4 Proteins 0.000 claims description 4
- 101000920667 Homo sapiens Epithelial cell adhesion molecule Proteins 0.000 claims description 4
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 claims description 4
- 101000615232 Homo sapiens Guanine nucleotide exchange factor DBS Proteins 0.000 claims description 4
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 4
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 4
- 101000972286 Homo sapiens Mucin-4 Proteins 0.000 claims description 4
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 4
- 101000880770 Homo sapiens Protein SSX2 Proteins 0.000 claims description 4
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 claims description 4
- 101000643895 Homo sapiens Ubiquitin carboxyl-terminal hydrolase 6 Proteins 0.000 claims description 4
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 4
- 102000000440 Melanoma-associated antigen Human genes 0.000 claims description 4
- 108050008953 Melanoma-associated antigen Proteins 0.000 claims description 4
- 102100022693 Mucin-4 Human genes 0.000 claims description 4
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 4
- 101710160107 Outer membrane protein A Proteins 0.000 claims description 4
- 102100037686 Protein SSX2 Human genes 0.000 claims description 4
- 102100035582 Ral-GDS-related protein Human genes 0.000 claims description 4
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 4
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 claims description 4
- 102100027212 Tumor-associated calcium signal transducer 2 Human genes 0.000 claims description 4
- 102100021015 Ubiquitin carboxyl-terminal hydrolase 6 Human genes 0.000 claims description 4
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 4
- 102100027548 WW domain-containing transcription regulator protein 1 Human genes 0.000 claims description 4
- 239000004480 active ingredient Substances 0.000 claims description 4
- 230000033115 angiogenesis Effects 0.000 claims description 4
- 238000004113 cell culture Methods 0.000 claims description 4
- PUBCCFNQJQKCNC-XKNFJVFFSA-N gastrin-releasingpeptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)CNC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(C)C)[C@@H](C)O)C(C)C)C1=CNC=N1 PUBCCFNQJQKCNC-XKNFJVFFSA-N 0.000 claims description 4
- 229940084986 human chorionic gonadotropin Drugs 0.000 claims description 4
- 238000012737 microarray-based gene expression Methods 0.000 claims description 4
- 238000012243 multiplex automated genomic engineering Methods 0.000 claims description 4
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims description 4
- 101150047061 tag-72 gene Proteins 0.000 claims description 4
- 108091005625 BRD4 Proteins 0.000 claims description 3
- 102100029895 Bromodomain-containing protein 4 Human genes 0.000 claims description 3
- 102100025441 Brother of CDO Human genes 0.000 claims description 3
- 102100029375 Crk-like protein Human genes 0.000 claims description 3
- 102100021822 Enoyl-CoA hydratase, mitochondrial Human genes 0.000 claims description 3
- 101710180035 Enoyl-CoA hydratase, mitochondrial Proteins 0.000 claims description 3
- 102100039622 Granulocyte colony-stimulating factor receptor Human genes 0.000 claims description 3
- 102100029234 Histone-lysine N-methyltransferase NSD2 Human genes 0.000 claims description 3
- 101100437786 Homo sapiens BOC gene Proteins 0.000 claims description 3
- 101000919315 Homo sapiens Crk-like protein Proteins 0.000 claims description 3
- 101000746364 Homo sapiens Granulocyte colony-stimulating factor receptor Proteins 0.000 claims description 3
- 101000634048 Homo sapiens Histone-lysine N-methyltransferase NSD2 Proteins 0.000 claims description 3
- 102100023915 Insulin Human genes 0.000 claims description 3
- 108090001061 Insulin Proteins 0.000 claims description 3
- 102100035703 Prostatic acid phosphatase Human genes 0.000 claims description 3
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 claims description 3
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 claims description 3
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 claims description 3
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 claims description 3
- 230000012010 growth Effects 0.000 claims description 3
- 230000001939 inductive effect Effects 0.000 claims description 3
- 229940125396 insulin Drugs 0.000 claims description 3
- 230000002265 prevention Effects 0.000 claims description 3
- 108010043671 prostatic acid phosphatase Proteins 0.000 claims description 3
- 102100033260 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 Human genes 0.000 claims description 2
- XMXLVNVGGJBUPF-UHFFFAOYSA-N 2-amino-n,n-diethyl-1,3-benzothiazole-6-carboxamide Chemical compound CCN(CC)C(=O)C1=CC=C2N=C(N)SC2=C1 XMXLVNVGGJBUPF-UHFFFAOYSA-N 0.000 claims description 2
- 102100035315 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial Human genes 0.000 claims description 2
- 102100036734 26S proteasome non-ATPase regulatory subunit 10 Human genes 0.000 claims description 2
- 102100021908 3-mercaptopyruvate sulfurtransferase Human genes 0.000 claims description 2
- 101710082567 3-methylorcinaldehyde synthase Proteins 0.000 claims description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 2
- 102100033400 4F2 cell-surface antigen heavy chain Human genes 0.000 claims description 2
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 claims description 2
- AAHNBILIYONQLX-UHFFFAOYSA-N 6-fluoro-3-[4-[3-methoxy-4-(4-methylimidazol-1-yl)phenyl]triazol-1-yl]-1-(2,2,2-trifluoroethyl)-4,5-dihydro-3h-1-benzazepin-2-one Chemical compound COC1=CC(C=2N=NN(C=2)C2C(N(CC(F)(F)F)C3=CC=CC(F)=C3CC2)=O)=CC=C1N1C=NC(C)=C1 AAHNBILIYONQLX-UHFFFAOYSA-N 0.000 claims description 2
- 102100021546 60S ribosomal protein L10 Human genes 0.000 claims description 2
- 102100021308 60S ribosomal protein L23 Human genes 0.000 claims description 2
- 102100024049 A-kinase anchor protein 13 Human genes 0.000 claims description 2
- 102100040084 A-kinase anchor protein 9 Human genes 0.000 claims description 2
- 102100028324 ADP-ribose glycohydrolase MACROD1 Human genes 0.000 claims description 2
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 claims description 2
- 102100024379 AF4/FMR2 family member 1 Human genes 0.000 claims description 2
- 102100024387 AF4/FMR2 family member 3 Human genes 0.000 claims description 2
- 102100036611 AN1-type zinc finger protein 4 Human genes 0.000 claims description 2
- 102100021407 ATP-dependent RNA helicase DDX18 Human genes 0.000 claims description 2
- 102100033410 Acidic leucine-rich nuclear phosphoprotein 32 family member C Human genes 0.000 claims description 2
- 102100033403 Acidic leucine-rich nuclear phosphoprotein 32 family member D Human genes 0.000 claims description 2
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 claims description 2
- 108700026758 Adenovirus hexon capsid Proteins 0.000 claims description 2
- 102100026443 Adhesion G-protein coupled receptor F1 Human genes 0.000 claims description 2
- 102100036775 Afadin Human genes 0.000 claims description 2
- 102100040026 Agrin Human genes 0.000 claims description 2
- 102100036472 Akirin-2 Human genes 0.000 claims description 2
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 claims description 2
- 102100032959 Alpha-actinin-4 Human genes 0.000 claims description 2
- 102100040743 Alpha-crystallin B chain Human genes 0.000 claims description 2
- 102100022417 Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 Human genes 0.000 claims description 2
- 102000004888 Aquaporin 1 Human genes 0.000 claims description 2
- 108090001004 Aquaporin 1 Proteins 0.000 claims description 2
- 101100177160 Arabidopsis thaliana HAC2 gene Proteins 0.000 claims description 2
- 102100024365 Arf-GAP domain and FG repeat-containing protein 1 Human genes 0.000 claims description 2
- 102100036781 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 Human genes 0.000 claims description 2
- 102000004000 Aurora Kinase A Human genes 0.000 claims description 2
- 108090000461 Aurora Kinase A Proteins 0.000 claims description 2
- 102100032481 B-cell CLL/lymphoma 9 protein Human genes 0.000 claims description 2
- 102100032424 B-cell CLL/lymphoma 9-like protein Human genes 0.000 claims description 2
- 102100027161 BRCA2-interacting transcriptional repressor EMSY Human genes 0.000 claims description 2
- 102100025616 Beta-1,3-N-acetylglucosaminyltransferase manic fringe Human genes 0.000 claims description 2
- 102100037281 Beta-adrenergic receptor kinase 2 Human genes 0.000 claims description 2
- 101001042041 Bos taurus Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial Proteins 0.000 claims description 2
- 102100027305 Box C/D snoRNA protein 1 Human genes 0.000 claims description 2
- 102100027951 Brain and acute leukemia cytoplasmic protein Human genes 0.000 claims description 2
- 102100028265 Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 Human genes 0.000 claims description 2
- 102100026008 Breakpoint cluster region protein Human genes 0.000 claims description 2
- 102100025905 C-Jun-amino-terminal kinase-interacting protein 4 Human genes 0.000 claims description 2
- 102100039398 C-X-C motif chemokine 2 Human genes 0.000 claims description 2
- 102100036189 C-X-C motif chemokine 3 Human genes 0.000 claims description 2
- 108700012439 CA9 Proteins 0.000 claims description 2
- 102100024217 CAMPATH-1 antigen Human genes 0.000 claims description 2
- 102100031173 CCN family member 4 Human genes 0.000 claims description 2
- 108010065524 CD52 Antigen Proteins 0.000 claims description 2
- 102100030933 CDK-activating kinase assembly factor MAT1 Human genes 0.000 claims description 2
- 102100027648 COP9 signalosome complex subunit 3 Human genes 0.000 claims description 2
- 102100021824 COP9 signalosome complex subunit 5 Human genes 0.000 claims description 2
- 102100040775 CREB-regulated transcription coactivator 1 Human genes 0.000 claims description 2
- 102100024152 Cadherin-17 Human genes 0.000 claims description 2
- 101100381481 Caenorhabditis elegans baz-2 gene Proteins 0.000 claims description 2
- 108010052500 Calgranulin A Proteins 0.000 claims description 2
- 101100449736 Candida albicans (strain SC5314 / ATCC MYA-2876) ZCF23 gene Proteins 0.000 claims description 2
- 101710132601 Capsid protein Proteins 0.000 claims description 2
- 102100031667 Cell adhesion molecule-related/down-regulated by oncogenes Human genes 0.000 claims description 2
- 102100027047 Cell division control protein 6 homolog Human genes 0.000 claims description 2
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 claims description 2
- 102100033211 Centromere protein W Human genes 0.000 claims description 2
- 102100026680 Chromobox protein homolog 7 Human genes 0.000 claims description 2
- 102100026681 Chromobox protein homolog 8 Human genes 0.000 claims description 2
- 102100031239 Chromodomain-helicase-DNA-binding protein 1-like Human genes 0.000 claims description 2
- 102100038248 Cis-aconitate decarboxylase Human genes 0.000 claims description 2
- 102100021981 Coiled-coil domain-containing protein 28A Human genes 0.000 claims description 2
- 102100031048 Coiled-coil domain-containing protein 6 Human genes 0.000 claims description 2
- 102100032768 Complement receptor type 2 Human genes 0.000 claims description 2
- 102100024342 Contactin-2 Human genes 0.000 claims description 2
- 108010060313 Core Binding Factor beta Subunit Proteins 0.000 claims description 2
- 102000008147 Core Binding Factor beta Subunit Human genes 0.000 claims description 2
- 102100025522 Cullin-7 Human genes 0.000 claims description 2
- 102100034275 Cx9C motif-containing protein 4 Human genes 0.000 claims description 2
- 108010058546 Cyclin D1 Proteins 0.000 claims description 2
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 claims description 2
- 108010025468 Cyclin-Dependent Kinase 6 Proteins 0.000 claims description 2
- 102100032857 Cyclin-dependent kinase 1 Human genes 0.000 claims description 2
- 101710106279 Cyclin-dependent kinase 1 Proteins 0.000 claims description 2
- 102100038113 Cyclin-dependent kinase 14 Human genes 0.000 claims description 2
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 claims description 2
- 102100026855 Cyclin-dependent kinase 5 activator 2 Human genes 0.000 claims description 2
- 102100026804 Cyclin-dependent kinase 6 Human genes 0.000 claims description 2
- 102100034501 Cyclin-dependent kinases regulatory subunit 1 Human genes 0.000 claims description 2
- SXVPOSFURRDKBO-UHFFFAOYSA-N Cyclododecanone Chemical compound O=C1CCCCCCCCCCC1 SXVPOSFURRDKBO-UHFFFAOYSA-N 0.000 claims description 2
- 102100030270 Cysteine-rich hydrophobic domain-containing protein 1 Human genes 0.000 claims description 2
- 102100034126 Cytoglobin Human genes 0.000 claims description 2
- 102100038497 Cytokine receptor-like factor 2 Human genes 0.000 claims description 2
- 102100030960 DNA replication licensing factor MCM2 Human genes 0.000 claims description 2
- 102100026992 Dermcidin Human genes 0.000 claims description 2
- 102100034577 Desmoglein-3 Human genes 0.000 claims description 2
- 102100036949 Developmental pluripotency-associated protein 2 Human genes 0.000 claims description 2
- 102100037126 Developmental pluripotency-associated protein 4 Human genes 0.000 claims description 2
- 102100022820 Disintegrin and metalloproteinase domain-containing protein 28 Human genes 0.000 claims description 2
- 102100024361 Disintegrin and metalloproteinase domain-containing protein 9 Human genes 0.000 claims description 2
- 102100037573 Dual specificity protein phosphatase 12 Human genes 0.000 claims description 2
- 102100034127 Dual specificity protein phosphatase 26 Human genes 0.000 claims description 2
- 102100035273 E3 ubiquitin-protein ligase CBL-B Human genes 0.000 claims description 2
- 102100030370 E3 ubiquitin-protein ligase Hakai Human genes 0.000 claims description 2
- 102100031918 E3 ubiquitin-protein ligase NEDD4 Human genes 0.000 claims description 2
- 102100031438 E3 ubiquitin-protein ligase RING1 Human genes 0.000 claims description 2
- 102100026245 E3 ubiquitin-protein ligase RNF43 Human genes 0.000 claims description 2
- 102100038631 E3 ubiquitin-protein ligase SMURF1 Human genes 0.000 claims description 2
- 102100029671 E3 ubiquitin-protein ligase TRIM8 Human genes 0.000 claims description 2
- 102100024739 E3 ubiquitin-protein ligase UHRF1 Human genes 0.000 claims description 2
- 102100037024 E3 ubiquitin-protein ligase XIAP Human genes 0.000 claims description 2
- 108700015856 ELAV-Like Protein 1 Proteins 0.000 claims description 2
- 102100034235 ELAV-like protein 1 Human genes 0.000 claims description 2
- 102000012804 EPCAM Human genes 0.000 claims description 2
- 101150084967 EPCAM gene Proteins 0.000 claims description 2
- 108091016436 EPS8 Proteins 0.000 claims description 2
- 102000020045 EPS8 Human genes 0.000 claims description 2
- 102100027100 Echinoderm microtubule-associated protein-like 4 Human genes 0.000 claims description 2
- 102100027261 Ecotropic viral integration site 5 protein homolog Human genes 0.000 claims description 2
- 101150011861 Elavl1 gene Proteins 0.000 claims description 2
- 102100027723 Endogenous retrovirus group K member 6 Rec protein Human genes 0.000 claims description 2
- 102100031862 Endoplasmic reticulum-Golgi intermediate compartment protein 1 Human genes 0.000 claims description 2
- 102100021579 Enhancer of filamentation 1 Human genes 0.000 claims description 2
- 101710091045 Envelope protein Proteins 0.000 claims description 2
- 101000809594 Escherichia coli (strain K12) Shikimate kinase 1 Proteins 0.000 claims description 2
- 102000005233 Eukaryotic Initiation Factor-4E Human genes 0.000 claims description 2
- 108060002636 Eukaryotic Initiation Factor-4E Proteins 0.000 claims description 2
- 102100021002 Eukaryotic translation initiation factor 5A-2 Human genes 0.000 claims description 2
- 102100024359 Exosome complex exonuclease RRP44 Human genes 0.000 claims description 2
- 102100036118 Far upstream element-binding protein 1 Human genes 0.000 claims description 2
- 102100035111 Farnesyl pyrophosphate synthase Human genes 0.000 claims description 2
- 102100028412 Fibroblast growth factor 10 Human genes 0.000 claims description 2
- 102100028043 Fibroblast growth factor 3 Human genes 0.000 claims description 2
- 102100028073 Fibroblast growth factor 5 Human genes 0.000 claims description 2
- 102100037680 Fibroblast growth factor 8 Human genes 0.000 claims description 2
- 102100026545 Fibronectin type III domain-containing protein 3B Human genes 0.000 claims description 2
- 102100038644 Four and a half LIM domains protein 2 Human genes 0.000 claims description 2
- 102100021265 Frizzled-2 Human genes 0.000 claims description 2
- 102100024165 G1/S-specific cyclin-D1 Human genes 0.000 claims description 2
- 102100037858 G1/S-specific cyclin-E1 Human genes 0.000 claims description 2
- 102100032340 G2/mitotic-specific cyclin-B1 Human genes 0.000 claims description 2
- 102100033201 G2/mitotic-specific cyclin-B2 Human genes 0.000 claims description 2
- 102100037759 GRB2-associated-binding protein 2 Human genes 0.000 claims description 2
- 101150016162 GSM1 gene Proteins 0.000 claims description 2
- 102100022871 GTPase ERas Human genes 0.000 claims description 2
- 102100029974 GTPase HRas Human genes 0.000 claims description 2
- 102100030708 GTPase KRas Human genes 0.000 claims description 2
- 102100022898 Galactoside-binding soluble lectin 13 Human genes 0.000 claims description 2
- 102100036584 Galanin receptor type 2 Human genes 0.000 claims description 2
- 102100025615 Gamma-synuclein Human genes 0.000 claims description 2
- 101710199766 Glycerol-3-phosphate acyltransferase 4 Proteins 0.000 claims description 2
- 102100025376 Glycerol-3-phosphate acyltransferase 4 Human genes 0.000 claims description 2
- 102100022975 Glycogen synthase kinase-3 alpha Human genes 0.000 claims description 2
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 claims description 2
- 102100036675 Golgi-associated PDZ and coiled-coil motif-containing protein Human genes 0.000 claims description 2
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 claims description 2
- 102100038367 Gremlin-1 Human genes 0.000 claims description 2
- 102100034221 Growth-regulated alpha protein Human genes 0.000 claims description 2
- 102100032134 Guanine nucleotide exchange factor VAV2 Human genes 0.000 claims description 2
- 102100032191 Guanine nucleotide exchange factor VAV3 Human genes 0.000 claims description 2
- 102100025334 Guanine nucleotide-binding protein G(q) subunit alpha Human genes 0.000 claims description 2
- 102100032610 Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas Human genes 0.000 claims description 2
- 102100036733 Guanine nucleotide-binding protein subunit alpha-12 Human genes 0.000 claims description 2
- 102100034445 HCLS1-associated protein X-1 Human genes 0.000 claims description 2
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 claims description 2
- 108091092889 HOTTIP Proteins 0.000 claims description 2
- 108091007417 HOX transcript antisense RNA Proteins 0.000 claims description 2
- 102100028765 Heat shock 70 kDa protein 4 Human genes 0.000 claims description 2
- 102100031001 Hepatoma-derived growth factor-related protein 2 Human genes 0.000 claims description 2
- 102100035621 Heterogeneous nuclear ribonucleoprotein A1 Human genes 0.000 claims description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims description 2
- 102100028176 High mobility group nucleosome-binding domain-containing protein 5 Human genes 0.000 claims description 2
- 102100022103 Histone-lysine N-methyltransferase 2A Human genes 0.000 claims description 2
- 102100038970 Histone-lysine N-methyltransferase EZH2 Human genes 0.000 claims description 2
- 102100023696 Histone-lysine N-methyltransferase SETDB1 Human genes 0.000 claims description 2
- 102100029239 Histone-lysine N-methyltransferase, H3 lysine-36 specific Human genes 0.000 claims description 2
- 102100023907 Homeobox protein NANOGP8 Human genes 0.000 claims description 2
- 101000927689 Homo sapiens 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 Proteins 0.000 claims description 2
- 101000597680 Homo sapiens 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial Proteins 0.000 claims description 2
- 101001136581 Homo sapiens 26S proteasome non-ATPase regulatory subunit 10 Proteins 0.000 claims description 2
- 101000753843 Homo sapiens 3-mercaptopyruvate sulfurtransferase Proteins 0.000 claims description 2
- 101000773083 Homo sapiens 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 claims description 2
- 101001108634 Homo sapiens 60S ribosomal protein L10 Proteins 0.000 claims description 2
- 101000675833 Homo sapiens 60S ribosomal protein L23 Proteins 0.000 claims description 2
- 101000833679 Homo sapiens A-kinase anchor protein 13 Proteins 0.000 claims description 2
- 101000890598 Homo sapiens A-kinase anchor protein 9 Proteins 0.000 claims description 2
- 101000578912 Homo sapiens ADP-ribose glycohydrolase MACROD1 Proteins 0.000 claims description 2
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 claims description 2
- 101000833180 Homo sapiens AF4/FMR2 family member 1 Proteins 0.000 claims description 2
- 101000833166 Homo sapiens AF4/FMR2 family member 3 Proteins 0.000 claims description 2
- 101000782079 Homo sapiens AN1-type zinc finger protein 4 Proteins 0.000 claims description 2
- 101000722210 Homo sapiens ATP-dependent DNA helicase DDX11 Proteins 0.000 claims description 2
- 101000732662 Homo sapiens Acidic leucine-rich nuclear phosphoprotein 32 family member C Proteins 0.000 claims description 2
- 101000732664 Homo sapiens Acidic leucine-rich nuclear phosphoprotein 32 family member D Proteins 0.000 claims description 2
- 101000824278 Homo sapiens Acyl-[acyl-carrier-protein] hydrolase Proteins 0.000 claims description 2
- 101000718228 Homo sapiens Adhesion G-protein coupled receptor F1 Proteins 0.000 claims description 2
- 101000928246 Homo sapiens Afadin Proteins 0.000 claims description 2
- 101000959594 Homo sapiens Agrin Proteins 0.000 claims description 2
- 101000928488 Homo sapiens Akirin-2 Proteins 0.000 claims description 2
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 claims description 2
- 101000797282 Homo sapiens Alpha-actinin-4 Proteins 0.000 claims description 2
- 101000891982 Homo sapiens Alpha-crystallin B chain Proteins 0.000 claims description 2
- 101000755758 Homo sapiens Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 Proteins 0.000 claims description 2
- 101000833314 Homo sapiens Arf-GAP domain and FG repeat-containing protein 1 Proteins 0.000 claims description 2
- 101000928215 Homo sapiens Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 Proteins 0.000 claims description 2
- 101000798495 Homo sapiens B-cell CLL/lymphoma 9 protein Proteins 0.000 claims description 2
- 101000798491 Homo sapiens B-cell CLL/lymphoma 9-like protein Proteins 0.000 claims description 2
- 101001057996 Homo sapiens BRCA2-interacting transcriptional repressor EMSY Proteins 0.000 claims description 2
- 101000575420 Homo sapiens Beta-1,3-N-acetylglucosaminyltransferase manic fringe Proteins 0.000 claims description 2
- 101000806653 Homo sapiens Beta-adrenergic receptor kinase 2 Proteins 0.000 claims description 2
- 101000937756 Homo sapiens Box C/D snoRNA protein 1 Proteins 0.000 claims description 2
- 101000697853 Homo sapiens Brain and acute leukemia cytoplasmic protein Proteins 0.000 claims description 2
- 101000935886 Homo sapiens Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 Proteins 0.000 claims description 2
- 101000933320 Homo sapiens Breakpoint cluster region protein Proteins 0.000 claims description 2
- 101001076862 Homo sapiens C-Jun-amino-terminal kinase-interacting protein 4 Proteins 0.000 claims description 2
- 101000889128 Homo sapiens C-X-C motif chemokine 2 Proteins 0.000 claims description 2
- 101000947193 Homo sapiens C-X-C motif chemokine 3 Proteins 0.000 claims description 2
- 101100165850 Homo sapiens CA9 gene Proteins 0.000 claims description 2
- 101000777555 Homo sapiens CCN family member 3 Proteins 0.000 claims description 2
- 101000777560 Homo sapiens CCN family member 4 Proteins 0.000 claims description 2
- 101000583935 Homo sapiens CDK-activating kinase assembly factor MAT1 Proteins 0.000 claims description 2
- 101000726002 Homo sapiens COP9 signalosome complex subunit 3 Proteins 0.000 claims description 2
- 101000896048 Homo sapiens COP9 signalosome complex subunit 5 Proteins 0.000 claims description 2
- 101000891939 Homo sapiens CREB-regulated transcription coactivator 1 Proteins 0.000 claims description 2
- 101000762247 Homo sapiens Cadherin-17 Proteins 0.000 claims description 2
- 101000777781 Homo sapiens Cell adhesion molecule-related/down-regulated by oncogenes Proteins 0.000 claims description 2
- 101000914465 Homo sapiens Cell division control protein 6 homolog Proteins 0.000 claims description 2
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 claims description 2
- 101000944447 Homo sapiens Centromere protein W Proteins 0.000 claims description 2
- 101000910835 Homo sapiens Chromobox protein homolog 7 Proteins 0.000 claims description 2
- 101000910841 Homo sapiens Chromobox protein homolog 8 Proteins 0.000 claims description 2
- 101000777053 Homo sapiens Chromodomain-helicase-DNA-binding protein 1-like Proteins 0.000 claims description 2
- 101001032339 Homo sapiens Cis-aconitate decarboxylase Proteins 0.000 claims description 2
- 101000896971 Homo sapiens Coiled-coil domain-containing protein 28A Proteins 0.000 claims description 2
- 101000777370 Homo sapiens Coiled-coil domain-containing protein 6 Proteins 0.000 claims description 2
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 claims description 2
- 101000909516 Homo sapiens Contactin-2 Proteins 0.000 claims description 2
- 101000856425 Homo sapiens Cullin-7 Proteins 0.000 claims description 2
- 101000716088 Homo sapiens Cyclin-L1 Proteins 0.000 claims description 2
- 101000884374 Homo sapiens Cyclin-dependent kinase 14 Proteins 0.000 claims description 2
- 101000912115 Homo sapiens Cyclin-dependent kinase 5 activator 2 Proteins 0.000 claims description 2
- 101000710200 Homo sapiens Cyclin-dependent kinases regulatory subunit 1 Proteins 0.000 claims description 2
- 101000991108 Homo sapiens Cysteine-rich hydrophobic domain-containing protein 1 Proteins 0.000 claims description 2
- 101000870148 Homo sapiens Cytoglobin Proteins 0.000 claims description 2
- 101000956427 Homo sapiens Cytokine receptor-like factor 2 Proteins 0.000 claims description 2
- 101000583807 Homo sapiens DNA replication licensing factor MCM2 Proteins 0.000 claims description 2
- 101000844721 Homo sapiens Deleted in malignant brain tumors 1 protein Proteins 0.000 claims description 2
- 101000911659 Homo sapiens Dermcidin Proteins 0.000 claims description 2
- 101000924311 Homo sapiens Desmoglein-3 Proteins 0.000 claims description 2
- 101000804948 Homo sapiens Developmental pluripotency-associated protein 2 Proteins 0.000 claims description 2
- 101000881868 Homo sapiens Developmental pluripotency-associated protein 4 Proteins 0.000 claims description 2
- 101000756756 Homo sapiens Disintegrin and metalloproteinase domain-containing protein 28 Proteins 0.000 claims description 2
- 101000832769 Homo sapiens Disintegrin and metalloproteinase domain-containing protein 9 Proteins 0.000 claims description 2
- 101001017423 Homo sapiens Dual specificity phosphatase 28 Proteins 0.000 claims description 2
- 101000881110 Homo sapiens Dual specificity protein phosphatase 12 Proteins 0.000 claims description 2
- 101001017415 Homo sapiens Dual specificity protein phosphatase 26 Proteins 0.000 claims description 2
- 101000737265 Homo sapiens E3 ubiquitin-protein ligase CBL-B Proteins 0.000 claims description 2
- 101001083405 Homo sapiens E3 ubiquitin-protein ligase Hakai Proteins 0.000 claims description 2
- 101000636713 Homo sapiens E3 ubiquitin-protein ligase NEDD4 Proteins 0.000 claims description 2
- 101000707962 Homo sapiens E3 ubiquitin-protein ligase RING1 Proteins 0.000 claims description 2
- 101000692702 Homo sapiens E3 ubiquitin-protein ligase RNF43 Proteins 0.000 claims description 2
- 101000664993 Homo sapiens E3 ubiquitin-protein ligase SMURF1 Proteins 0.000 claims description 2
- 101000795300 Homo sapiens E3 ubiquitin-protein ligase TRIM8 Proteins 0.000 claims description 2
- 101000760417 Homo sapiens E3 ubiquitin-protein ligase UHRF1 Proteins 0.000 claims description 2
- 101001057929 Homo sapiens Echinoderm microtubule-associated protein-like 4 Proteins 0.000 claims description 2
- 101001057141 Homo sapiens Ecotropic viral integration site 5 protein homolog Proteins 0.000 claims description 2
- 101000920804 Homo sapiens Endoplasmic reticulum-Golgi intermediate compartment protein 1 Proteins 0.000 claims description 2
- 101000898310 Homo sapiens Enhancer of filamentation 1 Proteins 0.000 claims description 2
- 101001002419 Homo sapiens Eukaryotic translation initiation factor 5A-2 Proteins 0.000 claims description 2
- 101000627103 Homo sapiens Exosome complex exonuclease RRP44 Proteins 0.000 claims description 2
- 101000930770 Homo sapiens Far upstream element-binding protein 1 Proteins 0.000 claims description 2
- 101001023007 Homo sapiens Farnesyl pyrophosphate synthase Proteins 0.000 claims description 2
- 101000917237 Homo sapiens Fibroblast growth factor 10 Proteins 0.000 claims description 2
- 101001060280 Homo sapiens Fibroblast growth factor 3 Proteins 0.000 claims description 2
- 101001060267 Homo sapiens Fibroblast growth factor 5 Proteins 0.000 claims description 2
- 101001027382 Homo sapiens Fibroblast growth factor 8 Proteins 0.000 claims description 2
- 101000913642 Homo sapiens Fibronectin type III domain-containing protein 3B Proteins 0.000 claims description 2
- 101001031714 Homo sapiens Four and a half LIM domains protein 2 Proteins 0.000 claims description 2
- 101000819477 Homo sapiens Frizzled-2 Proteins 0.000 claims description 2
- 101000738568 Homo sapiens G1/S-specific cyclin-E1 Proteins 0.000 claims description 2
- 101000868643 Homo sapiens G2/mitotic-specific cyclin-B1 Proteins 0.000 claims description 2
- 101000713023 Homo sapiens G2/mitotic-specific cyclin-B2 Proteins 0.000 claims description 2
- 101001024902 Homo sapiens GRB2-associated-binding protein 2 Proteins 0.000 claims description 2
- 101000574654 Homo sapiens GTP-binding protein Rit1 Proteins 0.000 claims description 2
- 101000620820 Homo sapiens GTPase ERas Proteins 0.000 claims description 2
- 101000584633 Homo sapiens GTPase HRas Proteins 0.000 claims description 2
- 101000584612 Homo sapiens GTPase KRas Proteins 0.000 claims description 2
- 101000620927 Homo sapiens Galactoside-binding soluble lectin 13 Proteins 0.000 claims description 2
- 101001072780 Homo sapiens Galanin receptor type 2 Proteins 0.000 claims description 2
- 101000787273 Homo sapiens Gamma-synuclein Proteins 0.000 claims description 2
- 101000903717 Homo sapiens Glycogen synthase kinase-3 alpha Proteins 0.000 claims description 2
- 101001040734 Homo sapiens Golgi phosphoprotein 3 Proteins 0.000 claims description 2
- 101001072499 Homo sapiens Golgi-associated PDZ and coiled-coil motif-containing protein Proteins 0.000 claims description 2
- 101000746367 Homo sapiens Granulocyte colony-stimulating factor Proteins 0.000 claims description 2
- 101001032872 Homo sapiens Gremlin-1 Proteins 0.000 claims description 2
- 101001069921 Homo sapiens Growth-regulated alpha protein Proteins 0.000 claims description 2
- 101000775776 Homo sapiens Guanine nucleotide exchange factor VAV2 Proteins 0.000 claims description 2
- 101000775742 Homo sapiens Guanine nucleotide exchange factor VAV3 Proteins 0.000 claims description 2
- 101000857888 Homo sapiens Guanine nucleotide-binding protein G(q) subunit alpha Proteins 0.000 claims description 2
- 101001014590 Homo sapiens Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas Proteins 0.000 claims description 2
- 101001014594 Homo sapiens Guanine nucleotide-binding protein G(s) subunit alpha isoforms short Proteins 0.000 claims description 2
- 101001072398 Homo sapiens Guanine nucleotide-binding protein subunit alpha-12 Proteins 0.000 claims description 2
- 101001068173 Homo sapiens HCLS1-associated protein X-1 Proteins 0.000 claims description 2
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 claims description 2
- 101001078692 Homo sapiens Heat shock 70 kDa protein 4 Proteins 0.000 claims description 2
- 101000854014 Homo sapiens Heterogeneous nuclear ribonucleoprotein A1 Proteins 0.000 claims description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims description 2
- 101001006376 Homo sapiens High mobility group nucleosome-binding domain-containing protein 5 Proteins 0.000 claims description 2
- 101001045846 Homo sapiens Histone-lysine N-methyltransferase 2A Proteins 0.000 claims description 2
- 101000882127 Homo sapiens Histone-lysine N-methyltransferase EZH2 Proteins 0.000 claims description 2
- 101000684609 Homo sapiens Histone-lysine N-methyltransferase SETDB1 Proteins 0.000 claims description 2
- 101000634050 Homo sapiens Histone-lysine N-methyltransferase, H3 lysine-36 specific Proteins 0.000 claims description 2
- 101001111983 Homo sapiens Homeobox protein NANOGP8 Proteins 0.000 claims description 2
- 101100508538 Homo sapiens IKBKE gene Proteins 0.000 claims description 2
- 101001050487 Homo sapiens IST1 homolog Proteins 0.000 claims description 2
- 101001077600 Homo sapiens Insulin receptor substrate 2 Proteins 0.000 claims description 2
- 101000599778 Homo sapiens Insulin-like growth factor 2 mRNA-binding protein 1 Proteins 0.000 claims description 2
- 101001053790 Homo sapiens Integrator complex subunit 1 Proteins 0.000 claims description 2
- 101000998808 Homo sapiens Integrator complex subunit 2 Proteins 0.000 claims description 2
- 101000998800 Homo sapiens Integrator complex subunit 3 Proteins 0.000 claims description 2
- 101001033770 Homo sapiens Integrator complex subunit 4 Proteins 0.000 claims description 2
- 101001033791 Homo sapiens Integrator complex subunit 5 Proteins 0.000 claims description 2
- 101001011755 Homo sapiens Integrator complex subunit 7 Proteins 0.000 claims description 2
- 101001011746 Homo sapiens Integrator complex subunit 8 Proteins 0.000 claims description 2
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 claims description 2
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 claims description 2
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 claims description 2
- 101001043809 Homo sapiens Interleukin-7 receptor subunit alpha Proteins 0.000 claims description 2
- 101000960234 Homo sapiens Isocitrate dehydrogenase [NADP] cytoplasmic Proteins 0.000 claims description 2
- 101000833492 Homo sapiens Jouberin Proteins 0.000 claims description 2
- 101000691574 Homo sapiens Junction plakoglobin Proteins 0.000 claims description 2
- 101001008949 Homo sapiens Kinesin-like protein KIF14 Proteins 0.000 claims description 2
- 101001051207 Homo sapiens L-lactate dehydrogenase B chain Proteins 0.000 claims description 2
- 101000956778 Homo sapiens LETM1 domain-containing protein 1 Proteins 0.000 claims description 2
- 101001003569 Homo sapiens LIM domain only protein 3 Proteins 0.000 claims description 2
- 101001135094 Homo sapiens LIM domain transcription factor LMO4 Proteins 0.000 claims description 2
- 101001004946 Homo sapiens Lactoylglutathione lyase Proteins 0.000 claims description 2
- 101001064870 Homo sapiens Lon protease homolog, mitochondrial Proteins 0.000 claims description 2
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 claims description 2
- 101000762967 Homo sapiens Lymphokine-activated killer T-cell-originated protein kinase Proteins 0.000 claims description 2
- 101000804764 Homo sapiens Lymphotactin Proteins 0.000 claims description 2
- 101001088893 Homo sapiens Lysine-specific demethylase 4C Proteins 0.000 claims description 2
- 101000624643 Homo sapiens M-phase inducer phosphatase 3 Proteins 0.000 claims description 2
- 101000916644 Homo sapiens Macrophage colony-stimulating factor 1 receptor Proteins 0.000 claims description 2
- 101000577881 Homo sapiens Macrophage metalloelastase Proteins 0.000 claims description 2
- 101000760817 Homo sapiens Macrophage-capping protein Proteins 0.000 claims description 2
- 101001039753 Homo sapiens Malignant T-cell-amplified sequence 1 Proteins 0.000 claims description 2
- 101001005667 Homo sapiens Mastermind-like protein 2 Proteins 0.000 claims description 2
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 claims description 2
- 101001005716 Homo sapiens Melanoma-associated antigen 11 Proteins 0.000 claims description 2
- 101001071437 Homo sapiens Metabotropic glutamate receptor 1 Proteins 0.000 claims description 2
- 101001055106 Homo sapiens Metastasis-associated in colon cancer protein 1 Proteins 0.000 claims description 2
- 101000962664 Homo sapiens Microtubule-associated protein RP/EB family member 1 Proteins 0.000 claims description 2
- 101001013022 Homo sapiens Migration and invasion enhancer 1 Proteins 0.000 claims description 2
- 101001055091 Homo sapiens Mitogen-activated protein kinase kinase kinase 8 Proteins 0.000 claims description 2
- 101001133081 Homo sapiens Mucin-2 Proteins 0.000 claims description 2
- 101000972284 Homo sapiens Mucin-3A Proteins 0.000 claims description 2
- 101000591295 Homo sapiens Myocardin-related transcription factor B Proteins 0.000 claims description 2
- 101000958771 Homo sapiens N-acylethanolamine-hydrolyzing acid amidase Proteins 0.000 claims description 2
- 101000616738 Homo sapiens NAD-dependent protein deacetylase sirtuin-6 Proteins 0.000 claims description 2
- 101000970025 Homo sapiens NUAK family SNF1-like kinase 2 Proteins 0.000 claims description 2
- 101001122114 Homo sapiens NUT family member 1 Proteins 0.000 claims description 2
- 101001023705 Homo sapiens Nectin-4 Proteins 0.000 claims description 2
- 101001112222 Homo sapiens Neural cell adhesion molecule L1-like protein Proteins 0.000 claims description 2
- 101001024600 Homo sapiens Neuroblastoma breakpoint family member 12 Proteins 0.000 claims description 2
- 101001014610 Homo sapiens Neuroendocrine secretory protein 55 Proteins 0.000 claims description 2
- 101000927793 Homo sapiens Neuroepithelial cell-transforming gene 1 protein Proteins 0.000 claims description 2
- 101001009683 Homo sapiens Neuronal membrane glycoprotein M6-a Proteins 0.000 claims description 2
- 101001069237 Homo sapiens Neuronal membrane glycoprotein M6-b Proteins 0.000 claims description 2
- 101001023833 Homo sapiens Neutrophil gelatinase-associated lipocalin Proteins 0.000 claims description 2
- 101000979498 Homo sapiens Ninein-like protein Proteins 0.000 claims description 2
- 101000996563 Homo sapiens Nuclear pore complex protein Nup214 Proteins 0.000 claims description 2
- 101000974343 Homo sapiens Nuclear receptor coactivator 4 Proteins 0.000 claims description 2
- 101000801664 Homo sapiens Nucleoprotein TPR Proteins 0.000 claims description 2
- 101000979629 Homo sapiens Nucleoside diphosphate kinase A Proteins 0.000 claims description 2
- 101000851976 Homo sapiens Nucleoside diphosphate phosphatase ENTPD5 Proteins 0.000 claims description 2
- 101000736088 Homo sapiens PC4 and SFRS1-interacting protein Proteins 0.000 claims description 2
- 101000585555 Homo sapiens PCNA-associated factor Proteins 0.000 claims description 2
- 101000693231 Homo sapiens PDZK1-interacting protein 1 Proteins 0.000 claims description 2
- 101001123302 Homo sapiens PR domain zinc finger protein 12 Proteins 0.000 claims description 2
- 101000599612 Homo sapiens Peroxisomal carnitine O-octanoyltransferase Proteins 0.000 claims description 2
- 101000688606 Homo sapiens Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 Proteins 0.000 claims description 2
- 101001120056 Homo sapiens Phosphatidylinositol 3-kinase regulatory subunit alpha Proteins 0.000 claims description 2
- 101000605639 Homo sapiens Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Proteins 0.000 claims description 2
- 101000604565 Homo sapiens Phosphatidylinositol glycan anchor biosynthesis class U protein Proteins 0.000 claims description 2
- 101000870428 Homo sapiens Phospholipase DDHD2 Proteins 0.000 claims description 2
- 101000691783 Homo sapiens Pirin Proteins 0.000 claims description 2
- 101000738776 Homo sapiens Pituitary tumor-transforming gene 1 protein-interacting protein Proteins 0.000 claims description 2
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 claims description 2
- 101000691480 Homo sapiens Placenta-specific gene 8 protein Proteins 0.000 claims description 2
- 101001067189 Homo sapiens Plexin-A1 Proteins 0.000 claims description 2
- 101000584499 Homo sapiens Polycomb protein SUZ12 Proteins 0.000 claims description 2
- 101000829578 Homo sapiens Polypeptide N-acetylgalactosaminyltransferase 10 Proteins 0.000 claims description 2
- 101000846284 Homo sapiens Pre-mRNA 3'-end-processing factor FIP1 Proteins 0.000 claims description 2
- 101001124937 Homo sapiens Pre-mRNA-splicing factor 38B Proteins 0.000 claims description 2
- 101000919019 Homo sapiens Probable ATP-dependent RNA helicase DDX6 Proteins 0.000 claims description 2
- 101000996785 Homo sapiens Probable G-protein coupled receptor 132 Proteins 0.000 claims description 2
- 101000734702 Homo sapiens Proline-, glutamic acid- and leucine-rich protein 1 Proteins 0.000 claims description 2
- 101000981455 Homo sapiens Prostate androgen-regulated mucin-like protein 1 Proteins 0.000 claims description 2
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 claims description 2
- 101000831616 Homo sapiens Protachykinin-1 Proteins 0.000 claims description 2
- 101000959489 Homo sapiens Protein AF-9 Proteins 0.000 claims description 2
- 101000892338 Homo sapiens Protein AF1q Proteins 0.000 claims description 2
- 101000797903 Homo sapiens Protein ALEX Proteins 0.000 claims description 2
- 101000971151 Homo sapiens Protein BANP Proteins 0.000 claims description 2
- 101000766826 Homo sapiens Protein CIP2A Proteins 0.000 claims description 2
- 101000912957 Homo sapiens Protein DEK Proteins 0.000 claims description 2
- 101000925651 Homo sapiens Protein ENL Proteins 0.000 claims description 2
- 101001057166 Homo sapiens Protein EVI2A Proteins 0.000 claims description 2
- 101001048947 Homo sapiens Protein FAM189B Proteins 0.000 claims description 2
- 101000848922 Homo sapiens Protein FAM72A Proteins 0.000 claims description 2
- 101001065541 Homo sapiens Protein LYRIC Proteins 0.000 claims description 2
- 101000977257 Homo sapiens Protein MMS22-like Proteins 0.000 claims description 2
- 101000880769 Homo sapiens Protein SSX1 Proteins 0.000 claims description 2
- 101000814371 Homo sapiens Protein Wnt-10a Proteins 0.000 claims description 2
- 101000770799 Homo sapiens Protein Wnt-10b Proteins 0.000 claims description 2
- 101000804792 Homo sapiens Protein Wnt-5a Proteins 0.000 claims description 2
- 101000984042 Homo sapiens Protein lin-28 homolog A Proteins 0.000 claims description 2
- 101000984033 Homo sapiens Protein lin-28 homolog B Proteins 0.000 claims description 2
- 101001014035 Homo sapiens Protein p13 MTCP-1 Proteins 0.000 claims description 2
- 101000830696 Homo sapiens Protein tyrosine phosphatase type IVA 1 Proteins 0.000 claims description 2
- 101000830691 Homo sapiens Protein tyrosine phosphatase type IVA 2 Proteins 0.000 claims description 2
- 101000830689 Homo sapiens Protein tyrosine phosphatase type IVA 3 Proteins 0.000 claims description 2
- 101000666172 Homo sapiens Protein-glutamine gamma-glutamyltransferase E Proteins 0.000 claims description 2
- 101000738322 Homo sapiens Prothymosin alpha Proteins 0.000 claims description 2
- 101000615238 Homo sapiens Proto-oncogene DBL Proteins 0.000 claims description 2
- 101001029173 Homo sapiens Proto-oncogene FRAT1 Proteins 0.000 claims description 2
- 101000781955 Homo sapiens Proto-oncogene Wnt-1 Proteins 0.000 claims description 2
- 101000954762 Homo sapiens Proto-oncogene Wnt-3 Proteins 0.000 claims description 2
- 101000775749 Homo sapiens Proto-oncogene vav Proteins 0.000 claims description 2
- 101000576060 Homo sapiens RAD50-interacting protein 1 Proteins 0.000 claims description 2
- 101001111714 Homo sapiens RING-box protein 2 Proteins 0.000 claims description 2
- 101001048695 Homo sapiens RNA polymerase II elongation factor ELL Proteins 0.000 claims description 2
- 101000742844 Homo sapiens RNA-binding motif protein, Y chromosome, family 1 member A1 Proteins 0.000 claims description 2
- 101000591115 Homo sapiens RNA-binding protein Musashi homolog 1 Proteins 0.000 claims description 2
- 101001092166 Homo sapiens RPE-retinal G protein-coupled receptor Proteins 0.000 claims description 2
- 101100078258 Homo sapiens RUNX1T1 gene Proteins 0.000 claims description 2
- 101001092182 Homo sapiens Ral-GDS-related protein Proteins 0.000 claims description 2
- 101000744515 Homo sapiens Ras-related protein M-Ras Proteins 0.000 claims description 2
- 101000686246 Homo sapiens Ras-related protein R-Ras Proteins 0.000 claims description 2
- 101000686227 Homo sapiens Ras-related protein R-Ras2 Proteins 0.000 claims description 2
- 101000620798 Homo sapiens Ras-related protein Rab-11A Proteins 0.000 claims description 2
- 101001079084 Homo sapiens Ras-related protein Rab-18 Proteins 0.000 claims description 2
- 101001130686 Homo sapiens Ras-related protein Rab-22A Proteins 0.000 claims description 2
- 101001130305 Homo sapiens Ras-related protein Rab-23 Proteins 0.000 claims description 2
- 101000712571 Homo sapiens Ras-related protein Rab-8A Proteins 0.000 claims description 2
- 101000831949 Homo sapiens Receptor for retinol uptake STRA6 Proteins 0.000 claims description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 claims description 2
- 101000727979 Homo sapiens Remodeling and spacing factor 1 Proteins 0.000 claims description 2
- 101001096355 Homo sapiens Replication factor C subunit 3 Proteins 0.000 claims description 2
- 101000752221 Homo sapiens Rho guanine nucleotide exchange factor 2 Proteins 0.000 claims description 2
- 101000752245 Homo sapiens Rho guanine nucleotide exchange factor 5 Proteins 0.000 claims description 2
- 101000611338 Homo sapiens Rhodopsin Proteins 0.000 claims description 2
- 101000687474 Homo sapiens Rhombotin-1 Proteins 0.000 claims description 2
- 101001111742 Homo sapiens Rhombotin-2 Proteins 0.000 claims description 2
- 101000754919 Homo sapiens Ribosomal oxygenase 2 Proteins 0.000 claims description 2
- 101000822528 Homo sapiens S-adenosylhomocysteine hydrolase-like protein 1 Proteins 0.000 claims description 2
- 101000901226 Homo sapiens S-arrestin Proteins 0.000 claims description 2
- 101000880124 Homo sapiens SERTA domain-containing protein 3 Proteins 0.000 claims description 2
- 101000654718 Homo sapiens SET-binding protein Proteins 0.000 claims description 2
- 101000650863 Homo sapiens SH2 domain-containing protein 1A Proteins 0.000 claims description 2
- 101001087372 Homo sapiens Securin Proteins 0.000 claims description 2
- 101001087358 Homo sapiens Securin-2 Proteins 0.000 claims description 2
- 101000632056 Homo sapiens Septin-9 Proteins 0.000 claims description 2
- 101000771237 Homo sapiens Serine/threonine-protein kinase A-Raf Proteins 0.000 claims description 2
- 101000987295 Homo sapiens Serine/threonine-protein kinase PAK 5 Proteins 0.000 claims description 2
- 101000864800 Homo sapiens Serine/threonine-protein kinase Sgk1 Proteins 0.000 claims description 2
- 101000595531 Homo sapiens Serine/threonine-protein kinase pim-1 Proteins 0.000 claims description 2
- 101001001648 Homo sapiens Serine/threonine-protein kinase pim-2 Proteins 0.000 claims description 2
- 101001001645 Homo sapiens Serine/threonine-protein kinase pim-3 Proteins 0.000 claims description 2
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 claims description 2
- 101000863692 Homo sapiens Ski oncogene Proteins 0.000 claims description 2
- 101000688996 Homo sapiens Ski-like protein Proteins 0.000 claims description 2
- 101000631937 Homo sapiens Sodium- and chloride-dependent glycine transporter 2 Proteins 0.000 claims description 2
- 101000639975 Homo sapiens Sodium-dependent noradrenaline transporter Proteins 0.000 claims description 2
- 101000652362 Homo sapiens Spermatogenesis-associated protein 4 Proteins 0.000 claims description 2
- 101000873927 Homo sapiens Squamous cell carcinoma antigen recognized by T-cells 3 Proteins 0.000 claims description 2
- 101000831940 Homo sapiens Stathmin Proteins 0.000 claims description 2
- 101000835900 Homo sapiens Submaxillary gland androgen-regulated protein 3B Proteins 0.000 claims description 2
- 101000716721 Homo sapiens Suprabasin Proteins 0.000 claims description 2
- 101000820700 Homo sapiens Switch-associated protein 70 Proteins 0.000 claims description 2
- 101000714470 Homo sapiens Synaptotagmin-1 Proteins 0.000 claims description 2
- 101000820777 Homo sapiens Syncytin-1 Proteins 0.000 claims description 2
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 claims description 2
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 claims description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 claims description 2
- 101001099181 Homo sapiens TATA-binding protein-associated factor 2N Proteins 0.000 claims description 2
- 101000891620 Homo sapiens TBC1 domain family member 1 Proteins 0.000 claims description 2
- 101000653585 Homo sapiens TBC1 domain family member 15 Proteins 0.000 claims description 2
- 101000800611 Homo sapiens TBC1 domain family member 3 Proteins 0.000 claims description 2
- 101000626155 Homo sapiens Tensin-4 Proteins 0.000 claims description 2
- 101000845189 Homo sapiens Testis-specific Y-encoded protein 1 Proteins 0.000 claims description 2
- 101000728490 Homo sapiens Tether containing UBX domain for GLUT4 Proteins 0.000 claims description 2
- 101000794194 Homo sapiens Tetraspanin-1 Proteins 0.000 claims description 2
- 101000852559 Homo sapiens Thioredoxin Proteins 0.000 claims description 2
- 101000799466 Homo sapiens Thrombopoietin receptor Proteins 0.000 claims description 2
- 101000809797 Homo sapiens Thymidylate synthase Proteins 0.000 claims description 2
- 101000649020 Homo sapiens Thyroid receptor-interacting protein 6 Proteins 0.000 claims description 2
- 101000838086 Homo sapiens Transaldolase Proteins 0.000 claims description 2
- 101001051166 Homo sapiens Transcriptional activator MN1 Proteins 0.000 claims description 2
- 101000775102 Homo sapiens Transcriptional coactivator YAP1 Proteins 0.000 claims description 2
- 101000669432 Homo sapiens Transducin-like enhancer protein 1 Proteins 0.000 claims description 2
- 101000800498 Homo sapiens Transketolase-like protein 1 Proteins 0.000 claims description 2
- 101000631616 Homo sapiens Translocation protein SEC62 Proteins 0.000 claims description 2
- 101000638154 Homo sapiens Transmembrane protease serine 2 Proteins 0.000 claims description 2
- 101000763474 Homo sapiens Transmembrane protein 140 Proteins 0.000 claims description 2
- 101000795130 Homo sapiens Trehalase Proteins 0.000 claims description 2
- 101000766332 Homo sapiens Tribbles homolog 1 Proteins 0.000 claims description 2
- 101000766349 Homo sapiens Tribbles homolog 2 Proteins 0.000 claims description 2
- 101000649014 Homo sapiens Triple functional domain protein Proteins 0.000 claims description 2
- 101000610980 Homo sapiens Tumor protein D52 Proteins 0.000 claims description 2
- 101000661459 Homo sapiens Tyrosine-protein kinase STYK1 Proteins 0.000 claims description 2
- 101001017896 Homo sapiens U6 snRNA-associated Sm-like protein LSm1 Proteins 0.000 claims description 2
- 101000807524 Homo sapiens Ubiquitin carboxyl-terminal hydrolase 22 Proteins 0.000 claims description 2
- 101000809257 Homo sapiens Ubiquitin carboxyl-terminal hydrolase 4 Proteins 0.000 claims description 2
- 101000800310 Homo sapiens Ubiquitin domain-containing protein TINCR Proteins 0.000 claims description 2
- 101000807354 Homo sapiens Ubiquitin-conjugating enzyme E2 C Proteins 0.000 claims description 2
- 101000772964 Homo sapiens Ubiquitin-protein ligase E3C Proteins 0.000 claims description 2
- 101000734214 Homo sapiens Unconventional prefoldin RPB5 interactor 1 Proteins 0.000 claims description 2
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 claims description 2
- 101000650162 Homo sapiens WW domain-containing transcription regulator protein 1 Proteins 0.000 claims description 2
- 101000626697 Homo sapiens YEATS domain-containing protein 4 Proteins 0.000 claims description 2
- 101000759453 Homo sapiens YY1-associated protein 1 Proteins 0.000 claims description 2
- 101000788669 Homo sapiens Zinc finger MYM-type protein 2 Proteins 0.000 claims description 2
- 101000723661 Homo sapiens Zinc finger protein 703 Proteins 0.000 claims description 2
- 108090000320 Hyaluronan Synthases Proteins 0.000 claims description 2
- 206010021143 Hypoxia Diseases 0.000 claims description 2
- 102100023423 IST1 homolog Human genes 0.000 claims description 2
- 102100021857 Inhibitor of nuclear factor kappa-B kinase subunit epsilon Human genes 0.000 claims description 2
- 102100025092 Insulin receptor substrate 2 Human genes 0.000 claims description 2
- 102100037924 Insulin-like growth factor 2 mRNA-binding protein 1 Human genes 0.000 claims description 2
- 102100024061 Integrator complex subunit 1 Human genes 0.000 claims description 2
- 102100033265 Integrator complex subunit 2 Human genes 0.000 claims description 2
- 102100033263 Integrator complex subunit 3 Human genes 0.000 claims description 2
- 102100039134 Integrator complex subunit 4 Human genes 0.000 claims description 2
- 102100039131 Integrator complex subunit 5 Human genes 0.000 claims description 2
- 102100030147 Integrator complex subunit 7 Human genes 0.000 claims description 2
- 102100030148 Integrator complex subunit 8 Human genes 0.000 claims description 2
- 102100025306 Integrin alpha-IIb Human genes 0.000 claims description 2
- 101710149643 Integrin alpha-IIb Proteins 0.000 claims description 2
- 102100037850 Interferon gamma Human genes 0.000 claims description 2
- 108010002350 Interleukin-2 Proteins 0.000 claims description 2
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 claims description 2
- 108090001005 Interleukin-6 Proteins 0.000 claims description 2
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 claims description 2
- 108090001007 Interleukin-8 Proteins 0.000 claims description 2
- 102100039905 Isocitrate dehydrogenase [NADP] cytoplasmic Human genes 0.000 claims description 2
- 102100024407 Jouberin Human genes 0.000 claims description 2
- 102100026153 Junction plakoglobin Human genes 0.000 claims description 2
- 102100027631 Kinesin-like protein KIF14 Human genes 0.000 claims description 2
- 102100024580 L-lactate dehydrogenase B chain Human genes 0.000 claims description 2
- 102100038448 LETM1 domain-containing protein 1 Human genes 0.000 claims description 2
- 102100026460 LIM domain only protein 3 Human genes 0.000 claims description 2
- 102100033494 LIM domain transcription factor LMO4 Human genes 0.000 claims description 2
- 102100026004 Lactoylglutathione lyase Human genes 0.000 claims description 2
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 claims description 2
- 102100026753 Lymphokine-activated killer T-cell-originated protein kinase Human genes 0.000 claims description 2
- 102100035304 Lymphotactin Human genes 0.000 claims description 2
- 102100033230 Lysine-specific demethylase 4C Human genes 0.000 claims description 2
- 102100023330 M-phase inducer phosphatase 3 Human genes 0.000 claims description 2
- 108091007767 MALAT1 Proteins 0.000 claims description 2
- 102000046961 MRE11 Homologue Human genes 0.000 claims description 2
- 108700019589 MRE11 Homologue Proteins 0.000 claims description 2
- 101150053046 MYD88 gene Proteins 0.000 claims description 2
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 claims description 2
- 102100027998 Macrophage metalloelastase Human genes 0.000 claims description 2
- 102100024573 Macrophage-capping protein Human genes 0.000 claims description 2
- 102100040888 Malignant T-cell-amplified sequence 1 Human genes 0.000 claims description 2
- 102100025130 Mastermind-like protein 2 Human genes 0.000 claims description 2
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 claims description 2
- 102100025083 Melanoma-associated antigen 11 Human genes 0.000 claims description 2
- 102100036834 Metabotropic glutamate receptor 1 Human genes 0.000 claims description 2
- 102100026892 Metastasis-associated in colon cancer protein 1 Human genes 0.000 claims description 2
- 102100039560 Microtubule-associated protein RP/EB family member 1 Human genes 0.000 claims description 2
- 102100029624 Migration and invasion enhancer 1 Human genes 0.000 claims description 2
- 102100026907 Mitogen-activated protein kinase kinase kinase 8 Human genes 0.000 claims description 2
- 101710132461 Molybdenum cofactor sulfurase Proteins 0.000 claims description 2
- 101150097381 Mtor gene Proteins 0.000 claims description 2
- 102100023123 Mucin-16 Human genes 0.000 claims description 2
- 102100034263 Mucin-2 Human genes 0.000 claims description 2
- 102100022497 Mucin-3A Human genes 0.000 claims description 2
- 101100335081 Mus musculus Flt3 gene Proteins 0.000 claims description 2
- 102100024134 Myeloid differentiation primary response protein MyD88 Human genes 0.000 claims description 2
- 102100034100 Myocardin-related transcription factor B Human genes 0.000 claims description 2
- 102100038360 N-acylethanolamine-hydrolyzing acid amidase Human genes 0.000 claims description 2
- 102100031455 NAD-dependent protein deacetylase sirtuin-1 Human genes 0.000 claims description 2
- 102100021840 NAD-dependent protein deacetylase sirtuin-6 Human genes 0.000 claims description 2
- 108091027881 NEAT1 Proteins 0.000 claims description 2
- 102100021733 NUAK family SNF1-like kinase 2 Human genes 0.000 claims description 2
- 102100027086 NUT family member 1 Human genes 0.000 claims description 2
- 102100035486 Nectin-4 Human genes 0.000 claims description 2
- 102100023616 Neural cell adhesion molecule L1-like protein Human genes 0.000 claims description 2
- 102100037005 Neuroblastoma breakpoint family member 12 Human genes 0.000 claims description 2
- 102100030394 Neuronal membrane glycoprotein M6-a Human genes 0.000 claims description 2
- 102100033800 Neuronal membrane glycoprotein M6-b Human genes 0.000 claims description 2
- 102100035405 Neutrophil gelatinase-associated lipocalin Human genes 0.000 claims description 2
- 102100023120 Ninein-like protein Human genes 0.000 claims description 2
- 108010029755 Notch1 Receptor Proteins 0.000 claims description 2
- 108010029741 Notch4 Receptor Proteins 0.000 claims description 2
- 102000001753 Notch4 Receptor Human genes 0.000 claims description 2
- 102100033819 Nuclear pore complex protein Nup214 Human genes 0.000 claims description 2
- 102100025372 Nuclear pore complex protein Nup98-Nup96 Human genes 0.000 claims description 2
- 102100022927 Nuclear receptor coactivator 4 Human genes 0.000 claims description 2
- 102100033615 Nucleoprotein TPR Human genes 0.000 claims description 2
- 102100023252 Nucleoside diphosphate kinase A Human genes 0.000 claims description 2
- 102100036518 Nucleoside diphosphate phosphatase ENTPD5 Human genes 0.000 claims description 2
- KUIFHYPNNRVEKZ-VIJRYAKMSA-N O-(N-acetyl-alpha-D-galactosaminyl)-L-threonine Chemical compound OC(=O)[C@@H](N)[C@@H](C)O[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1NC(C)=O KUIFHYPNNRVEKZ-VIJRYAKMSA-N 0.000 claims description 2
- 102000043276 Oncogene Human genes 0.000 claims description 2
- 102100025386 Oxidized low-density lipoprotein receptor 1 Human genes 0.000 claims description 2
- 102100036220 PC4 and SFRS1-interacting protein Human genes 0.000 claims description 2
- 102100029879 PCNA-associated factor Human genes 0.000 claims description 2
- 102100025648 PDZK1-interacting protein 1 Human genes 0.000 claims description 2
- 102100028958 PR domain zinc finger protein 12 Human genes 0.000 claims description 2
- 102000036673 PRAME Human genes 0.000 claims description 2
- 108060006580 PRAME Proteins 0.000 claims description 2
- 108091093018 PVT1 Proteins 0.000 claims description 2
- 102100037499 Parkinson disease protein 7 Human genes 0.000 claims description 2
- 108010071083 Patched-2 Receptor Proteins 0.000 claims description 2
- 102100037974 Peroxisomal carnitine O-octanoyltransferase Human genes 0.000 claims description 2
- 102100024242 Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 Human genes 0.000 claims description 2
- 102100026169 Phosphatidylinositol 3-kinase regulatory subunit alpha Human genes 0.000 claims description 2
- 102100038332 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Human genes 0.000 claims description 2
- 102100038725 Phosphatidylinositol glycan anchor biosynthesis class U protein Human genes 0.000 claims description 2
- 102100034179 Phospholipase DDHD2 Human genes 0.000 claims description 2
- 102100026123 Pirin Human genes 0.000 claims description 2
- 102100037419 Pituitary tumor-transforming gene 1 protein-interacting protein Human genes 0.000 claims description 2
- 102100035194 Placenta growth factor Human genes 0.000 claims description 2
- 102100037596 Platelet-derived growth factor subunit A Human genes 0.000 claims description 2
- 102100030702 Polycomb protein SUZ12 Human genes 0.000 claims description 2
- 102100023217 Polypeptide N-acetylgalactosaminyltransferase 10 Human genes 0.000 claims description 2
- 102100031755 Pre-mRNA 3'-end-processing factor FIP1 Human genes 0.000 claims description 2
- 102100029480 Probable ATP-dependent RNA helicase DDX6 Human genes 0.000 claims description 2
- 102100033838 Probable G-protein coupled receptor 132 Human genes 0.000 claims description 2
- 102100034729 Proline-, glutamic acid- and leucine-rich protein 1 Human genes 0.000 claims description 2
- 102100024055 Prostate androgen-regulated mucin-like protein 1 Human genes 0.000 claims description 2
- 102100036735 Prostate stem cell antigen Human genes 0.000 claims description 2
- 102100024304 Protachykinin-1 Human genes 0.000 claims description 2
- 102100039686 Protein AF-9 Human genes 0.000 claims description 2
- 102100040665 Protein AF1q Human genes 0.000 claims description 2
- 102100021567 Protein BANP Human genes 0.000 claims description 2
- 102100024952 Protein CBFA2T1 Human genes 0.000 claims description 2
- 102100028634 Protein CIP2A Human genes 0.000 claims description 2
- 102100026113 Protein DEK Human genes 0.000 claims description 2
- 108010032428 Protein Deglycase DJ-1 Proteins 0.000 claims description 2
- 102100033813 Protein ENL Human genes 0.000 claims description 2
- 102100027246 Protein EVI2A Human genes 0.000 claims description 2
- 102100023844 Protein FAM189B Human genes 0.000 claims description 2
- 102100034514 Protein FAM72A Human genes 0.000 claims description 2
- 102100032133 Protein LYRIC Human genes 0.000 claims description 2
- 102100023475 Protein MMS22-like Human genes 0.000 claims description 2
- 102100023087 Protein S100-A4 Human genes 0.000 claims description 2
- 102100032446 Protein S100-A7 Human genes 0.000 claims description 2
- 102100032442 Protein S100-A8 Human genes 0.000 claims description 2
- 102100037687 Protein SSX1 Human genes 0.000 claims description 2
- 102100039461 Protein Wnt-10a Human genes 0.000 claims description 2
- 102100029062 Protein Wnt-10b Human genes 0.000 claims description 2
- 101710188315 Protein X Proteins 0.000 claims description 2
- 102100034607 Protein arginine N-methyltransferase 5 Human genes 0.000 claims description 2
- 101710084427 Protein arginine N-methyltransferase 5 Proteins 0.000 claims description 2
- 102100025460 Protein lin-28 homolog A Human genes 0.000 claims description 2
- 102100025459 Protein lin-28 homolog B Human genes 0.000 claims description 2
- 102100031352 Protein p13 MTCP-1 Human genes 0.000 claims description 2
- 102100024599 Protein tyrosine phosphatase type IVA 1 Human genes 0.000 claims description 2
- 102100024602 Protein tyrosine phosphatase type IVA 2 Human genes 0.000 claims description 2
- 102100024601 Protein tyrosine phosphatase type IVA 3 Human genes 0.000 claims description 2
- 108091000521 Protein-Arginine Deiminase Type 2 Proteins 0.000 claims description 2
- 102100035735 Protein-arginine deiminase type-2 Human genes 0.000 claims description 2
- 102100038094 Protein-glutamine gamma-glutamyltransferase E Human genes 0.000 claims description 2
- 102100037925 Prothymosin alpha Human genes 0.000 claims description 2
- 102100021384 Proto-oncogene DBL Human genes 0.000 claims description 2
- 102100037072 Proto-oncogene FRAT1 Human genes 0.000 claims description 2
- 108050004181 Proto-oncogene Mas Proteins 0.000 claims description 2
- 102100032190 Proto-oncogene vav Human genes 0.000 claims description 2
- 102100025895 RAD50-interacting protein 1 Human genes 0.000 claims description 2
- 102100023449 RNA polymerase II elongation factor ELL Human genes 0.000 claims description 2
- 102100038040 RNA-binding motif protein, Y chromosome, family 1 member A1 Human genes 0.000 claims description 2
- 102000004229 RNA-binding protein EWS Human genes 0.000 claims description 2
- 108090000740 RNA-binding protein EWS Proteins 0.000 claims description 2
- 102000003890 RNA-binding protein FUS Human genes 0.000 claims description 2
- 108090000292 RNA-binding protein FUS Proteins 0.000 claims description 2
- 102100034026 RNA-binding protein Musashi homolog 1 Human genes 0.000 claims description 2
- 108700040655 RUNX1 Translocation Partner 1 Proteins 0.000 claims description 2
- 102100039789 Ras-related protein M-Ras Human genes 0.000 claims description 2
- 102100024683 Ras-related protein R-Ras Human genes 0.000 claims description 2
- 102100025003 Ras-related protein R-Ras2 Human genes 0.000 claims description 2
- 102100022873 Ras-related protein Rab-11A Human genes 0.000 claims description 2
- 102100028149 Ras-related protein Rab-18 Human genes 0.000 claims description 2
- 102100031516 Ras-related protein Rab-22A Human genes 0.000 claims description 2
- 102100031522 Ras-related protein Rab-23 Human genes 0.000 claims description 2
- 102100033480 Ras-related protein Rab-8A Human genes 0.000 claims description 2
- 101100372762 Rattus norvegicus Flt1 gene Proteins 0.000 claims description 2
- 101000852966 Rattus norvegicus Interleukin-1 receptor-like 1 Proteins 0.000 claims description 2
- 101001000628 Rattus norvegicus Peripheral myelin protein 22 Proteins 0.000 claims description 2
- 102100024235 Receptor for retinol uptake STRA6 Human genes 0.000 claims description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 claims description 2
- 102100029771 Remodeling and spacing factor 1 Human genes 0.000 claims description 2
- 102100037855 Replication factor C subunit 3 Human genes 0.000 claims description 2
- 108010053823 Rho Guanine Nucleotide Exchange Factors Proteins 0.000 claims description 2
- 102100021708 Rho guanine nucleotide exchange factor 1 Human genes 0.000 claims description 2
- 102100021707 Rho guanine nucleotide exchange factor 2 Human genes 0.000 claims description 2
- 102100021688 Rho guanine nucleotide exchange factor 5 Human genes 0.000 claims description 2
- 102100040756 Rhodopsin Human genes 0.000 claims description 2
- 102100024869 Rhombotin-1 Human genes 0.000 claims description 2
- 102100023876 Rhombotin-2 Human genes 0.000 claims description 2
- 102100022092 Ribosomal oxygenase 2 Human genes 0.000 claims description 2
- 208000035217 Ring chromosome 1 syndrome Diseases 0.000 claims description 2
- 108010055623 S-Phase Kinase-Associated Proteins Proteins 0.000 claims description 2
- 102100022479 S-adenosylhomocysteine hydrolase-like protein 1 Human genes 0.000 claims description 2
- 102100034374 S-phase kinase-associated protein 2 Human genes 0.000 claims description 2
- 108010005256 S100 Calcium Binding Protein A7 Proteins 0.000 claims description 2
- 108010085149 S100 Calcium-Binding Protein A4 Proteins 0.000 claims description 2
- 102100028029 SCL-interrupting locus protein Human genes 0.000 claims description 2
- 102100037366 SERTA domain-containing protein 3 Human genes 0.000 claims description 2
- 102100032741 SET-binding protein Human genes 0.000 claims description 2
- 108091006634 SLC12A5 Proteins 0.000 claims description 2
- 108091006313 SLC3A2 Proteins 0.000 claims description 2
- 102100033004 Securin Human genes 0.000 claims description 2
- 102100033002 Securin-2 Human genes 0.000 claims description 2
- 102100028024 Septin-9 Human genes 0.000 claims description 2
- 102100029437 Serine/threonine-protein kinase A-Raf Human genes 0.000 claims description 2
- 102100027941 Serine/threonine-protein kinase PAK 5 Human genes 0.000 claims description 2
- 102100030070 Serine/threonine-protein kinase Sgk1 Human genes 0.000 claims description 2
- 102100023085 Serine/threonine-protein kinase mTOR Human genes 0.000 claims description 2
- 102100036077 Serine/threonine-protein kinase pim-1 Human genes 0.000 claims description 2
- 102100036120 Serine/threonine-protein kinase pim-2 Human genes 0.000 claims description 2
- 102100036119 Serine/threonine-protein kinase pim-3 Human genes 0.000 claims description 2
- 102100038081 Signal transducer CD24 Human genes 0.000 claims description 2
- 108010041191 Sirtuin 1 Proteins 0.000 claims description 2
- 102100029969 Ski oncogene Human genes 0.000 claims description 2
- 102100024451 Ski-like protein Human genes 0.000 claims description 2
- 102100028886 Sodium- and chloride-dependent glycine transporter 2 Human genes 0.000 claims description 2
- 102100034250 Solute carrier family 12 member 5 Human genes 0.000 claims description 2
- 102100030259 Spermatogenesis-associated protein 4 Human genes 0.000 claims description 2
- 101000942604 Sphingomonas wittichii (strain DC-6 / KACC 16600) Chloroacetanilide N-alkylformylase, oxygenase component Proteins 0.000 claims description 2
- 102100035748 Squamous cell carcinoma antigen recognized by T-cells 3 Human genes 0.000 claims description 2
- 102100024237 Stathmin Human genes 0.000 claims description 2
- 102100025729 Submaxillary gland androgen-regulated protein 3B Human genes 0.000 claims description 2
- 102100020889 Suprabasin Human genes 0.000 claims description 2
- 102100021701 Switch-associated protein 70 Human genes 0.000 claims description 2
- 102100036417 Synaptotagmin-1 Human genes 0.000 claims description 2
- 102100021696 Syncytin-1 Human genes 0.000 claims description 2
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 claims description 2
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 claims description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 claims description 2
- 101150057140 TACSTD1 gene Proteins 0.000 claims description 2
- 108700012457 TACSTD2 Proteins 0.000 claims description 2
- 102100040238 TBC1 domain family member 1 Human genes 0.000 claims description 2
- 102100029870 TBC1 domain family member 15 Human genes 0.000 claims description 2
- 102100033271 TBC1 domain family member 3 Human genes 0.000 claims description 2
- 102000002259 TNF-Related Apoptosis-Inducing Ligand Receptors Human genes 0.000 claims description 2
- 108010000449 TNF-Related Apoptosis-Inducing Ligand Receptors Proteins 0.000 claims description 2
- 101710175789 Tafazzin Proteins 0.000 claims description 2
- 102100038126 Tenascin Human genes 0.000 claims description 2
- 108010008125 Tenascin Proteins 0.000 claims description 2
- 102100024545 Tensin-4 Human genes 0.000 claims description 2
- 102100031283 Testis-specific Y-encoded protein 1 Human genes 0.000 claims description 2
- 102100029773 Tether containing UBX domain for GLUT4 Human genes 0.000 claims description 2
- 102100030169 Tetraspanin-1 Human genes 0.000 claims description 2
- 102100036407 Thioredoxin Human genes 0.000 claims description 2
- 102100034196 Thrombopoietin receptor Human genes 0.000 claims description 2
- 102100038618 Thymidylate synthase Human genes 0.000 claims description 2
- 102100028099 Thyroid receptor-interacting protein 6 Human genes 0.000 claims description 2
- 102100028601 Transaldolase Human genes 0.000 claims description 2
- 102100025171 Transcription initiation factor TFIID subunit 12 Human genes 0.000 claims description 2
- 102100022012 Transcription intermediary factor 1-beta Human genes 0.000 claims description 2
- 101710177718 Transcription intermediary factor 1-beta Proteins 0.000 claims description 2
- 102100024592 Transcriptional activator MN1 Human genes 0.000 claims description 2
- 102100031873 Transcriptional coactivator YAP1 Human genes 0.000 claims description 2
- 102100039362 Transducin-like enhancer protein 1 Human genes 0.000 claims description 2
- 102100033108 Transketolase-like protein 1 Human genes 0.000 claims description 2
- 102100029007 Translocation protein SEC62 Human genes 0.000 claims description 2
- 102100031989 Transmembrane protease serine 2 Human genes 0.000 claims description 2
- 102100027030 Transmembrane protein 140 Human genes 0.000 claims description 2
- 102100029677 Trehalase Human genes 0.000 claims description 2
- 102100026387 Tribbles homolog 1 Human genes 0.000 claims description 2
- 102100026394 Tribbles homolog 2 Human genes 0.000 claims description 2
- OKKRPWIIYQTPQF-UHFFFAOYSA-N Trimethylolpropane trimethacrylate Chemical compound CC(=C)C(=O)OCC(CC)(COC(=O)C(C)=C)COC(=O)C(C)=C OKKRPWIIYQTPQF-UHFFFAOYSA-N 0.000 claims description 2
- 102100028101 Triple functional domain protein Human genes 0.000 claims description 2
- 102100040418 Tumor protein D52 Human genes 0.000 claims description 2
- 206010054094 Tumour necrosis Diseases 0.000 claims description 2
- 102100037781 Tyrosine-protein kinase STYK1 Human genes 0.000 claims description 2
- 102100033314 U6 snRNA-associated Sm-like protein LSm1 Human genes 0.000 claims description 2
- 102000056723 UBE3C Human genes 0.000 claims description 2
- 108010005656 Ubiquitin Thiolesterase Proteins 0.000 claims description 2
- 102100037184 Ubiquitin carboxyl-terminal hydrolase 22 Human genes 0.000 claims description 2
- 102100038463 Ubiquitin carboxyl-terminal hydrolase 4 Human genes 0.000 claims description 2
- 102100025038 Ubiquitin carboxyl-terminal hydrolase isozyme L1 Human genes 0.000 claims description 2
- 102100033084 Ubiquitin domain-containing protein TINCR Human genes 0.000 claims description 2
- 102100037256 Ubiquitin-conjugating enzyme E2 C Human genes 0.000 claims description 2
- 102100033622 Unconventional prefoldin RPB5 interactor 1 Human genes 0.000 claims description 2
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 claims description 2
- 108010053100 Vascular Endothelial Growth Factor Receptor-3 Proteins 0.000 claims description 2
- 102000016663 Vascular Endothelial Growth Factor Receptor-3 Human genes 0.000 claims description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 2
- 108010026102 Vitamin D3 24-Hydroxylase Proteins 0.000 claims description 2
- 102000013387 Vitamin D3 24-Hydroxylase Human genes 0.000 claims description 2
- 101150019524 WNT2 gene Proteins 0.000 claims description 2
- 102000052547 Wnt-1 Human genes 0.000 claims description 2
- 102000052556 Wnt-2 Human genes 0.000 claims description 2
- 108700020986 Wnt-2 Proteins 0.000 claims description 2
- 102000052549 Wnt-3 Human genes 0.000 claims description 2
- 102000043366 Wnt-5a Human genes 0.000 claims description 2
- 108700031544 X-Linked Inhibitor of Apoptosis Proteins 0.000 claims description 2
- 101100445056 Xenopus laevis elavl1-a gene Proteins 0.000 claims description 2
- 101100445057 Xenopus laevis elavl1-b gene Proteins 0.000 claims description 2
- 101100485099 Xenopus laevis wnt2b-b gene Proteins 0.000 claims description 2
- 102100024780 YEATS domain-containing protein 4 Human genes 0.000 claims description 2
- 102100023267 YY1-associated protein 1 Human genes 0.000 claims description 2
- 102100025085 Zinc finger MYM-type protein 2 Human genes 0.000 claims description 2
- 102100028376 Zinc finger protein 703 Human genes 0.000 claims description 2
- 230000001594 aberrant effect Effects 0.000 claims description 2
- 108010026331 alpha-Fetoproteins Proteins 0.000 claims description 2
- 102000013529 alpha-Fetoproteins Human genes 0.000 claims description 2
- 210000001072 colon Anatomy 0.000 claims description 2
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 claims description 2
- 102000006815 folate receptor Human genes 0.000 claims description 2
- 108020005243 folate receptor Proteins 0.000 claims description 2
- 150000002270 gangliosides Chemical class 0.000 claims description 2
- 230000007954 hypoxia Effects 0.000 claims description 2
- 230000002401 inhibitory effect Effects 0.000 claims description 2
- 108040006849 interleukin-2 receptor activity proteins Proteins 0.000 claims description 2
- 208000033350 intracranial berry type 1 aneurysm Diseases 0.000 claims description 2
- 101150071637 mre11 gene Proteins 0.000 claims description 2
- 230000004770 neurodegeneration Effects 0.000 claims description 2
- 208000015122 neurodegenerative disease Diseases 0.000 claims description 2
- 108010054452 nuclear pore complex protein 98 Proteins 0.000 claims description 2
- 108010017843 platelet-derived growth factor A Proteins 0.000 claims description 2
- 108091005418 scavenger receptor class E Proteins 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 96
- 102100022936 ATPase inhibitor, mitochondrial Human genes 0.000 claims 2
- 101710085568 ATPase inhibitor, mitochondrial Proteins 0.000 claims 2
- 102100029108 Elongation factor 1-alpha 2 Human genes 0.000 claims 2
- 101000841231 Homo sapiens Elongation factor 1-alpha 2 Proteins 0.000 claims 2
- 102100029503 E3 ubiquitin-protein ligase TRIM32 Human genes 0.000 claims 1
- 102100036703 Guanine nucleotide-binding protein subunit alpha-13 Human genes 0.000 claims 1
- 101000634982 Homo sapiens E3 ubiquitin-protein ligase TRIM32 Proteins 0.000 claims 1
- 101001072481 Homo sapiens Guanine nucleotide-binding protein subunit alpha-13 Proteins 0.000 claims 1
- 101000642815 Homo sapiens Protein SSXT Proteins 0.000 claims 1
- 101000800847 Homo sapiens Protein TFG Proteins 0.000 claims 1
- 101001076867 Homo sapiens RNA-binding protein 3 Proteins 0.000 claims 1
- 101000712958 Homo sapiens Ras association domain-containing protein 1 Proteins 0.000 claims 1
- 101000783404 Homo sapiens Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform Proteins 0.000 claims 1
- 101000837401 Homo sapiens T-cell leukemia/lymphoma protein 1A Proteins 0.000 claims 1
- 102100025298 Mitochondrial-processing peptidase subunit beta Human genes 0.000 claims 1
- 102100027983 Molybdenum cofactor sulfurase Human genes 0.000 claims 1
- 102000001759 Notch1 Receptor Human genes 0.000 claims 1
- 102000007497 Patched-2 Receptor Human genes 0.000 claims 1
- 101710169169 Polyprenol monophosphomannose synthase Proteins 0.000 claims 1
- 102100035586 Protein SSXT Human genes 0.000 claims 1
- 102100033661 Protein TFG Human genes 0.000 claims 1
- 102100025902 RNA-binding protein 3 Human genes 0.000 claims 1
- 102100023320 Ral guanine nucleotide dissociation stimulator Human genes 0.000 claims 1
- 101150015043 Ralgds gene Proteins 0.000 claims 1
- 102100033243 Ras association domain-containing protein 1 Human genes 0.000 claims 1
- 102100022135 S-arrestin Human genes 0.000 claims 1
- 102100036122 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform Human genes 0.000 claims 1
- 102100028676 T-cell leukemia/lymphoma protein 1A Human genes 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 abstract description 42
- 230000006870 function Effects 0.000 abstract description 23
- 239000012636 effector Substances 0.000 abstract description 22
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 abstract description 12
- 102000004169 proteins and genes Human genes 0.000 abstract description 12
- 239000003814 drug Substances 0.000 abstract description 11
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 abstract description 8
- 230000009471 action Effects 0.000 abstract description 5
- 210000000440 neutrophil Anatomy 0.000 abstract description 5
- 229940124597 therapeutic agent Drugs 0.000 abstract description 5
- 241000124008 Mammalia Species 0.000 abstract description 3
- 230000007246 mechanism Effects 0.000 abstract description 3
- 229940125644 antibody drug Drugs 0.000 abstract 1
- 150000001413 amino acids Chemical class 0.000 description 187
- 239000000203 mixture Substances 0.000 description 22
- 239000000243 solution Substances 0.000 description 19
- 230000014509 gene expression Effects 0.000 description 18
- 230000008569 process Effects 0.000 description 18
- 108010087819 Fc receptors Proteins 0.000 description 17
- 102000009109 Fc receptors Human genes 0.000 description 17
- 238000004458 analytical method Methods 0.000 description 13
- 238000010586 diagram Methods 0.000 description 12
- 239000013604 expression vector Substances 0.000 description 12
- 241001465754 Metazoa Species 0.000 description 11
- 108090000765 processed proteins & peptides Proteins 0.000 description 11
- 238000012216 screening Methods 0.000 description 11
- 238000002965 ELISA Methods 0.000 description 10
- 108010076504 Protein Sorting Signals Proteins 0.000 description 10
- 210000004102 animal cell Anatomy 0.000 description 9
- 239000000872 buffer Substances 0.000 description 9
- 230000009977 dual effect Effects 0.000 description 9
- 235000018102 proteins Nutrition 0.000 description 9
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 9
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 8
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 8
- 230000000295 complement effect Effects 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 238000012552 review Methods 0.000 description 8
- 239000006228 supernatant Substances 0.000 description 8
- 238000005406 washing Methods 0.000 description 8
- 206010057249 Phagocytosis Diseases 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 7
- 229940024606 amino acid Drugs 0.000 description 7
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 7
- 230000008782 phagocytosis Effects 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- 239000011347 resin Substances 0.000 description 7
- 229920005989 resin Polymers 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 239000001963 growth medium Substances 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 210000000265 leukocyte Anatomy 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 102000004196 processed proteins & peptides Human genes 0.000 description 6
- 229960000575 trastuzumab Drugs 0.000 description 6
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 108010090804 Streptavidin Proteins 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 230000009089 cytolysis Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 238000000684 flow cytometry Methods 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 235000020183 skimmed milk Nutrition 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 206010020751 Hypersensitivity Diseases 0.000 description 4
- 108010073816 IgE Receptors Proteins 0.000 description 4
- 102000009438 IgE Receptors Human genes 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 239000000654 additive Substances 0.000 description 4
- 208000026935 allergic disease Diseases 0.000 description 4
- 230000006907 apoptotic process Effects 0.000 description 4
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 4
- 229960005091 chloramphenicol Drugs 0.000 description 4
- 239000003623 enhancer Substances 0.000 description 4
- 210000000224 granular leucocyte Anatomy 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 3
- ZEOWTGPWHLSLOG-UHFFFAOYSA-N Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F Chemical compound Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F ZEOWTGPWHLSLOG-UHFFFAOYSA-N 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 102100023593 Fibroblast growth factor receptor 1 Human genes 0.000 description 3
- 101710182386 Fibroblast growth factor receptor 1 Proteins 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 108010042653 IgA receptor Proteins 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 3
- 108010013639 Peptidoglycan Proteins 0.000 description 3
- 108010051742 Platelet-Derived Growth Factor beta Receptor Proteins 0.000 description 3
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 3
- 239000004793 Polystyrene Substances 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 108010016200 Zinc Finger Protein GLI1 Proteins 0.000 description 3
- 102100035535 Zinc finger protein GLI1 Human genes 0.000 description 3
- 230000000996 additive effect Effects 0.000 description 3
- 239000003125 aqueous solvent Substances 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 210000004443 dendritic cell Anatomy 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 235000019441 ethanol Nutrition 0.000 description 3
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 230000016784 immunoglobulin production Effects 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 230000002757 inflammatory effect Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 210000001616 monocyte Anatomy 0.000 description 3
- 229920002223 polystyrene Polymers 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 239000012562 protein A resin Substances 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 102000052666 B-Cell Lymphoma 3 Human genes 0.000 description 2
- 108700009171 B-Cell Lymphoma 3 Proteins 0.000 description 2
- 102100021631 B-cell lymphoma 6 protein Human genes 0.000 description 2
- 101150072667 Bcl3 gene Proteins 0.000 description 2
- 102100024965 Caspase recruitment domain-containing protein 11 Human genes 0.000 description 2
- 102100028914 Catenin beta-1 Human genes 0.000 description 2
- 102100035888 Caveolin-1 Human genes 0.000 description 2
- 206010057248 Cell death Diseases 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 102100021246 DDIT3 upstream open reading frame protein Human genes 0.000 description 2
- 102100027641 DNA-binding protein inhibitor ID-1 Human genes 0.000 description 2
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 2
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 2
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 2
- 102100027844 Fibroblast growth factor receptor 4 Human genes 0.000 description 2
- 108010009306 Forkhead Box Protein O1 Proteins 0.000 description 2
- 102100035427 Forkhead box protein O1 Human genes 0.000 description 2
- 108010070675 Glutathione transferase Proteins 0.000 description 2
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 2
- 102100035108 High affinity nerve growth factor receptor Human genes 0.000 description 2
- 101000971234 Homo sapiens B-cell lymphoma 6 protein Proteins 0.000 description 2
- 101000903697 Homo sapiens B-cell lymphoma/leukemia 11B Proteins 0.000 description 2
- 101000761179 Homo sapiens Caspase recruitment domain-containing protein 11 Proteins 0.000 description 2
- 101000916173 Homo sapiens Catenin beta-1 Proteins 0.000 description 2
- 101000715467 Homo sapiens Caveolin-1 Proteins 0.000 description 2
- 101001081590 Homo sapiens DNA-binding protein inhibitor ID-1 Proteins 0.000 description 2
- 101000917134 Homo sapiens Fibroblast growth factor receptor 4 Proteins 0.000 description 2
- 101000596894 Homo sapiens High affinity nerve growth factor receptor Proteins 0.000 description 2
- 101001139130 Homo sapiens Krueppel-like factor 5 Proteins 0.000 description 2
- 101001030211 Homo sapiens Myc proto-oncogene protein Proteins 0.000 description 2
- 101000979338 Homo sapiens Nuclear factor NF-kappa-B p100 subunit Proteins 0.000 description 2
- 101001126417 Homo sapiens Platelet-derived growth factor receptor alpha Proteins 0.000 description 2
- 101000876829 Homo sapiens Protein C-ets-1 Proteins 0.000 description 2
- 101000878540 Homo sapiens Protein-tyrosine kinase 2-beta Proteins 0.000 description 2
- 101000779418 Homo sapiens RAC-alpha serine/threonine-protein kinase Proteins 0.000 description 2
- 101000798015 Homo sapiens RAC-beta serine/threonine-protein kinase Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 101000932478 Homo sapiens Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 2
- 101000740178 Homo sapiens Sal-like protein 4 Proteins 0.000 description 2
- 101000984753 Homo sapiens Serine/threonine-protein kinase B-raf Proteins 0.000 description 2
- 101000596772 Homo sapiens Transcription factor 7-like 1 Proteins 0.000 description 2
- 101000666382 Homo sapiens Transcription factor E2-alpha Proteins 0.000 description 2
- 101000904152 Homo sapiens Transcription factor E2F1 Proteins 0.000 description 2
- 101000904150 Homo sapiens Transcription factor E2F3 Proteins 0.000 description 2
- 101000866336 Homo sapiens Transcription factor E2F5 Proteins 0.000 description 2
- 101001028730 Homo sapiens Transcription factor JunB Proteins 0.000 description 2
- 101001050297 Homo sapiens Transcription factor JunD Proteins 0.000 description 2
- 101000823316 Homo sapiens Tyrosine-protein kinase ABL1 Proteins 0.000 description 2
- 101001022129 Homo sapiens Tyrosine-protein kinase Fyn Proteins 0.000 description 2
- 101000997832 Homo sapiens Tyrosine-protein kinase JAK2 Proteins 0.000 description 2
- 101000702691 Homo sapiens Zinc finger protein SNAI1 Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 102100020680 Krueppel-like factor 5 Human genes 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 2
- 102000016943 Muramidase Human genes 0.000 description 2
- 108010014251 Muramidase Proteins 0.000 description 2
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 2
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 2
- 102100023059 Nuclear factor NF-kappa-B p100 subunit Human genes 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 241000286209 Phasianidae Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102100030485 Platelet-derived growth factor receptor alpha Human genes 0.000 description 2
- 102100035251 Protein C-ets-1 Human genes 0.000 description 2
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 2
- 102100037787 Protein-tyrosine kinase 2-beta Human genes 0.000 description 2
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 2
- 102100032315 RAC-beta serine/threonine-protein kinase Human genes 0.000 description 2
- 101150111584 RHOA gene Proteins 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 2
- 108060006706 SRC Proteins 0.000 description 2
- 102000001332 SRC Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 102100037192 Sal-like protein 4 Human genes 0.000 description 2
- 102100027103 Serine/threonine-protein kinase B-raf Human genes 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 2
- 108010057666 Transcription Factor CHOP Proteins 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102100038313 Transcription factor E2-alpha Human genes 0.000 description 2
- 102100024026 Transcription factor E2F1 Human genes 0.000 description 2
- 102100024027 Transcription factor E2F3 Human genes 0.000 description 2
- 102100031632 Transcription factor E2F5 Human genes 0.000 description 2
- 102100037168 Transcription factor JunB Human genes 0.000 description 2
- 102100023118 Transcription factor JunD Human genes 0.000 description 2
- 102100022387 Transforming protein RhoA Human genes 0.000 description 2
- 102100022596 Tyrosine-protein kinase ABL1 Human genes 0.000 description 2
- 102100035221 Tyrosine-protein kinase Fyn Human genes 0.000 description 2
- 102100033444 Tyrosine-protein kinase JAK2 Human genes 0.000 description 2
- 108700020467 WT1 Proteins 0.000 description 2
- 101150084041 WT1 gene Proteins 0.000 description 2
- 102100022748 Wilms tumor protein Human genes 0.000 description 2
- 102100030917 Zinc finger protein SNAI1 Human genes 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 230000007815 allergy Effects 0.000 description 2
- 238000003277 amino acid sequence analysis Methods 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 230000001363 autoimmune Effects 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 230000024203 complement activation Effects 0.000 description 2
- 230000004154 complement system Effects 0.000 description 2
- 210000004748 cultured cell Anatomy 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 230000007123 defense Effects 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 230000012202 endocytosis Effects 0.000 description 2
- 210000003979 eosinophil Anatomy 0.000 description 2
- 108010002591 epsilon receptor Proteins 0.000 description 2
- 230000029142 excretion Effects 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 230000009610 hypersensitivity Effects 0.000 description 2
- 239000012642 immune effector Substances 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 230000028709 inflammatory response Effects 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 108020001756 ligand binding domains Proteins 0.000 description 2
- 210000000207 lymphocyte subset Anatomy 0.000 description 2
- 239000004325 lysozyme Substances 0.000 description 2
- 229960000274 lysozyme Drugs 0.000 description 2
- 235000010335 lysozyme Nutrition 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 210000003584 mesangial cell Anatomy 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 102000051367 mu Opioid Receptors Human genes 0.000 description 2
- 230000009871 nonspecific binding Effects 0.000 description 2
- 230000014207 opsonization Effects 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000002688 persistence Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 2
- 230000006461 physiological response Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 229960004641 rituximab Drugs 0.000 description 2
- 238000007480 sanger sequencing Methods 0.000 description 2
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- 230000035939 shock Effects 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 229940032147 starch Drugs 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000031998 transcytosis Effects 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 230000001960 triggered effect Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 108020001612 μ-opioid receptors Proteins 0.000 description 2
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 1
- 102100027832 14-3-3 protein gamma Human genes 0.000 description 1
- 102100027831 14-3-3 protein theta Human genes 0.000 description 1
- 102100040685 14-3-3 protein zeta/delta Human genes 0.000 description 1
- QTWJRLJHJPIABL-UHFFFAOYSA-N 2-methylphenol;3-methylphenol;4-methylphenol Chemical compound CC1=CC=C(O)C=C1.CC1=CC=CC(O)=C1.CC1=CC=CC=C1O QTWJRLJHJPIABL-UHFFFAOYSA-N 0.000 description 1
- 102100033793 ALK tyrosine kinase receptor Human genes 0.000 description 1
- 102100038511 AT-rich interactive domain-containing protein 3A Human genes 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 102100022142 Achaete-scute homolog 1 Human genes 0.000 description 1
- 108010051457 Acid Phosphatase Proteins 0.000 description 1
- 102000013563 Acid Phosphatase Human genes 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 102100029374 Adapter molecule crk Human genes 0.000 description 1
- 108010080691 Alcohol O-acetyltransferase Proteins 0.000 description 1
- 102100040069 Aldehyde dehydrogenase 1A1 Human genes 0.000 description 1
- 102100033658 Alpha-globin transcription factor CP2 Human genes 0.000 description 1
- 102100027308 Apoptosis regulator BAX Human genes 0.000 description 1
- 108050006685 Apoptosis regulator BAX Proteins 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 102100028449 Arginine-glutamic acid dipeptide repeats protein Human genes 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 102100022976 B-cell lymphoma/leukemia 11A Human genes 0.000 description 1
- 101700002522 BARD1 Proteins 0.000 description 1
- 108091012583 BCL2 Proteins 0.000 description 1
- 108091007065 BIRCs Proteins 0.000 description 1
- 102100028048 BRCA1-associated RING domain protein 1 Human genes 0.000 description 1
- 241000194110 Bacillus sp. (in: Bacteria) Species 0.000 description 1
- 108700003785 Baculoviral IAP Repeat-Containing 3 Proteins 0.000 description 1
- 102100021677 Baculoviral IAP repeat-containing protein 2 Human genes 0.000 description 1
- 102100021662 Baculoviral IAP repeat-containing protein 3 Human genes 0.000 description 1
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 1
- 102100026596 Bcl-2-like protein 1 Human genes 0.000 description 1
- 102100021894 Bcl-2-like protein 12 Human genes 0.000 description 1
- 102100021334 Bcl-2-related protein A1 Human genes 0.000 description 1
- 101150008012 Bcl2l1 gene Proteins 0.000 description 1
- 101150104237 Birc3 gene Proteins 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 102100022544 Bone morphogenetic protein 7 Human genes 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 101710098191 C-4 methylsterol oxidase ERG25 Proteins 0.000 description 1
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 description 1
- 102100021411 C-terminal-binding protein 2 Human genes 0.000 description 1
- 102100025752 CASP8 and FADD-like apoptosis regulator Human genes 0.000 description 1
- 102100031168 CCN family member 2 Human genes 0.000 description 1
- 108010083123 CDX2 Transcription Factor Proteins 0.000 description 1
- 108091011896 CSF1 Proteins 0.000 description 1
- 101100180602 Caenorhabditis elegans csnk-1 gene Proteins 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102100031118 Catenin delta-2 Human genes 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 108091007854 Cdh1/Fizzy-related Proteins 0.000 description 1
- 102100032860 Cell division cycle 5-like protein Human genes 0.000 description 1
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 241000288673 Chiroptera Species 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 244000180278 Copernicia prunifera Species 0.000 description 1
- 235000010919 Copernicia prunifera Nutrition 0.000 description 1
- 108010043471 Core Binding Factor Alpha 2 Subunit Proteins 0.000 description 1
- 108010079362 Core Binding Factor Alpha 3 Subunit Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 102100028907 Cullin-4A Human genes 0.000 description 1
- 102100026359 Cyclic AMP-responsive element-binding protein 1 Human genes 0.000 description 1
- 108010016788 Cyclin-Dependent Kinase Inhibitor p21 Proteins 0.000 description 1
- 102100024456 Cyclin-dependent kinase 8 Human genes 0.000 description 1
- 102100033270 Cyclin-dependent kinase inhibitor 1 Human genes 0.000 description 1
- 108010076010 Cystathionine beta-lyase Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 101150077031 DAXX gene Proteins 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 102100037799 DNA-binding protein Ikaros Human genes 0.000 description 1
- 102100032881 DNA-binding protein SATB1 Human genes 0.000 description 1
- 102100027642 DNA-binding protein inhibitor ID-2 Human genes 0.000 description 1
- 102100028559 Death domain-associated protein 6 Human genes 0.000 description 1
- 102100031262 Deleted in malignant brain tumors 1 protein Human genes 0.000 description 1
- 102100035813 E3 ubiquitin-protein ligase CBL Human genes 0.000 description 1
- 101150076616 EPHA2 gene Proteins 0.000 description 1
- 102100032057 ETS domain-containing protein Elk-1 Human genes 0.000 description 1
- 102100039563 ETS translocation variant 1 Human genes 0.000 description 1
- 102100039562 ETS translocation variant 3 Human genes 0.000 description 1
- 102100039578 ETS translocation variant 4 Human genes 0.000 description 1
- 102100039247 ETS-related transcription factor Elf-4 Human genes 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 208000001976 Endocrine Gland Neoplasms Diseases 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 108700041152 Endoplasmic Reticulum Chaperone BiP Proteins 0.000 description 1
- 102100021451 Endoplasmic reticulum chaperone BiP Human genes 0.000 description 1
- 102100036448 Endothelial PAS domain-containing protein 1 Human genes 0.000 description 1
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 101000823089 Equus caballus Alpha-1-antiproteinase 1 Proteins 0.000 description 1
- 102100031690 Erythroid transcription factor Human genes 0.000 description 1
- 241000488157 Escherichia sp. Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 101150026630 FOXG1 gene Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102100026170 Fez family zinc finger protein 1 Human genes 0.000 description 1
- 102100028072 Fibroblast growth factor 4 Human genes 0.000 description 1
- 102100028075 Fibroblast growth factor 6 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 102100040859 Fizzy-related protein homolog Human genes 0.000 description 1
- 108010008599 Forkhead Box Protein M1 Proteins 0.000 description 1
- 102100020871 Forkhead box protein G1 Human genes 0.000 description 1
- 102100023374 Forkhead box protein M1 Human genes 0.000 description 1
- 102100028122 Forkhead box protein P1 Human genes 0.000 description 1
- 102100027570 Forkhead box protein Q1 Human genes 0.000 description 1
- 108090000123 Fos-related antigen 1 Proteins 0.000 description 1
- 102000003817 Fos-related antigen 1 Human genes 0.000 description 1
- 102100039788 GTPase NRas Human genes 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 101001077417 Gallus gallus Potassium voltage-gated channel subfamily H member 6 Proteins 0.000 description 1
- 102100033295 Glial cell line-derived neurotrophic factor Human genes 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 108700039143 HMGA2 Proteins 0.000 description 1
- 101150112743 HSPA5 gene Proteins 0.000 description 1
- 102100035961 Hematopoietically-expressed homeobox protein HHEX Human genes 0.000 description 1
- 102100029283 Hepatocyte nuclear factor 3-alpha Human genes 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100029009 High mobility group protein HMG-I/HMG-Y Human genes 0.000 description 1
- 102100028999 High mobility group protein HMGI-C Human genes 0.000 description 1
- 102100033071 Histone acetyltransferase KAT6A Human genes 0.000 description 1
- 102100039996 Histone deacetylase 1 Human genes 0.000 description 1
- 102100024594 Histone-lysine N-methyltransferase PRDM16 Human genes 0.000 description 1
- 102100029144 Histone-lysine N-methyltransferase PRDM9 Human genes 0.000 description 1
- 101150073387 Hmga2 gene Proteins 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 102100031671 Homeobox protein CDX-2 Human genes 0.000 description 1
- 102100022373 Homeobox protein DLX-5 Human genes 0.000 description 1
- 102100030309 Homeobox protein Hox-A1 Human genes 0.000 description 1
- 102100021090 Homeobox protein Hox-A9 Human genes 0.000 description 1
- 102100040227 Homeobox protein Hox-D13 Human genes 0.000 description 1
- 102100034864 Homeobox protein Hox-D9 Human genes 0.000 description 1
- 102100027893 Homeobox protein Nkx-2.1 Human genes 0.000 description 1
- 102100030634 Homeobox protein OTX2 Human genes 0.000 description 1
- 102100029279 Homeobox protein SIX1 Human genes 0.000 description 1
- 102100030234 Homeobox protein cut-like 1 Human genes 0.000 description 1
- 102100027695 Homeobox protein engrailed-2 Human genes 0.000 description 1
- 101000723517 Homo sapiens 14-3-3 protein gamma Proteins 0.000 description 1
- 101000723543 Homo sapiens 14-3-3 protein theta Proteins 0.000 description 1
- 101000964898 Homo sapiens 14-3-3 protein zeta/delta Proteins 0.000 description 1
- 101000779641 Homo sapiens ALK tyrosine kinase receptor Proteins 0.000 description 1
- 101000808887 Homo sapiens AT-rich interactive domain-containing protein 3A Proteins 0.000 description 1
- 101000901099 Homo sapiens Achaete-scute homolog 1 Proteins 0.000 description 1
- 101000919320 Homo sapiens Adapter molecule crk Proteins 0.000 description 1
- 101000890570 Homo sapiens Aldehyde dehydrogenase 1A1 Proteins 0.000 description 1
- 101000800875 Homo sapiens Alpha-globin transcription factor CP2 Proteins 0.000 description 1
- 101001061654 Homo sapiens Arginine-glutamic acid dipeptide repeats protein Proteins 0.000 description 1
- 101000903703 Homo sapiens B-cell lymphoma/leukemia 11A Proteins 0.000 description 1
- 101000971073 Homo sapiens Bcl-2-like protein 12 Proteins 0.000 description 1
- 101000894929 Homo sapiens Bcl-2-related protein A1 Proteins 0.000 description 1
- 101000899361 Homo sapiens Bone morphogenetic protein 7 Proteins 0.000 description 1
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 description 1
- 101000914211 Homo sapiens CASP8 and FADD-like apoptosis regulator Proteins 0.000 description 1
- 101000777550 Homo sapiens CCN family member 2 Proteins 0.000 description 1
- 101000875075 Homo sapiens Cannabinoid receptor 2 Proteins 0.000 description 1
- 101000922056 Homo sapiens Catenin delta-2 Proteins 0.000 description 1
- 101000868318 Homo sapiens Cell division cycle 5-like protein Proteins 0.000 description 1
- 101000916245 Homo sapiens Cullin-4A Proteins 0.000 description 1
- 101000855516 Homo sapiens Cyclic AMP-responsive element-binding protein 1 Proteins 0.000 description 1
- 101000980937 Homo sapiens Cyclin-dependent kinase 8 Proteins 0.000 description 1
- 101000599038 Homo sapiens DNA-binding protein Ikaros Proteins 0.000 description 1
- 101000655234 Homo sapiens DNA-binding protein SATB1 Proteins 0.000 description 1
- 101001081582 Homo sapiens DNA-binding protein inhibitor ID-2 Proteins 0.000 description 1
- 101000813729 Homo sapiens ETS translocation variant 1 Proteins 0.000 description 1
- 101000813726 Homo sapiens ETS translocation variant 3 Proteins 0.000 description 1
- 101000813747 Homo sapiens ETS translocation variant 4 Proteins 0.000 description 1
- 101000813135 Homo sapiens ETS-related transcription factor Elf-4 Proteins 0.000 description 1
- 101000967216 Homo sapiens Eosinophil cationic protein Proteins 0.000 description 1
- 101001066268 Homo sapiens Erythroid transcription factor Proteins 0.000 description 1
- 101000912431 Homo sapiens Fez family zinc finger protein 1 Proteins 0.000 description 1
- 101001060274 Homo sapiens Fibroblast growth factor 4 Proteins 0.000 description 1
- 101001060265 Homo sapiens Fibroblast growth factor 6 Proteins 0.000 description 1
- 101000827688 Homo sapiens Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 101001059893 Homo sapiens Forkhead box protein P1 Proteins 0.000 description 1
- 101000861406 Homo sapiens Forkhead box protein Q1 Proteins 0.000 description 1
- 101001062996 Homo sapiens Friend leukemia integration 1 transcription factor Proteins 0.000 description 1
- 101000744505 Homo sapiens GTPase NRas Proteins 0.000 description 1
- 101001021503 Homo sapiens Hematopoietically-expressed homeobox protein HHEX Proteins 0.000 description 1
- 101001062353 Homo sapiens Hepatocyte nuclear factor 3-alpha Proteins 0.000 description 1
- 101000986380 Homo sapiens High mobility group protein HMG-I/HMG-Y Proteins 0.000 description 1
- 101000944179 Homo sapiens Histone acetyltransferase KAT6A Proteins 0.000 description 1
- 101001035024 Homo sapiens Histone deacetylase 1 Proteins 0.000 description 1
- 101000686942 Homo sapiens Histone-lysine N-methyltransferase PRDM16 Proteins 0.000 description 1
- 101001124887 Homo sapiens Histone-lysine N-methyltransferase PRDM9 Proteins 0.000 description 1
- 101000901627 Homo sapiens Homeobox protein DLX-5 Proteins 0.000 description 1
- 101001083156 Homo sapiens Homeobox protein Hox-A1 Proteins 0.000 description 1
- 101001037168 Homo sapiens Homeobox protein Hox-D13 Proteins 0.000 description 1
- 101001019766 Homo sapiens Homeobox protein Hox-D9 Proteins 0.000 description 1
- 101000632178 Homo sapiens Homeobox protein Nkx-2.1 Proteins 0.000 description 1
- 101000584400 Homo sapiens Homeobox protein OTX2 Proteins 0.000 description 1
- 101000634171 Homo sapiens Homeobox protein SIX1 Proteins 0.000 description 1
- 101000726740 Homo sapiens Homeobox protein cut-like 1 Proteins 0.000 description 1
- 101001081122 Homo sapiens Homeobox protein engrailed-2 Proteins 0.000 description 1
- 101000606465 Homo sapiens Inactive tyrosine-protein kinase 7 Proteins 0.000 description 1
- 101001056180 Homo sapiens Induced myeloid leukemia cell differentiation protein Mcl-1 Proteins 0.000 description 1
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 101001076292 Homo sapiens Insulin-like growth factor II Proteins 0.000 description 1
- 101000994378 Homo sapiens Integrin alpha-3 Proteins 0.000 description 1
- 101001002695 Homo sapiens Integrin-linked protein kinase Proteins 0.000 description 1
- 101001011393 Homo sapiens Interferon regulatory factor 2 Proteins 0.000 description 1
- 101001011441 Homo sapiens Interferon regulatory factor 4 Proteins 0.000 description 1
- 101000971533 Homo sapiens Killer cell lectin-like receptor subfamily G member 1 Proteins 0.000 description 1
- 101001139146 Homo sapiens Krueppel-like factor 2 Proteins 0.000 description 1
- 101001139134 Homo sapiens Krueppel-like factor 4 Proteins 0.000 description 1
- 101001139126 Homo sapiens Krueppel-like factor 6 Proteins 0.000 description 1
- 101000984044 Homo sapiens LIM homeobox transcription factor 1-beta Proteins 0.000 description 1
- 101001020548 Homo sapiens LIM/homeobox protein Lhx1 Proteins 0.000 description 1
- 101000972291 Homo sapiens Lymphoid enhancer-binding factor 1 Proteins 0.000 description 1
- 101000613958 Homo sapiens Lysine-specific demethylase 2A Proteins 0.000 description 1
- 101001088883 Homo sapiens Lysine-specific demethylase 5B Proteins 0.000 description 1
- 101000624625 Homo sapiens M-phase inducer phosphatase 1 Proteins 0.000 description 1
- 101100076418 Homo sapiens MECOM gene Proteins 0.000 description 1
- 101001106413 Homo sapiens Macrophage-stimulating protein receptor Proteins 0.000 description 1
- 101000581507 Homo sapiens Methyl-CpG-binding domain protein 1 Proteins 0.000 description 1
- 101001055092 Homo sapiens Mitogen-activated protein kinase kinase kinase 7 Proteins 0.000 description 1
- 101000973211 Homo sapiens Nuclear factor 1 B-type Proteins 0.000 description 1
- 101000974356 Homo sapiens Nuclear receptor coactivator 3 Proteins 0.000 description 1
- 101001109719 Homo sapiens Nucleophosmin Proteins 0.000 description 1
- 101001072590 Homo sapiens POZ-, AT hook-, and zinc finger-containing protein 1 Proteins 0.000 description 1
- 101001123306 Homo sapiens PR domain zinc finger protein 10 Proteins 0.000 description 1
- 101001123300 Homo sapiens PR domain zinc finger protein 13 Proteins 0.000 description 1
- 101001123298 Homo sapiens PR domain zinc finger protein 14 Proteins 0.000 description 1
- 101001123296 Homo sapiens PR domain zinc finger protein 15 Proteins 0.000 description 1
- 101001124900 Homo sapiens PR domain zinc finger protein 8 Proteins 0.000 description 1
- 101000613577 Homo sapiens Paired box protein Pax-2 Proteins 0.000 description 1
- 101000613490 Homo sapiens Paired box protein Pax-3 Proteins 0.000 description 1
- 101000613495 Homo sapiens Paired box protein Pax-4 Proteins 0.000 description 1
- 101000601664 Homo sapiens Paired box protein Pax-8 Proteins 0.000 description 1
- 101000741790 Homo sapiens Peroxisome proliferator-activated receptor gamma Proteins 0.000 description 1
- 101000595669 Homo sapiens Pituitary homeobox 2 Proteins 0.000 description 1
- 101001126085 Homo sapiens Piwi-like protein 1 Proteins 0.000 description 1
- 101001067174 Homo sapiens Plexin-B1 Proteins 0.000 description 1
- 101000872170 Homo sapiens Polycomb complex protein BMI-1 Proteins 0.000 description 1
- 101000610107 Homo sapiens Pre-B-cell leukemia transcription factor 1 Proteins 0.000 description 1
- 101000610110 Homo sapiens Pre-B-cell leukemia transcription factor 2 Proteins 0.000 description 1
- 101000983170 Homo sapiens Proliferation-associated protein 2G4 Proteins 0.000 description 1
- 101000898093 Homo sapiens Protein C-ets-2 Proteins 0.000 description 1
- 101000761460 Homo sapiens Protein CASP Proteins 0.000 description 1
- 101000585703 Homo sapiens Protein L-Myc Proteins 0.000 description 1
- 101000573199 Homo sapiens Protein PML Proteins 0.000 description 1
- 101000861454 Homo sapiens Protein c-Fos Proteins 0.000 description 1
- 101000893493 Homo sapiens Protein flightless-1 homolog Proteins 0.000 description 1
- 101001051777 Homo sapiens Protein kinase C alpha type Proteins 0.000 description 1
- 101001026852 Homo sapiens Protein kinase C epsilon type Proteins 0.000 description 1
- 101000971404 Homo sapiens Protein kinase C iota type Proteins 0.000 description 1
- 101000688345 Homo sapiens Protein phosphatase 1 regulatory subunit 14A Proteins 0.000 description 1
- 101000702384 Homo sapiens Protein sprouty homolog 2 Proteins 0.000 description 1
- 101000686031 Homo sapiens Proto-oncogene tyrosine-protein kinase ROS Proteins 0.000 description 1
- 101000579425 Homo sapiens Proto-oncogene tyrosine-protein kinase receptor Ret Proteins 0.000 description 1
- 101001116931 Homo sapiens Protocadherin alpha-6 Proteins 0.000 description 1
- 101001124901 Homo sapiens Putative histone-lysine N-methyltransferase PRDM6 Proteins 0.000 description 1
- 101000712530 Homo sapiens RAF proto-oncogene serine/threonine-protein kinase Proteins 0.000 description 1
- 101000599843 Homo sapiens RelA-associated inhibitor Proteins 0.000 description 1
- 101000669917 Homo sapiens Rho-associated protein kinase 1 Proteins 0.000 description 1
- 101000581118 Homo sapiens Rho-related GTP-binding protein RhoC Proteins 0.000 description 1
- 101000664418 Homo sapiens Secreted Ly-6/uPAR-related protein 1 Proteins 0.000 description 1
- 101000851593 Homo sapiens Separin Proteins 0.000 description 1
- 101000644537 Homo sapiens Sequestosome-1 Proteins 0.000 description 1
- 101000587434 Homo sapiens Serine/arginine-rich splicing factor 3 Proteins 0.000 description 1
- 101000829367 Homo sapiens Src substrate cortactin Proteins 0.000 description 1
- 101000629597 Homo sapiens Sterol regulatory element-binding protein 1 Proteins 0.000 description 1
- 101000666775 Homo sapiens T-box transcription factor TBX3 Proteins 0.000 description 1
- 101000891113 Homo sapiens T-cell acute lymphocytic leukemia protein 1 Proteins 0.000 description 1
- 101000625330 Homo sapiens T-cell acute lymphocytic leukemia protein 2 Proteins 0.000 description 1
- 101000800488 Homo sapiens T-cell leukemia homeobox protein 1 Proteins 0.000 description 1
- 101000595737 Homo sapiens TBC1 domain family member 3C Proteins 0.000 description 1
- 101000837626 Homo sapiens Thyroid hormone receptor alpha Proteins 0.000 description 1
- 101000837845 Homo sapiens Transcription factor E3 Proteins 0.000 description 1
- 101000813738 Homo sapiens Transcription factor ETV6 Proteins 0.000 description 1
- 101000819088 Homo sapiens Transcription factor GATA-6 Proteins 0.000 description 1
- 101000962461 Homo sapiens Transcription factor Maf Proteins 0.000 description 1
- 101000979205 Homo sapiens Transcription factor MafA Proteins 0.000 description 1
- 101000979190 Homo sapiens Transcription factor MafB Proteins 0.000 description 1
- 101000651211 Homo sapiens Transcription factor PU.1 Proteins 0.000 description 1
- 101000687905 Homo sapiens Transcription factor SOX-2 Proteins 0.000 description 1
- 101000642514 Homo sapiens Transcription factor SOX-4 Proteins 0.000 description 1
- 101000596093 Homo sapiens Transcription initiation factor TFIID subunit 1 Proteins 0.000 description 1
- 101000636213 Homo sapiens Transcriptional activator Myb Proteins 0.000 description 1
- 101001010792 Homo sapiens Transcriptional regulator ERG Proteins 0.000 description 1
- 101000635938 Homo sapiens Transforming growth factor beta-1 proprotein Proteins 0.000 description 1
- 101000801232 Homo sapiens Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 101000823271 Homo sapiens Tyrosine-protein kinase ABL2 Proteins 0.000 description 1
- 101000984551 Homo sapiens Tyrosine-protein kinase Blk Proteins 0.000 description 1
- 101001026790 Homo sapiens Tyrosine-protein kinase Fes/Fps Proteins 0.000 description 1
- 101000912503 Homo sapiens Tyrosine-protein kinase Fgr Proteins 0.000 description 1
- 101001050476 Homo sapiens Tyrosine-protein kinase ITK/TSK Proteins 0.000 description 1
- 101000997835 Homo sapiens Tyrosine-protein kinase JAK1 Proteins 0.000 description 1
- 101000604583 Homo sapiens Tyrosine-protein kinase SYK Proteins 0.000 description 1
- 101000889732 Homo sapiens Tyrosine-protein kinase Tec Proteins 0.000 description 1
- 101000820294 Homo sapiens Tyrosine-protein kinase Yes Proteins 0.000 description 1
- 101000807561 Homo sapiens Tyrosine-protein kinase receptor UFO Proteins 0.000 description 1
- 101001087416 Homo sapiens Tyrosine-protein phosphatase non-receptor type 11 Proteins 0.000 description 1
- 101000803403 Homo sapiens Vimentin Proteins 0.000 description 1
- 101000854951 Homo sapiens Wings apart-like protein homolog Proteins 0.000 description 1
- 101000782132 Homo sapiens Zinc finger protein 217 Proteins 0.000 description 1
- 101000785650 Homo sapiens Zinc finger protein 268 Proteins 0.000 description 1
- 101001059220 Homo sapiens Zinc finger protein Gfi-1 Proteins 0.000 description 1
- 101000856554 Homo sapiens Zinc finger protein Gfi-1b Proteins 0.000 description 1
- 101000691578 Homo sapiens Zinc finger protein PLAG1 Proteins 0.000 description 1
- 101000730644 Homo sapiens Zinc finger protein PLAGL2 Proteins 0.000 description 1
- 101000976643 Homo sapiens Zinc finger protein ZIC 2 Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 102100039813 Inactive tyrosine-protein kinase 7 Human genes 0.000 description 1
- 102100026539 Induced myeloid leukemia cell differentiation protein Mcl-1 Human genes 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 102100025947 Insulin-like growth factor II Human genes 0.000 description 1
- 102100032819 Integrin alpha-3 Human genes 0.000 description 1
- 102100020944 Integrin-linked protein kinase Human genes 0.000 description 1
- 102100029838 Interferon regulatory factor 2 Human genes 0.000 description 1
- 102100030126 Interferon regulatory factor 4 Human genes 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 102100020675 Krueppel-like factor 2 Human genes 0.000 description 1
- 102100020677 Krueppel-like factor 4 Human genes 0.000 description 1
- 102100020679 Krueppel-like factor 6 Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 102100025457 LIM homeobox transcription factor 1-beta Human genes 0.000 description 1
- 102100036133 LIM/homeobox protein Lhx1 Human genes 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 102100022699 Lymphoid enhancer-binding factor 1 Human genes 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102100040598 Lysine-specific demethylase 2A Human genes 0.000 description 1
- 102100033247 Lysine-specific demethylase 5B Human genes 0.000 description 1
- 102100023326 M-phase inducer phosphatase 1 Human genes 0.000 description 1
- 102000046015 MDS1 and EVI1 Complex Locus Human genes 0.000 description 1
- 108700024831 MDS1 and EVI1 Complex Locus Proteins 0.000 description 1
- 108010018650 MEF2 Transcription Factors Proteins 0.000 description 1
- 101150029107 MEIS1 gene Proteins 0.000 description 1
- 108700012912 MYCN Proteins 0.000 description 1
- 101150022024 MYCN gene Proteins 0.000 description 1
- 102100028123 Macrophage colony-stimulating factor 1 Human genes 0.000 description 1
- 102100021435 Macrophage-stimulating protein receptor Human genes 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 239000005913 Maltodextrin Substances 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102100027383 Methyl-CpG-binding domain protein 1 Human genes 0.000 description 1
- 108010050345 Microphthalmia-Associated Transcription Factor Proteins 0.000 description 1
- 102100030157 Microphthalmia-associated transcription factor Human genes 0.000 description 1
- 102100026888 Mitogen-activated protein kinase kinase kinase 7 Human genes 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108700041619 Myeloid Ecotropic Viral Integration Site 1 Proteins 0.000 description 1
- 102000047831 Myeloid Ecotropic Viral Integration Site 1 Human genes 0.000 description 1
- 102100039229 Myocyte-specific enhancer factor 2C Human genes 0.000 description 1
- 108700026495 N-Myc Proto-Oncogene Proteins 0.000 description 1
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinyl-2-pyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 1
- 102100030124 N-myc proto-oncogene protein Human genes 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 102100029166 NT-3 growth factor receptor Human genes 0.000 description 1
- 102100023181 Neurogenic locus notch homolog protein 1 Human genes 0.000 description 1
- 102100022165 Nuclear factor 1 B-type Human genes 0.000 description 1
- 102100022883 Nuclear receptor coactivator 3 Human genes 0.000 description 1
- 102100022673 Nuclear receptor subfamily 4 group A member 3 Human genes 0.000 description 1
- 102100022678 Nucleophosmin Human genes 0.000 description 1
- 108010079246 OMPA outer membrane proteins Proteins 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 101700056750 PAK1 Proteins 0.000 description 1
- 102100036665 POZ-, AT hook-, and zinc finger-containing protein 1 Human genes 0.000 description 1
- 102100028955 PR domain zinc finger protein 10 Human genes 0.000 description 1
- 102100028973 PR domain zinc finger protein 13 Human genes 0.000 description 1
- 102100028974 PR domain zinc finger protein 14 Human genes 0.000 description 1
- 102100028975 PR domain zinc finger protein 15 Human genes 0.000 description 1
- 102100029128 PR domain zinc finger protein 8 Human genes 0.000 description 1
- 102100040852 Paired box protein Pax-2 Human genes 0.000 description 1
- 102100040891 Paired box protein Pax-3 Human genes 0.000 description 1
- 102100040909 Paired box protein Pax-4 Human genes 0.000 description 1
- 102100037502 Paired box protein Pax-8 Human genes 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 108010065129 Patched-1 Receptor Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 102100038825 Peroxisome proliferator-activated receptor gamma Human genes 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 201000005746 Pituitary adenoma Diseases 0.000 description 1
- 102100036090 Pituitary homeobox 2 Human genes 0.000 description 1
- 206010061538 Pituitary tumour benign Diseases 0.000 description 1
- 102100029364 Piwi-like protein 1 Human genes 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 102100040990 Platelet-derived growth factor subunit B Human genes 0.000 description 1
- 102100034384 Plexin-B1 Human genes 0.000 description 1
- 102100033566 Polycomb complex protein BMI-1 Human genes 0.000 description 1
- 101710163352 Potassium voltage-gated channel subfamily H member 4 Proteins 0.000 description 1
- 101710163348 Potassium voltage-gated channel subfamily H member 8 Proteins 0.000 description 1
- 102100025073 Potassium voltage-gated channel subfamily H member 8 Human genes 0.000 description 1
- 102100040171 Pre-B-cell leukemia transcription factor 1 Human genes 0.000 description 1
- 102100040168 Pre-B-cell leukemia transcription factor 2 Human genes 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 102100026899 Proliferation-associated protein 2G4 Human genes 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102100021890 Protein C-ets-2 Human genes 0.000 description 1
- 102100030128 Protein L-Myc Human genes 0.000 description 1
- 102100026375 Protein PML Human genes 0.000 description 1
- 102100027584 Protein c-Fos Human genes 0.000 description 1
- 102100040923 Protein flightless-1 homolog Human genes 0.000 description 1
- 102100024924 Protein kinase C alpha type Human genes 0.000 description 1
- 102100037339 Protein kinase C epsilon type Human genes 0.000 description 1
- 102100021557 Protein kinase C iota type Human genes 0.000 description 1
- 102100028680 Protein patched homolog 1 Human genes 0.000 description 1
- 102100036894 Protein patched homolog 2 Human genes 0.000 description 1
- 102100024147 Protein phosphatase 1 regulatory subunit 14A Human genes 0.000 description 1
- 102100030400 Protein sprouty homolog 2 Human genes 0.000 description 1
- 108010019674 Proto-Oncogene Proteins c-sis Proteins 0.000 description 1
- 102000015925 Proto-oncogene Mas Human genes 0.000 description 1
- 102100040101 Proto-oncogene serine/threonine-protein kinase mos Human genes 0.000 description 1
- 102100023347 Proto-oncogene tyrosine-protein kinase ROS Human genes 0.000 description 1
- 102100028286 Proto-oncogene tyrosine-protein kinase receptor Ret Human genes 0.000 description 1
- 102100024278 Protocadherin alpha-6 Human genes 0.000 description 1
- 102100029134 Putative histone-lysine N-methyltransferase PRDM6 Human genes 0.000 description 1
- 102100033479 RAF proto-oncogene serine/threonine-protein kinase Human genes 0.000 description 1
- 102100022122 Ras-related C3 botulinum toxin substrate 1 Human genes 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101000613608 Rattus norvegicus Monocyte to macrophage differentiation factor Proteins 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 102100037875 RelA-associated inhibitor Human genes 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 102100039313 Rho-associated protein kinase 1 Human genes 0.000 description 1
- 102100027610 Rho-related GTP-binding protein RhoC Human genes 0.000 description 1
- 102100025373 Runt-related transcription factor 1 Human genes 0.000 description 1
- 102100025369 Runt-related transcription factor 3 Human genes 0.000 description 1
- 108010017324 STAT3 Transcription Factor Proteins 0.000 description 1
- 101150014136 SUC2 gene Proteins 0.000 description 1
- 101100379220 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) API2 gene Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 108010077895 Sarcosine Proteins 0.000 description 1
- 101000702553 Schistosoma mansoni Antigen Sm21.7 Proteins 0.000 description 1
- 101000714192 Schistosoma mansoni Tegument antigen Proteins 0.000 description 1
- 102100038583 Secreted Ly-6/uPAR-related protein 1 Human genes 0.000 description 1
- 102100036750 Separin Human genes 0.000 description 1
- 102100020814 Sequestosome-1 Human genes 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 102100029665 Serine/arginine-rich splicing factor 3 Human genes 0.000 description 1
- 102100027910 Serine/threonine-protein kinase PAK 1 Human genes 0.000 description 1
- 102100024040 Signal transducer and activator of transcription 3 Human genes 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 102000013380 Smoothened Receptor Human genes 0.000 description 1
- 101710090597 Smoothened homolog Proteins 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 102100023719 Src substrate cortactin Human genes 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 102100026839 Sterol regulatory element-binding protein 1 Human genes 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 108090000787 Subtilisin Proteins 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 108010002687 Survivin Proteins 0.000 description 1
- 108010029625 T-Box Domain Protein 2 Proteins 0.000 description 1
- 102100038721 T-box transcription factor TBX2 Human genes 0.000 description 1
- 102100038409 T-box transcription factor TBX3 Human genes 0.000 description 1
- 102100040365 T-cell acute lymphocytic leukemia protein 1 Human genes 0.000 description 1
- 102100025039 T-cell acute lymphocytic leukemia protein 2 Human genes 0.000 description 1
- 102100033111 T-cell leukemia homeobox protein 1 Human genes 0.000 description 1
- 102100036058 TBC1 domain family member 3C Human genes 0.000 description 1
- 102000003714 TNF receptor-associated factor 6 Human genes 0.000 description 1
- 108090000009 TNF receptor-associated factor 6 Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102100028702 Thyroid hormone receptor alpha Human genes 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 102100028507 Transcription factor E3 Human genes 0.000 description 1
- 102100039580 Transcription factor ETV6 Human genes 0.000 description 1
- 102100021382 Transcription factor GATA-6 Human genes 0.000 description 1
- 102100039189 Transcription factor Maf Human genes 0.000 description 1
- 102100023237 Transcription factor MafA Human genes 0.000 description 1
- 102100023234 Transcription factor MafB Human genes 0.000 description 1
- 102100027654 Transcription factor PU.1 Human genes 0.000 description 1
- 102100024270 Transcription factor SOX-2 Human genes 0.000 description 1
- 102100036693 Transcription factor SOX-4 Human genes 0.000 description 1
- 102100035222 Transcription initiation factor TFIID subunit 1 Human genes 0.000 description 1
- 102100030780 Transcriptional activator Myb Human genes 0.000 description 1
- 102100029983 Transcriptional regulator ERG Human genes 0.000 description 1
- 102100030742 Transforming growth factor beta-1 proprotein Human genes 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108010091356 Tumor Protein p73 Proteins 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 102100027881 Tumor protein 63 Human genes 0.000 description 1
- 101710140697 Tumor protein 63 Proteins 0.000 description 1
- 102100030018 Tumor protein p73 Human genes 0.000 description 1
- 108010083162 Twist-Related Protein 1 Proteins 0.000 description 1
- 102100030398 Twist-related protein 1 Human genes 0.000 description 1
- 102100022651 Tyrosine-protein kinase ABL2 Human genes 0.000 description 1
- 102100027053 Tyrosine-protein kinase Blk Human genes 0.000 description 1
- 102100037333 Tyrosine-protein kinase Fes/Fps Human genes 0.000 description 1
- 102100026150 Tyrosine-protein kinase Fgr Human genes 0.000 description 1
- 102100023345 Tyrosine-protein kinase ITK/TSK Human genes 0.000 description 1
- 102100033438 Tyrosine-protein kinase JAK1 Human genes 0.000 description 1
- 102100038183 Tyrosine-protein kinase SYK Human genes 0.000 description 1
- 102100021788 Tyrosine-protein kinase Yes Human genes 0.000 description 1
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 description 1
- 102100033019 Tyrosine-protein phosphatase non-receptor type 11 Human genes 0.000 description 1
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 1
- 206010046392 Ureteric cancer Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 201000003761 Vaginal carcinoma Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 102100035071 Vimentin Human genes 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 102100020735 Wings apart-like protein homolog Human genes 0.000 description 1
- 102000033021 YBX1 Human genes 0.000 description 1
- 108091002437 YBX1 Proteins 0.000 description 1
- 102100036595 Zinc finger protein 217 Human genes 0.000 description 1
- 102100026516 Zinc finger protein 268 Human genes 0.000 description 1
- 102100029004 Zinc finger protein Gfi-1 Human genes 0.000 description 1
- 102100025531 Zinc finger protein Gfi-1b Human genes 0.000 description 1
- 102100026200 Zinc finger protein PLAG1 Human genes 0.000 description 1
- 102100032571 Zinc finger protein PLAGL2 Human genes 0.000 description 1
- 102100023492 Zinc finger protein ZIC 2 Human genes 0.000 description 1
- YKTSYUJCYHOUJP-UHFFFAOYSA-N [O--].[Al+3].[Al+3].[O-][Si]([O-])([O-])[O-] Chemical compound [O--].[Al+3].[Al+3].[O-][Si]([O-])([O-])[O-] YKTSYUJCYHOUJP-UHFFFAOYSA-N 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 201000005188 adrenal gland cancer Diseases 0.000 description 1
- 208000024447 adrenal gland neoplasm Diseases 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 102000004139 alpha-Amylases Human genes 0.000 description 1
- 108090000637 alpha-Amylases Proteins 0.000 description 1
- 229940024171 alpha-amylase Drugs 0.000 description 1
- CEGOLXSVJUTHNZ-UHFFFAOYSA-K aluminium tristearate Chemical compound [Al+3].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CEGOLXSVJUTHNZ-UHFFFAOYSA-K 0.000 description 1
- 229940063655 aluminum stearate Drugs 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 229940124691 antibody therapeutics Drugs 0.000 description 1
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 108700000711 bcl-X Proteins 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000003124 biologic agent Substances 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- 102000002717 c-Mer Tyrosine Kinase Human genes 0.000 description 1
- 108010018804 c-Mer Tyrosine Kinase Proteins 0.000 description 1
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 201000007455 central nervous system cancer Diseases 0.000 description 1
- 208000025997 central nervous system neoplasm Diseases 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000024207 chronic leukemia Diseases 0.000 description 1
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- 229930003836 cresol Natural products 0.000 description 1
- 229940013361 cresol Drugs 0.000 description 1
- 101150052649 ctbp2 gene Proteins 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- GVJHHUAWPYXKBD-UHFFFAOYSA-N d-alpha-tocopherol Natural products OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 235000019700 dicalcium phosphate Nutrition 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 201000011523 endocrine gland cancer Diseases 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 108010018033 endothelial PAS domain-containing protein 1 Proteins 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 201000001343 fallopian tube carcinoma Diseases 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 108010027263 homeobox protein HOXA9 Proteins 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- OGQSCIYDJSNCMY-UHFFFAOYSA-H iron(3+);methyl-dioxido-oxo-$l^{5}-arsane Chemical compound [Fe+3].[Fe+3].C[As]([O-])([O-])=O.C[As]([O-])([O-])=O.C[As]([O-])([O-])=O OGQSCIYDJSNCMY-UHFFFAOYSA-H 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 229960001375 lactose Drugs 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 208000029559 malignant endocrine neoplasm Diseases 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 208000026037 malignant tumor of neck Diseases 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- 229940035034 maltodextrin Drugs 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- PDTFCHSETJBPTR-UHFFFAOYSA-N phenylmercuric nitrate Chemical compound [O-][N+](=O)O[Hg]C1=CC=CC=C1 PDTFCHSETJBPTR-UHFFFAOYSA-N 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 208000021310 pituitary gland adenoma Diseases 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 229940069328 povidone Drugs 0.000 description 1
- 235000019814 powdered cellulose Nutrition 0.000 description 1
- 229920003124 powdered cellulose Polymers 0.000 description 1
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 230000009993 protective function Effects 0.000 description 1
- 108010062302 rac1 GTP Binding Protein Proteins 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000007727 signaling mechanism Effects 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000002314 small intestine cancer Diseases 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 1
- 229940079827 sodium hydrogen sulfite Drugs 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 235000010262 sodium metabisulphite Nutrition 0.000 description 1
- 229920003109 sodium starch glycolate Polymers 0.000 description 1
- 229940079832 sodium starch glycolate Drugs 0.000 description 1
- 239000008109 sodium starch glycolate Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 206010062261 spinal cord neoplasm Diseases 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 235000010384 tocopherol Nutrition 0.000 description 1
- 229960001295 tocopherol Drugs 0.000 description 1
- 229930003799 tocopherol Natural products 0.000 description 1
- 239000011732 tocopherol Substances 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 108010064892 trkC Receptor Proteins 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 201000011294 ureter cancer Diseases 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 201000004916 vulva carcinoma Diseases 0.000 description 1
- 208000013013 vulvar carcinoma Diseases 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- GVJHHUAWPYXKBD-IEOSBIPESA-N α-tocopherol Chemical compound OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/283—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to an antibody with increased binding to human Fc alpha receptor and a technique for maximizing the mechanism of action of the antibody using the same.
- Antibodies provide a link between the humoral and cellular immune systems, where the Fab region of the antibody recognizes antigens, while the Fc portion binds to the Fc receptor (FcR), which is differentially expressed by all immune competent cells. Crosslinking of receptors by multivalent antigen/antibody complexes triggers target cell degranulation, cytolysis or phagocytosis and transcription-activation of cytokine-encoding genes (Deo, Y.M. et al., Immunol. Today 18(3) ):127-135 (1997)). An antibody binds to a cell through the Fc region by binding to an Fc receptor (FcR) on the cell by an Fc receptor binding site on the antibody Fc region.
- FcR Fc receptor
- Receptors for the Fc region of immunoglobulins are important for triggering many protective functions of monocytes, macrophages and polymorphonuclear cells.
- Receptors (Fc receptors or FcRs) for immunoglobulins on these cells have been extensively studied, and monoclonal antibodies to these receptors have been raised and shown to be therapeutically effective.
- Fc receptors or FcRs Fc receptors
- monoclonal antibodies to these receptors have been raised and shown to be therapeutically effective.
- an antibody binds to an Fc receptor on the cell surface, phagocytosis and destruction of antibody-coated particles, clearance of immune complexes, and lysis of antibody-coated target cells by killer cells (known as antibody-dependent cell-mediated cytotoxicity, or ADCC) , triggers several important and diverse biological responses, including the release of inflammatory mediators, control of placental migration and immunoglobulin production.
- ADCC antibody-dependent cell-mediated cytotoxicity
- Fc receptors specific for different classes of antibodies, including IgG (gamma receptor), IgE (epsilon receptor), IgA (alpha receptor) and IgM (mu receptor).
- IgG gamma receptor
- IgE epsilon receptor
- IgA alpha receptor
- IgM mu receptor
- the IgA receptor Fc ⁇ receptor or CD89
- ADCP antibody-dependent cellular phagocytosis
- ADCC antibody dependent cellular cytotoxicity
- Fc ⁇ receptors may cooperate with receptors for IgG on effector cells to enhance phagocytosis on target cells.
- effector functions mediated by the antibody Fc region can be divided into two categories: (1) effector functions that act after the antibody binds to the antigen (these functions include, for example, involvement in the complement cascade or Fc receptors) (FcR)-bearing cells); and (2) effector functions that operate independently of antigen binding, which functions confer persistence in circulation and the ability to migrate across cellular barriers, such as by transcytosis.
- effector functions that act after the antibody binds to the antigen include, for example, involvement in the complement cascade or Fc receptors) (FcR)-bearing cells
- effector functions that operate independently of antigen binding which functions confer persistence in circulation and the ability to migrate across cellular barriers, such as by transcytosis.
- FcR complement cascade or Fc receptors
- the Fc ⁇ receptor or CD89 is a receptor that binds to the Fc portion of IgA (Kerr, M. A. 1990, Biochem. J. 271: 285-296), mainly polymorphonuclear leukocytes (PMN), monocytes, macrophages, neutrophils and eosinophils. It is always expressed on cytotoxic immune effector cells, including (Morton, H. C., et al., 1996, Critical Reviews in Immunology 16: 423). It has also been reported that Fc ⁇ receptors are expressed on lymphocyte subpopulations (Morton, H.
- the ⁇ -chain of the human Fc ⁇ receptor is highly glycosylated and is a type I transmembrane molecule belonging to the Ig super-gene family, which also includes receptors for IgG and IgE.
- One gene located on chromosome 19 encodes a number of variously spliced isotypes of the Fc ⁇ RI alpha chain (55-110 kDa; Morton, H.
- Fc ⁇ receptors bind both antigen-bound IgA1 and IgA2, and monomeric IgA1 and IgA2 (Mazangera, R. L. et al., 1990, Biochem. J. 272: 159-165), indicating that Fc ⁇ R and Fc ⁇ RI are IgG and Fc ⁇ RI, respectively. Consistent with the saturation of the receptor with the monomeric IgA antigen in vivo in the same way as it was saturated with IgE.
- rituximab Mab-induced apoptosis has been shown to induce induction of apoptosis and complement-mediated cytolysis and ADCC (Selenko, N., et al., J. Clin. Immunol. 22 (3):124-130 (2002)).
- rituximab-induced apoptosis of lymphoma cells not only kills the cells but also promotes uptake and cross-presentation of lymphoma cell-derived peptides by antigen-presenting dendritic cells (DCs), induces the maturation of DCs, Produces specific cytotoxic T lymphocytes (CTLs).
- DCs antigen-presenting dendritic cells
- Fc receptors that are specific for different types of antibodies, including IgG (gamma receptor), IgE (epsilon receptor), IgA (alpha receptor) and IgM (mu receptor).
- IgG gamma receptor
- IgE epsilon receptor
- IgA alpha receptor
- IgM mu receptor
- the IgA receptor Fc ⁇ receptor or CD89
- ADCP antibody-dependent cellular phagocytosis
- ADCC antibody dependent cellular cytotoxicity
- Fc ⁇ receptors may cooperate with receptors for IgG on effector cells to enhance phagocytosis on target cells.
- effector functions mediated by the antibody Fc region can be divided into two categories: (1) effector functions that act after the antibody binds to the antigen (these functions include, for example, involvement in the complement cascade or Fc receptors) (FcR)-bearing cells); and (2) effector functions that operate independently of antigen binding, which functions confer persistence in circulation and the ability to migrate across cellular barriers, such as by transcytosis.
- effector functions that act after the antibody binds to the antigen include, for example, involvement in the complement cascade or Fc receptors) (FcR)-bearing cells
- effector functions that operate independently of antigen binding which functions confer persistence in circulation and the ability to migrate across cellular barriers, such as by transcytosis.
- FcR complement cascade or Fc receptors
- the Fc ⁇ receptor or CD89 is a receptor that binds to the Fc portion of IgA (Kerr, M. A. 1990, Biochem. J. 271: 285-296), mainly polymorphonuclear leukocytes (PMN), monocytes, macrophages, neutrophils and eosinophils. It is always expressed on cytotoxic immune effector cells, including (Morton, H. C., et al., 1996, Critical Reviews in Immunology 16: 423). It has also been reported that Fc ⁇ receptors are expressed on lymphocyte subpopulations (Morton, H.
- the ⁇ -chain of the human Fc ⁇ receptor is highly glycosylated and is a type I transmembrane molecule belonging to the Ig super-gene family, which also includes receptors for IgG and IgE.
- One gene located on chromosome 19 encodes a number of variously spliced isotypes of the Fc ⁇ RI alpha chain (55-110 kDa; Morton, H.
- Fc ⁇ receptors bind both antigen-bound IgA1 and IgA2, and monomeric IgA1 and IgA2 (Mazangera, R. L. et al., 1990, Biochem. J. 272: 159-165), indicating that Fc ⁇ R and Fc ⁇ RI are IgG and Fc ⁇ RI, respectively. Consistent with the saturation of the receptor with the monomeric IgA antigen in vivo in the same way as it was saturated with IgE.
- IgA using the effector function of leukocytes which has the highest ratio in mammals, not only exists in a dimeric form, but also undergoes complex glycosylation, tailpiece, etc., resulting in significantly lower productivity than IgG, and antibody recycling in the body It has a very big disadvantage that it has a short half-life of 1 week compared to IgG having a half-life of 3 weeks because it cannot bind to FcRn, which is known to be involved in (recycle).
- a novel IgG antibody or fragment having immunological activity thereof that binds to Fc alpha receptor is provided. And, it aims to present a dual or multiple antibody platform of various types in order to utilize the antibody as a therapeutic antibody.
- the present invention provides an antibody specific for Fc alpha receptor or a fragment having immunological activity thereof.
- the invention also provides bispecific or multispecific antibodies.
- the present invention also provides an isolated nucleic acid molecule encoding the antibody, a vector comprising the same, and a host cell transformed with the vector.
- the present invention provides a pharmaceutical composition comprising a bispecific or multispecific antibody as an active ingredient.
- the present invention provides a method for preparing an antibody specific for an Fc alpha receptor or a fragment having immunological activity thereof.
- the present invention provides methods for making bispecific or multispecific antibodies.
- the Fc alpha receptor-specific antibodies or fragments having immunological activity thereof bind to the Fc alpha receptor of neutrophils, which occupies the highest ratio in effector cells in the form of IgG, particularly in mammals. It has the effect of maximizing the mechanism of action (ADCC and ADCP) of the antibody by maximizing the effector function of various antibody therapeutics while overcoming the disadvantages of the IgA antibody. can be utilized
- FIG. 1 is a diagram showing the prepared dimeric Fc alpha receptor-ECD region antigen protein and tetrameric Fc alpha receptor-ECD region antigen protein vector and the results of SDS-PAGE analysis thereof.
- FIG. 2 is a diagram showing a schematic diagram of antibody screening using a flow cytometer.
- FIG. 3 is a diagram illustrating the results of amino acid sequence analysis of six human antibody variants of scFv showing high binding affinity to Fc alpha receptor-ECD.
- FIG. 5 is a diagram showing a vector of IgG (JS9, JS19, JS30, JS40, JS41 and JS48) containing six scFv antibody variants, respectively, and SDS-PAGE gel photos after expression and purification.
- FIG. 6 is a diagram confirming the antigen-binding ability of IgG antibodies (JS9, JS30, JS40, JS41, and JS48) including 6 types of scFv antibody variants, respectively.
- FIG. 7 is a diagram showing the results of amino acid sequence analysis of three novel scFv human antibody variants showing increased binding affinity to Fc alpha receptor-ECD discovered by the ultra-high-speed screening system.
- FIG. 8 is a diagram showing the results of analyzing the binding affinity of three new scFv antibody variants JS116, JS144 and JS140 to Fc alpha receptor-ECD with increased binding affinity to Fc alpha receptor-ECD by flow cytometry.
- 9 is an animal cell expression vector for producing three novel scFv antibody mutants with increased binding affinity to Fc alpha receptor-ECD in the form of IgG, and a view confirmed by SDS-PAGE after expression and purification in animal cells.
- FIG. 10 is a diagram showing the results of confirming the binding ability of the Fc alpha receptor-ECD of three types of antibodies with increased binding affinity to the Fc alpha receptor-ECD prepared in the form of IgG by ELISA.
- 11 is an animal cell expression vector for constructing a JS40-1 antibody having a JS40 VH region and a JS48 VL region and a JS48-1 antibody having a JS48 VH region and a JS40 VL region, and animal cells It is a diagram confirmed by SDS-PAGE after expression and purification in
- FIG. 12 is a view showing the results of confirming the binding affinity of the JS40-1 antibody and the JS48-1 antibody to Fc alpha receptor-ECD by ELISA.
- FIG. 13 is a diagram showing expression vectors of dual antibodies (8 types) binding to two antigens (Fc alpha receptor and Her-2) prepared using IgG antibodies JS40 and JS48 and trastuzumab.
- FIG. 14 is a view showing SDS-PAGE gel pictures of 8 types of double antibodies expressed and purified in animal cells.
- a and B binding to Fc alpha receptor
- the present invention relates to an antibody specific for an Fc alpha receptor or a fragment having immunological activity thereof.
- the antibody may be IgG, and the fragment having immunological activity is Fab, Fd, Fab', dAb, F(ab'), F(ab') 2 , scFv (single chain fragment variable), It may be any one selected from the group consisting of Fv, single-chain antibody, Fv dimer, complementarity determining region fragment, humanized antibody, chimeric antibody, and diabody, more preferably scFv.
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention is (a) CDRH (complementarity determining) comprising any one selected from the group consisting of the amino acid sequence of SEQ ID NOs: 1 to 3 regions Heavy chain) 1, CDRH2 comprising any one selected from the group consisting of amino acid sequences of SEQ ID NOs: 4 to 7, and CDRH3 comprising any one selected from the group consisting of amino acid sequences of SEQ ID NOs: 8 to 15 a VH domain; And / or (b) CDRL (Complementarity determining regions light chain) 1 comprising any one selected from the group consisting of the amino acid sequence of SEQ ID NOs: 16 to 21, any one selected from the group consisting of the amino acid sequence of SEQ ID NOs: 22 to 27 It may include a VL domain comprising CDRL2 comprising one, and CDRL3 comprising any one selected from the group consisting of amino acid sequences of SEQ ID NOs: 28 to 32.
- CDRH complementar
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention is (a) FR1 comprising any one selected from the group consisting of the amino acid sequence of SEQ ID NOs: 33 to 36, SEQ ID NO: FR2 containing any one selected from the group consisting of the amino acid sequence of 37 to 41, FR3 containing any one selected from the group consisting of the amino acid sequence of SEQ ID NOs: 42 to 44, and the amino acid sequence of SEQ ID NOs: 45 or 46 a VH domain comprising FR4 comprising; And / or (b) FR1 comprising any one selected from the group consisting of the amino acid sequence of SEQ ID NOs: 47 to 52, FR2 comprising any one selected from the group consisting of the amino acid sequence of SEQ ID NOs: 53 to 56, SEQ ID NO: It may include a VL domain comprising FR3 comprising any one selected from the group consisting of the amino acid sequence of 57 to 63 and FR4 comprising any one selected
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 33, CDRH1 comprising the amino acid sequence of SEQ ID NO: 1, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 37, CDRH2 comprising the amino acid sequence of SEQ ID NO: 4, FR3 comprising the amino acid sequence of SEQ ID NO: 42, CDRH3 comprising the amino acid sequence of SEQ ID NO: 11 and the amino acid sequence of SEQ ID NO: 46 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 47, CDRL1 comprising the amino acid sequence of SEQ ID NO: 16, FR2 comprising the amino acid sequence of SEQ ID NO: 53, CDRL2 comprising the amino acid sequence of SEQ ID NO: 24, JS40 comprising a V domain comprising a VL domain comprising FR3 comprising the amino acid
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 34, CDRH1 comprising the amino acid sequence of SEQ ID NO: 1, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 37, CDRH2 comprising the amino acid sequence of SEQ ID NO: 4, FR3 comprising the amino acid sequence of SEQ ID NO: 42, CDRH3 comprising the amino acid sequence of SEQ ID NO: 11 and the amino acid sequence of SEQ ID NO: 46 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 49, CDRL1 comprising the amino acid sequence of SEQ ID NO: 17, FR2 comprising the amino acid sequence of SEQ ID NO: 54, CDRL2 comprising the amino acid sequence of SEQ ID NO: 23, JS48 comprising a V domain comprising a VL domain comprising FR3 comprising the amino acid
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 33, CDRH1 comprising the amino acid sequence of SEQ ID NO: 1, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 37, CDRH2 comprising the amino acid sequence of SEQ ID NO: 4, FR3 comprising the amino acid sequence of SEQ ID NO: 42, CDRH3 comprising the amino acid sequence of SEQ ID NO: 8 and the amino acid sequence of SEQ ID NO: 45 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 47, CDRL1 comprising the amino acid sequence of SEQ ID NO: 16, FR2 comprising the amino acid sequence of SEQ ID NO: 53, CDRL2 comprising the amino acid sequence of SEQ ID NO: 22, A V domain comprising a VL domain comprising FR3 comprising the amino acid sequence of SEQ ID NO:
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 33, CDRH1 comprising the amino acid sequence of SEQ ID NO: 1, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 37, CDRH2 comprising the amino acid sequence of SEQ ID NO: 4, FR3 comprising the amino acid sequence of SEQ ID NO: 42, CDRH3 comprising the amino acid sequence of SEQ ID NO: 9 and the amino acid sequence of SEQ ID NO: 45 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 47, CDRL1 comprising the amino acid sequence of SEQ ID NO: 16, FR2 comprising the amino acid sequence of SEQ ID NO: 53, CDRL2 comprising the amino acid sequence of SEQ ID NO: 22, A V domain comprising a VL domain comprising FR3 comprising the amino acid sequence of SEQ ID NO:
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 34, CDRH1 comprising the amino acid sequence of SEQ ID NO: 1, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 38, CDRH2 comprising the amino acid sequence of SEQ ID NO: 4, FR3 comprising the amino acid sequence of SEQ ID NO: 42, CDRH3 comprising the amino acid sequence of SEQ ID NO: 10 and the amino acid sequence of SEQ ID NO: 46 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 48, CDRL1 comprising the amino acid sequence of SEQ ID NO: 17, FR2 comprising the amino acid sequence of SEQ ID NO: 54, CDRL2 comprising the amino acid sequence of SEQ ID NO: 23, A V domain comprising a VL domain comprising FR3 comprising the amino acid sequence of SEQ ID NO: 34,
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 34, CDRH1 comprising the amino acid sequence of SEQ ID NO: 1, FR2 comprising the amino acid sequence of SEQ ID NO: 37, CDRH2 comprising the amino acid sequence of SEQ ID NO: 4, FR3 comprising the amino acid sequence of SEQ ID NO: 42, CDRH3 comprising the amino acid sequence of SEQ ID NO: 11 and amino acid sequence of SEQ ID NO: 46 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 49, CDRL1 comprising the amino acid sequence of SEQ ID NO: 16, FR2 comprising the amino acid sequence of SEQ ID NO: 54, CDRL2 comprising the amino acid sequence of SEQ ID NO: 24, JS40-1 comprising a V domain comprising a VL domain comprising FR3 comprising the amino acid sequence of
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 33, CDRH1 comprising the amino acid sequence of SEQ ID NO: 1, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 37, CDRH2 comprising the amino acid sequence of SEQ ID NO: 4, FR3 comprising the amino acid sequence of SEQ ID NO: 42, CDRH3 comprising the amino acid sequence of SEQ ID NO: 11 and the amino acid sequence of SEQ ID NO: 45 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 47, CDRL1 comprising the amino acid sequence of SEQ ID NO: 17, FR2 comprising the amino acid sequence of SEQ ID NO: 53, CDRL2 comprising the amino acid sequence of SEQ ID NO: 23, JS40-1 comprising a V domain comprising a VL domain comprising FR3 comprising the amino
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 35, CDRH1 comprising the amino acid sequence of SEQ ID NO: 2, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 39, CDRH2 comprising the amino acid sequence of SEQ ID NO: 6, FR3 comprising the amino acid sequence of SEQ ID NO: 43, CDRH3 comprising the amino acid sequence of SEQ ID NO: 23 and the amino acid sequence of SEQ ID NO: 46 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 50, CDRL1 comprising the amino acid sequence of SEQ ID NO: 18, FR2 comprising the amino acid sequence of SEQ ID NO: 55, CDRL2 comprising the amino acid sequence of SEQ ID NO: 25, JS9 comprising a V domain comprising a VL domain comprising FR3 comprising the amino acid
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 33, CDRH1 comprising the amino acid sequence of SEQ ID NO: 1, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 41, CDRH2 comprising the amino acid sequence of SEQ ID NO: 4, FR3 comprising the amino acid sequence of SEQ ID NO: 42, CDRH3 comprising the amino acid sequence of SEQ ID NO: 15 and the amino acid sequence of SEQ ID NO: 46 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 52, CDRL1 comprising the amino acid sequence of SEQ ID NO: 21, FR2 comprising the amino acid sequence of SEQ ID NO: 56, CDRL2 comprising the amino acid sequence of SEQ ID NO: 27, JS19 comprising a V domain comprising a VL domain comprising FR3 comprising the amino acid
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 36, CDRH1 comprising the amino acid sequence of SEQ ID NO: 3, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 40, CDRH2 comprising the amino acid sequence of SEQ ID NO: 7, FR3 comprising the amino acid sequence of SEQ ID NO: 44, CDRH3 comprising the amino acid sequence of SEQ ID NO: 13 and the amino acid sequence of SEQ ID NO: 46 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 51, CDRL1 comprising the amino acid sequence of SEQ ID NO: 19, FR2 comprising the amino acid sequence of SEQ ID NO: 54, CDRL2 comprising the amino acid sequence of SEQ ID NO: 26, JS30 comprising a V domain comprising a VL domain comprising FR3 comprising the amino acid
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention comprises (a) FR1 comprising the amino acid sequence of SEQ ID NO: 36, CDRH1 comprising the amino acid sequence of SEQ ID NO: 3, the sequence FR2 comprising the amino acid sequence of SEQ ID NO: 40, CDRH2 comprising the amino acid sequence of SEQ ID NO: 7, FR3 comprising the amino acid sequence of SEQ ID NO: 44, CDRH3 comprising the amino acid sequence of SEQ ID NO: 14 and the amino acid sequence of SEQ ID NO: 46 a VH domain comprising FR4 comprising; and/or (b) FR1 comprising the amino acid sequence of SEQ ID NO: 51, CDRL1 comprising the amino acid sequence of SEQ ID NO: 20, FR2 comprising the amino acid sequence of SEQ ID NO: 54, CDRL2 comprising the amino acid sequence of SEQ ID NO: 23, JS41 comprising a V domain comprising a VL domain comprising FR3 comprising the amino acid
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention is CL comprising the amino acid sequence of SEQ ID NO: 68, CH1 comprising the amino acid sequence of SEQ ID NO: 69, SEQ ID NO: 70 CH2 comprising the amino acid sequence or CH3 comprising the amino acid sequence of SEQ ID NO: 71.
- the antibody or fragment having immunological activity specific for the Fc alpha receptor of the present invention can specifically bind to the extracellular domain (ECD) of the Fc alpha receptor, and the Fc alpha receptor
- ECD extracellular domain
- the extracellular region of may include the amino acid sequence of SEQ ID NO: 72.
- the Fc alpha receptor-specific antibody or fragment having immunological activity thereof of the present invention can increase effector action, and phagocytosis (antibody-dependent cellular phagocytosis, ADCP) of leukocytes and CD89-bearing cell lines Alternatively, antibody-mediated cellular cytotoxicity (ADCC) may be increased.
- ADCP antibody-dependent cellular phagocytosis
- ADCC antibody-mediated cellular cytotoxicity
- Fc alpha receptor Fc ⁇ receptor
- IgA receptor IgA receptor
- CD89 CD89
- the antibody is not only in the form of a whole antibody, but also includes functional fragments of antibody molecules.
- the whole antibody has a structure having two full-length light chains and two full-length heavy chains, and each light chain is connected to the heavy chain by a disulfide bond.
- a functional fragment of an antibody molecule refers to a fragment having an antigen-binding function
- examples of antibody fragments include (a) a light chain variable region (VL), a heavy chain variable region (VH), and a light chain constant region (CL) and a Fab fragment consisting of the first constant region of the heavy chain (CH1); (b) an Fd fragment consisting of the VH and CH1 domains; (c) an Fv fragment consisting of the VL and VH domains of a single antibody; (d) a dAb fragment consisting of a VH domain (Ward ES et al., Nature 341:544-546 (1989)); (e) an isolated CDR region; (f) a bivalent fragment comprising two linked Fab fragments F(ab')2 fragment: (g) single chain Fv molecule (scFv) joined by a peptide linker that joins VH domain and VL domain to form an antigen binding site (h) bispecific single chain Fv dimer (PC
- the antibody or fragment having immunological activity thereof of the present invention may be selected from the group consisting of an animal-derived antibody, a chimeric antibody, a humanized antibody, a human antibody, and a fragment having immunological activity thereof.
- the antibody may be recombinantly or synthetically produced.
- An animal-derived antibody produced by immunizing an animal to be immunized with a desired antigen may cause immune rejection when administered to humans for therapeutic purposes, and a chimeric antibody has been developed to suppress such immune rejection.
- a chimeric antibody is one obtained by substituting a constant region of an animal-derived antibody that causes an anti-isotype reaction with that of a human antibody using a genetic engineering method. Chimeric antibodies have significantly improved anti-isotype response compared to animal-derived antibodies, but still have animal-derived amino acids in the variable region, potentially resulting in anti-idiotypic side effects. are doing A humanized antibody was developed to improve these side effects. This is produced by grafting complementarity determining regions (CDRs), which play an important role in antigen binding, into a human antibody framework among the variable regions of a chimeric antibody.
- CDRs complementarity determining regions
- the most important thing in the CDR grafting technology for producing a humanized antibody is to select an optimized human antibody that can best accept the CDR region of an animal-derived antibody. structure analysis, molecular modeling technology, etc. are used. However, even when the CDR regions of an animal-derived antibody are transplanted into the optimized human antibody framework, there are cases in which amino acids that affect antigen binding are present while being located in the framework of the animal-derived antibody, so that antigen-binding ability is not preserved in many cases. Therefore, it can be said that the application of additional antibody engineering technology to restore antigen binding force is essential.
- the antibody or fragment having immunological activity thereof may be isolated from a living body (not present in the living body) or non-naturally occurring, for example, synthetically or recombinantly produced.
- the term "antibody” refers to a substance produced by stimulation of an antigen in the immune system, the type is not particularly limited, and can be obtained naturally or non-naturally (eg, synthetically or recombinantly).
- Antibodies are advantageous for mass expression and production because they are very stable and have a long half-life not only in vitro but also in vivo.
- the adhesion is very high.
- a complete antibody has a structure having two full-length light chains and two full-length heavy chains, and each light chain is linked to a heavy chain by a disulfide bond.
- the constant region of an antibody is divided into a heavy chain constant region and a light chain constant region, and the heavy chain constant region has gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) and epsilon ( ⁇ ) types, subclasses gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), gamma 3 ( ⁇ 3), gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1) and alpha 2 ( ⁇ 2).
- the constant region of the light chain has kappa ( ⁇ ) and lambda ( ⁇ ) types.
- the term “heavy chain” refers to a variable region domain V H and three constant region domains C H1 , C H2 and C H3 comprising an amino acid sequence having a variable region sequence sufficient to confer specificity to an antigen. and a full-length heavy chain including a hinge and a fragment thereof.
- the term “light chain” refers to both full-length light chains and fragments thereof comprising a variable region domain VL and a constant region domain CL comprising an amino acid sequence having sufficient variable region sequence to confer specificity to an antigen. interpreted as including
- variable region or variable domain refers to a portion of an antibody molecule that exhibits many variations in sequence while performing a function of specifically binding to an antigen, and complementarity in the variable region There are determining regions CDR1, CDR2 and CDR3. Between the CDRs, a framework region (FR) portion exists to support the CDR ring.
- FR framework region
- the "complementarity determining region” is a ring-shaped region involved in antigen recognition, and the specificity of the antibody for the antigen is determined as the sequence of this region changes.
- scFv single chain fragment variable
- scFv single chain fragment variable
- CDR complementarity determining region
- the terms “specifically binding” or “specifically recognized” have the same meaning as commonly known to those skilled in the art, and mean that an antigen and an antibody specifically interact to conduct an immunological reaction. .
- the term “antigen-binding fragment” refers to a fragment of the entire immunoglobulin structure, and refers to a portion of a polypeptide including an antigen-binding portion. For example, it may be scFv, (scFv) 2 , scFv-Fc, Fab, Fab' or F(ab') 2 , but is not limited thereto.
- Fab has a structure having a light chain and heavy chain variable regions, a light chain constant region and a heavy chain first constant region (C H1 ), and has one antigen-binding site.
- Fab' differs from Fab in that it has a hinge region comprising one or more cysteine residues at the C-terminus of the heavy chain C H1 domain.
- the F(ab') 2 antibody is produced by forming a disulfide bond with a cysteine residue in the hinge region of Fab'.
- Fv is a minimal antibody fragment having only a heavy chain variable region and a light chain variable region, and a recombinant technique for generating an Fv fragment is well known in the art.
- the heavy chain variable region and the light chain variable region are linked by a non-covalent bond
- single-chain Fv single-chain Fv
- the linker may be a peptide linker consisting of any amino acids from 1 to 100 or 2 to 50 amino acids, and an appropriate sequence is known in the art.
- the antigen-binding fragment can be obtained using a proteolytic enzyme (for example, Fab can be obtained by restriction digestion of the entire antibody with papain, and F(ab') 2 fragment can be obtained by digestion with pepsin), It can be produced through genetic recombination technology.
- a proteolytic enzyme for example, Fab can be obtained by restriction digestion of the entire antibody with papain, and F(ab') 2 fragment can be obtained by digestion with pepsin
- the term "hinge region” is a region included in the heavy chain of an antibody, which exists between the C H1 and C H2 regions, and functions to provide flexibility of the antigen-binding site in the antibody. means area.
- the hinge may be derived from a human antibody, and specifically, may be derived from IgA, IgE, or IgG, such as IgG1, IgG2, IgG3, or IgG4.
- the present invention relates to a bispecific or multispecific antibody comprising an antibody specific for an Fc alpha receptor or a fragment having immunological activity thereof of the present invention, and a moiety that binds to a target antigen other than the Fc alpha receptor. it's about
- the portion that binds to the target antigen may include an antibody or a fragment having immunological activity thereof, and the fragment having immunological activity is Fab, Fd, Fab', dAb, F(ab'), F (ab') 2 , scFv, Fv, single chain antibody, Fv dimer, complementarity determining region fragment, humanized antibody, chimeric antibody and diabody (diabody) may be any one selected from the group consisting of, scFv or Fab more preferably.
- the target antigen is 17-1A antigen, GD3 ganglioside R24, EGFRvIII, PSMA, PSCA, HLA-DR, EpCAM, MUC1 core protein, aberrant glycosylated MUC1, fibronectin variant containing an ED-B domain, HER2/neu, Carcinogenous antigen (CEA), gastrin-releasing peptide (GRP) receptor antigen, mucine antigen, epidermal growth factor receptor (EGF-R), HER3, HER4, MAGE antigen, SART antigen, MUC1 antigen , c-erb-2 antigen, TAG 72, carbonic anhydrase IX, alpha-fetoprotein, A3, antigen specific for A33 antibody, Ba 733, BrE3-antigen, CA125, CD1, CD1a, CD3, CD5, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD33, CD38, CD40, CD45, CD52, CD
- the apoptosis-related gene is ABL1, AKT1, AKT2, BARD1, BAX, BCL11B, BCL2, BCL2A1, BCL2L1, BCL2L12, BCL3, BCL6, BIRC2, BIRC3, BIRC5, BRAF, CARD11, CDC25A, CARD11, CAV1 CDKN1A, CFLAR, CNR2, CTNNB1, CUL4A, DAXX, DDIT3, E2F1, E2F3, E2F5, ESPL1, FOXO1, HDAC1, HSPA5, IGF1R, IGF2, JUN, JUNB, JUND, MDMALT1, MAP3K7, MCL1, MDM MYC, NFKB2, NPM1, NTRK1, PAK1, PAX3, PML, PRKCA, PRKCE, PTK2B, RAF1, RHOA, TGFB1, TNFRSF1B, TP73, TRAF6, YWHAG, YWHAQ or Y
- the oncogene is SEPTIN9, ACOD1, ACTN4, ADAM28, ADAM9, ADGRF1, ADRBK2, AFF1, AFF3, AGAP2, AGFG1, AGRN, AHCYL1, AHI1, AIMP2, AKAP13, AKAP9, ALL1, AKIRIN2, AKTIP1, ALDH1A1 ANIB1, ANP32C, ANP32D, AQP1, ARAF, ARHGEF1, ARHGEF2, ARHGEF5, ASPSCR1, AURKA, BAALC, BAIAP2L1, BANP, BCAR4, BCKDHB, BCL9, BCL9L, BCR, BMI1, BMP7, BOC, BRD4 CAPG, CBFB, CBLB, CBLL1, CBX7, CBX8, CCDC28A, CCDC6, CCNB1, CCNB2, CCND1, CCNE1, CCNL1, CD24, CDC25C, CDC6, CDH17, CDK1, CDK14, CDK4, CD
- the target antigen may be a cell surface antigen or an autoantigen
- the cell surface antigen is CEA, ED-B fibronectin, CD20, CD22, CD19, EGFR, IGFlR, VEFGRl/Flt-1, VEGFR2/KDR, VEGRF3 /Flt-4, HER2/neu, CD30, CD33, CD3, CD16, CD64, CD89, CD2, adenovirus fiber knob, PfMSP-1, HN/NDV, EpCAM/17-lA, hTR, IL-2R/Tac, It may be at least one selected from the group consisting of CA9-9, MUCl, HLA class II, GD2, G250, TAG-72, PSMA, CEACAM6, HMWMAA, CD40, M13 envelope protein, and GPIIb/IIIa.
- the present invention provides an isolated nucleic acid molecule encoding an antibody of the invention or an immunologically active fragment thereof, or a bispecific or multispecific antibody of the invention, a vector comprising the same, and a vector transformed therewith It relates to host cells.
- the nucleic acid molecules of the present invention may be isolated or recombinant, and include single-stranded and double-stranded forms of DNA and RNA as well as corresponding complementary sequences.
- An isolated nucleic acid is a nucleic acid that has been separated from surrounding genetic sequences present in the genome of the individual from which the nucleic acid was isolated, in the case of a nucleic acid isolated from a naturally occurring source.
- a nucleic acid synthesized enzymatically or chemically from a template such as a PCR product, a cDNA molecule, or an oligonucleotide
- a nucleic acid resulting from such a procedure can be understood as an isolated nucleic acid molecule.
- nucleic acid molecule refers to a nucleic acid molecule in the form of separate fragments or as a component of a larger nucleic acid construct.
- Nucleic acids are operably linked when placed into a functional relationship with another nucleic acid sequence.
- the DNA of the presequence or secretion leader is operably linked to the DNA of the polypeptide when expressed as a preprotein in the form before the polypeptide is secreted
- the promoter or enhancer is the polypeptide sequence is operably linked to a coding sequence when it affects the transcription of, or a ribosome binding site is operably linked to a coding sequence when positioned to facilitate translation.
- operably linked means that the DNA sequences to be linked are located contiguously, and in the case of a secretory leader, they are contiguous and in the same reading frame. However, enhancers need not be located adjacent to each other. Linkage is achieved by ligation at convenient restriction enzyme sites. If such sites do not exist, synthetic oligonucleotide adapters or linkers are used according to conventional methods.
- An isolated nucleic acid molecule encoding an antibody of the present invention, or an immunologically active fragment thereof, or a bispecific or multispecific antibody of the present invention, may be prepared due to codon degeneracy or the expression of the antibody.
- codons preferred in organisms various modifications can be made to the coding region within the range that does not change the amino acid sequence of the antibody expressed from the coding region, and the range that does not affect gene expression in parts other than the coding region. It will be well understood by those skilled in the art that various modifications or modifications can be made within, and that such modified genes are also included within the scope of the present invention.
- nucleic acid molecule of the present invention encodes a protein having an equivalent activity
- one or more nucleic acid bases may be mutated by substitution, deletion, insertion, or a combination thereof, and these are also included in the scope of the present invention.
- the sequence of such a nucleic acid molecule may be single-stranded or double-stranded, and may be a DNA molecule or an RNA (mRNA) molecule.
- An isolated nucleic acid molecule encoding an antibody of the present invention or an immunologically active fragment thereof according to the present invention, or a bispecific or multispecific antibody of the present invention can be inserted into an expression vector for protein expression.
- Expression vectors usually comprise a protein operably linked, ie, placed in a functional relationship, with regulatory or regulatory sequences, selectable markers, optional fusion partners, and/or additional elements.
- a host cell transformed with a nucleic acid preferably an antibody of the invention or an immunologically active fragment thereof, or expression containing an isolated nucleic acid molecule encoding a bispecific or multispecific antibody of the invention
- An antibody of the present invention or a fragment having immunological activity thereof, or a bispecific or multispecific antibody of the present invention can be produced by culturing a vector to induce protein expression.
- suitable host cells can be used, including, but not limited to, mammalian cells, bacteria, insect cells, and yeast. Methods for introducing an exogenous nucleic acid into a host cell are known in the art and will vary depending on the host cell used.
- E. coli which has a high industrial use value due to low production cost, can be produced as a host cell.
- the vector of the present invention includes, but is not limited to, a plasmid vector, a cosmid vector, a bacteriophage vector, and a viral vector.
- Suitable vectors include a signal sequence or leader sequence for membrane targeting or secretion in addition to expression control elements such as promoter, operator, start codon, stop codon, polyadenylation signal and enhancer, and may be prepared in various ways depending on the purpose.
- the promoter of the vector may be constitutive or inducible.
- the signal sequence includes a PhoA signal sequence and an OmpA signal sequence when the host is Escherichia sp., and an ⁇ -amylase signal sequence and a subtilisin signal when the host is a Bacillus sp.
- the vector may also contain a selection marker for selecting a host cell containing the vector, and in the case of a replicable expression vector, an origin of replication.
- vector refers to a carrier capable of inserting a nucleic acid sequence for introduction into a cell capable of replicating the nucleic acid sequence.
- Nucleic acid sequences may be exogenous or heterologous.
- Vectors include, but are not limited to, plasmids, cosmids, and viruses (eg, bacteriophages).
- viruses eg, bacteriophages.
- One skilled in the art can construct vectors by standard recombinant techniques (Maniatis, et al., Molecular Cloning , A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988; and Ausubel et al., In: Current Protocols in Molecular Biology, John, Wiley & Sons, Inc, NY, 1994 et al.).
- expression control sequences such as promoter, terminator, enhancer, etc., membrane targeting or secretion according to the type of host cell in which the antibody is to be produced. Sequences and the like can be appropriately selected and combined in various ways depending on the purpose.
- expression vector refers to a vector comprising a nucleic acid sequence encoding at least a portion of a transcribed gene product. In some cases, the RNA molecule is then translated into a protein, polypeptide, or peptide.
- the expression vector may include various regulatory sequences. In addition to regulatory sequences that control transcription and translation, vectors and expression vectors may contain nucleic acid sequences that also serve other functions.
- the term "host cell” includes eukaryotes and prokaryotes, and refers to any transformable organism capable of replicating the vector or expressing a gene encoded by the vector.
- a host cell may be transfected or transformed by the vector, which refers to a process in which an exogenous nucleic acid molecule is delivered or introduced into a host cell.
- the host cell may be a bacterium or an animal cell
- the animal cell line may be a CHO cell, a HEK cell or an NSO cell
- the bacterium may be E. coli.
- the present invention relates to a cancer comprising an antibody of the present invention or a fragment having immunological activity thereof, and a bispecific or multispecific antibody comprising a portion that binds to a target antigen other than an Fc alpha receptor as an active ingredient , autoimmune disease, neurodegerative disease, Alzheimer's disease, metabolic disease, cardiovascular disease, atherosclerosis, organ transplant rejection, fungi, viruses, bacteria or parasites It relates to a pharmaceutical composition for preventing or treating a disease or condition selected from the group consisting of diseases or symptoms caused by
- the cancer is brain tumor, melanoma, myeloma, non-small cell lung cancer, oral cancer, liver cancer, stomach cancer, colon cancer, breast cancer, lung cancer, bone cancer, pancreatic cancer, skin cancer, head or neck cancer, cervical cancer, ovarian cancer, colorectal cancer , small intestine cancer, rectal cancer, fallopian tube carcinoma, perianal cancer, endometrial carcinoma, vaginal carcinoma, vulvar carcinoma, Hodgkin's disease, esophageal cancer, lymph gland cancer, bladder cancer, gallbladder cancer, endocrine gland cancer, thyroid cancer, parathyroid cancer, adrenal cancer , soft tissue sarcoma, urethral cancer, penile cancer, prostate cancer, chronic or acute leukemia, lymphocyte lymphoma, renal or ureter cancer, renal cell carcinoma, renal pelvic carcinoma, central nervous system tumor, primary central nervous system lymphoma, spinal cord tumor, brainstem glioma And it may be any one selected from the group consisting of
- prevention refers to any action that suppresses or delays the occurrence, spread, and recurrence of a disease or disorder by administration of the composition according to the present invention.
- treatment refers to any act of improving or beneficially changing the symptoms of a disease or disease and complications thereof by administering the composition according to the present invention.
- Those of ordinary skill in the art to which the present invention pertains with reference to the data presented by the Korean Medical Association, etc., know the exact standard of the disease for which the composition of the present application is effective, and can determine the degree of improvement, improvement and treatment will be.
- terapéuticaally effective amount used in combination with an active ingredient in the present invention means an amount effective to prevent or treat a disease or disorder
- the therapeutically effective amount of the composition of the present invention includes several factors, for example, administration It may vary depending on the method, the target site, the condition of the patient, etc. Therefore, when used in the human body, the dosage should be determined as an appropriate amount in consideration of both safety and efficiency. It is also possible to estimate the amount used in humans from the effective amount determined through animal experiments. These considerations in determining effective amounts are found, for example, in Hardman and Limbird, eds., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 10th ed. (2001), Pergamon Press; and E.W. Martin ed., Remington's Pharmaceutical Sciences, 18th ed. (1990), Mack Publishing Co.
- the pharmaceutical composition of the present invention is administered in a pharmaceutically effective amount.
- pharmaceutically effective amount refers to an amount sufficient to treat a disease at a reasonable benefit/risk ratio applicable to medical treatment and not to cause side effects, and the effective dose level is determined by the patient's Health status, disease or disease type, disease or disease severity, drug activity, drug sensitivity, administration method, administration time, administration route and excretion rate, treatment period, factors including drugs used in combination or concurrently, and others It may be determined according to factors well known in the medical field.
- the composition of the present invention may be administered as an individual therapeutic agent or in combination with other therapeutic agents, may be administered sequentially or simultaneously with conventional therapeutic agents, and may be administered singly or multiple times. Taking all of the above factors into consideration, it is important to administer an amount that can obtain the maximum effect with a minimum amount without side effects, which can be easily determined by those skilled in the art.
- the pharmaceutical composition of the present invention may include a carrier, diluent, excipient, or a combination of two or more commonly used in biological agents.
- pharmaceutically acceptable refers to exhibiting properties that are not toxic to cells or humans exposed to the composition.
- the carrier is not particularly limited as long as it is suitable for in vivo delivery of the composition, and for example, Merck Index, 13th ed., Merck & Co. Inc.
- saline Compounds described in , saline, sterile water, Ringer's solution, buffered saline, dextrose solution, maltodextrin solution, glycerol, ethanol, and one or more of these components can be mixed and used, and if necessary, other antioxidants, buffers, bacteriostats, etc. Conventional additives may be added. In addition, diluents, dispersants, surfactants, binders and lubricants may be additionally added to form an injectable dosage form such as an aqueous solution, suspension, emulsion, etc., pills, capsules, granules or tablets. Furthermore, it can be preferably formulated according to each disease or component using an appropriate method in the art or a method disclosed in Remington's Pharmaceutical Science (Mack Publishing Company, Easton PA, 18th, 1990).
- the pharmaceutical composition may be one or more formulations selected from the group including oral formulations, external preparations, suppositories, sterile injection solutions and sprays, and oral or injection formulations are more preferred.
- the term "administration” means providing a predetermined substance to a subject or patient by any suitable method, and parenteral administration (eg, intravenous, subcutaneous, intraperitoneal) according to a desired method Alternatively, it can be applied locally as an injection formulation) or orally administered, and the dosage varies according to the patient's weight, age, sex, health condition, diet, administration time, administration method, excretion rate, and severity of disease.
- Liquid formulations for oral administration of the composition of the present invention include suspensions, internal solutions, emulsions, syrups, etc., and various excipients, such as wetting agents, sweetening agents, fragrances, and preservatives, in addition to commonly used simple diluents such as water and liquid paraffin. and the like may be included.
- Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, freeze-dried preparations, suppositories, and the like.
- the pharmaceutical composition of the present invention may be administered by any device capable of transporting an active substance to a target cell.
- Preferred administration methods and formulations are intravenous injections, subcutaneous injections, intradermal injections, intramuscular injections, drip injections, and the like.
- aqueous solvents such as physiological saline and Ringel's solution, vegetable oil, higher fatty acid esters (eg, ethyl oleate), and non-aqueous solvents such as alcohols (eg, ethanol, benzyl alcohol, propylene glycol, glycerin, etc.)
- Stabilizers for preventing deterioration e.g., ascorbic acid, sodium hydrogen sulfite, sodium pyrosulfite, BHA, tocopherol, EDTA, etc.
- emulsifiers emulsifiers
- buffers for pH control to inhibit the growth of microorganisms
- Pharmaceutical carriers such as preservatives (eg, phenylmercuric nitrate, thimerosal, benzalkonium chloride, phenol,
- the term "individual” refers to monkeys, cattle, horses, sheep, pigs, chickens, turkeys, quails, cats, dogs, mice, bats, It refers to any animal, including camel, rat, rabbit or guinea pig, and "sample” may be droplet, sputum, whole blood, plasma, serum, urine or saliva isolated therefrom.
- the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable additive, wherein the pharmaceutically acceptable additive includes starch, gelatinized starch, microcrystalline cellulose, lactose, povidone, colloidal silicon dioxide, calcium hydrogen phosphate. , lactose, mannitol, syrup, gum arabic, pregelatinized starch, corn starch, powdered cellulose, hydroxypropyl cellulose, Opadry, sodium starch glycolate, lead carnauba, synthetic aluminum silicate, stearic acid, magnesium stearate, aluminum stearate, Calcium stearate, sucrose, dextrose, sorbitol and talc and the like may be used.
- the pharmaceutically acceptable additive according to the present invention is preferably included in an amount of 0.1 to 90 parts by weight based on the composition, but is not limited thereto.
- the present invention provides a method for forming an antigen-antibody complex by contacting a sample isolated from a specimen with a bispecific or multispecific antibody of the present invention; and detecting the formation of the complex by cancer, autoimmune disease, neurodegenerative disease, Alzheimer's disease, metabolic disease, cardiovascular disease, atherosclerosis, organ transplant rejection, fungi, viruses, bacteria or parasites
- a method for providing information on the diagnosis of a disease or condition selected from the group consisting of a induced disease or symptom selected from the group consisting of a induced disease or symptom.
- the present invention provides a method comprising: culturing a host cell transformed with a vector comprising an isolated nucleic acid molecule encoding an antibody of the invention or a fragment having immunological activity; And it relates to a method for producing an antibody or fragment having immunological activity specific for an Fc alpha receptor comprising the step of recovering the antibody or fragment having immunological activity thereof from the host cell culture.
- the invention provides a method comprising: culturing a host cell transformed with a vector comprising an isolated nucleic acid molecule encoding a bispecific or multispecific antibody of the invention; And it relates to a method for producing a bispecific or multispecific antibody that binds to an Fc alpha receptor and a target antigen other than the Fc alpha receptor, comprising recovering the antibody or a fragment having immunological activity thereof from the host cell culture.
- the present invention relates to the use of an antibody specific for an Fc alpha receptor or a fragment having immunological activity of the present invention for use in the manufacture of an antibody therapeutic.
- the present invention relates to a bispecific or multispecific antibody of the present invention for cancer, autoimmune disease, neurodegerative disease, Alzheimer's disease, metabolic disease, cardiovascular disease, It relates to the use for the prevention or treatment of a disease or condition selected from the group consisting of atherosclerosis, organ transplant rejection, disease or condition caused by fungi, viruses, bacteria or parasites.
- the present invention relates to a method of treating cancer comprising administering to a subject suffering from cancer in a pharmaceutically effective amount of a bispecific or multispecific antibody of the present invention.
- the extracellular domain (ECD) of the Fc alpha receptor was prepared as an antigen.
- ECD extracellular domain
- a dimeric form fused with a GST (Glutathione-S-transferase) tag and a tetramer fused with a Streptavidin tag A vector for expression of animal cells to produce an antigen (tetrameric) was prepared (FIG. 1).
- Expi293F cells cultured for one day at a density of 2x10 6 cells/ml were transfected using PEI (Polyscience, 23966).
- an Alexa488 fluorescent molecule was labeled with an antigen protein fused with streptavidin among the antigen proteins prepared in Examples above. Thereafter, using the bacterial-displayed human scFv antibody library constructed by the present inventors, human antibodies binding to the ECD region of the Fc alpha receptor were screened. Specifically, 1 ml of library cells were incubated in 25 ml TB medium containing 2% glucose and 40 ⁇ g/ml of chloramphenicol at 37° C. at 250 rpm for 4 hours, and then the cultured cells were incubated at 40 ⁇ g/ml.
- the cells were resuspended using 1 ml of 10Mm Tris-HCl (pH 8.0), washed twice to remove residual medium, and 1 ml of The outer cell membrane was removed by rotating the STE [0.5 M sucrose, 10 Mm Tris-HCl and 10 Mm EDTA (pH 8.0)] solution at 37° C. for 30 minutes to give an osmotic shock. Then, in a solution of 1 ml of Solution A and 20 ⁇ l of 50 mg/ml lysozyme solution, the peptidoglycan layer was removed by rotation at 37° C. for 15 minutes.
- 10Mm Tris-HCl pH 8.0
- the process of selecting spheroplasts showing high affinity for the Fc alpha receptor-ECD region through the spheroplasting process, antigen labeling, and selective gating of flow cytometry was repeated.
- the desired clones are amplified through the enrichment process, the process of securing the selected scFv mutant gene through PCR amplification, the subcloning process, and the transformation process.
- the next round of selection was performed to enrich (Fig. 2). ScFv mutant clones having excellent binding affinity to the Fc alpha receptor-ECD region were obtained through a search process of several repeated rounds.
- IgG The size and purity of IgG (JS9, JS19, JS30, JS40, JS41 and JS48) containing each of the six scFv antibody variants purified after buffer replacement with PBS using Centrifugal filter units 3K (Merck Millipore) were measured by SDS- It was analyzed by PAGE (FIG. 5).
- Example 7 Screening of human antibodies with improved binding affinity to the Fc alpha receptor ECD region using a high-speed screening system
- 1 ml of library cells were cultured in 25 ml TB medium containing 2% glucose and 40 ⁇ g/ml of chloramphenicol at 37° C. at 250 rpm for 4 hours.
- the cells were resuspended with 1 ml of 10 Mm Tris-HCl (pH 8.0), washed twice to remove residual medium, and 1 ml of The outer cell membrane was removed by rotation in a solution of STE [0.5 M sucrose, 10 Mm Tris-HCl, 10 Mm EDTA (pH 8.0)] at 37° C. for 30 minutes to give an osmotic shock.
- STE 0.5 M sucrose, 10 Mm Tris-HCl, 10 Mm EDTA (pH 8.0)
- the peptidoglycan layer was removed by rotation at 37° C. for 15 minutes.
- the process of selecting spheroplasts showing high affinity for the Fc alpha receptor ECD region through the spheroplasts removing the compartment layer, antigen labeling, and selective gating of flow cytometry was repeated.
- the desired clone is subjected to the enrichment process, the process of securing the selected scFv mutant gene through PCR amplification, the subcloning process, and the transformation process.
- the next round of selection was performed to enrich them. New scFv mutant clones with improved binding affinity to the Fc alpha receptor ECD region were obtained through a search process of several repeated rounds.
- each mutant and wild-type Fc to be used as a control were prepared as spheroplasts by the method described in Example 7 above.
- the prepared spheroplasts were bound to the Fc alpha receptor-ECD-Streptavidn-Alexa488 antigen used for screening at a concentration of 50 nM and incubated at room temperature for 1 hour. After washing twice with PBS to remove non-specific binding, binding to the Fc alpha receptor ECD region was analyzed using a flow cytometer.
- Example 10 Antibody production and purification of three scFv variants with increased binding affinity to the Fc alpha receptor ECD region
- the VH regions of JS40 and JS48 the two antibodies that showed the highest binding affinity to the Fc alpha receptor on the protein, have very similar sequences, but the VL sequences are completely different.
- the two types of antibodies (JS40-1 and JS48-1) prepared in Example 12 were serially diluted with 1% skim milk (in 0.05% PBST) and the existing as a control. of two types of antibodies (JS40 and JS48) were dispensed into each well by 50 ⁇ l and reacted at room temperature for 1 hour. After the washing process, 50 ⁇ l of anti-human IgG(H+L)-HRP conjugate (Jackson Immunoresearch) and each antibody reaction were performed at room temperature for 1 hour and washed.
- the JS40 antibody and the JS48 antibody which had high binding affinity to the Fc alpha receptor in the above example, were prepared in the form of double antibodies, respectively.
- Knob (T366W) and Hole (T366S, L368A, Y407V) were introduced into Fc using Trastuzumab, which targets JS40, JS48 and Her-2, respectively, in scFv and Fab form, respectively.
- JSB-40-1 (JS40 Fab + scFv of Trastzumab), JSB-48-1 (JS48 Fab + scFv of Trastzumab), JSB-40-2 (JS40 scFv + Fab of Trastzumab) and JSB- 48-2 (JS48 scFv + Trastzumab Fab) was constructed, and JS40, JS48 and Trastzumab were linked to the Fc terminus of each antibody in the form of scFv, four types of dual antibody JSC-40-1 (JS40 IgG + To make trastuzumab scFv), JSC-48-1 (JS48 IgG + trastuzumab scFv), JSC-40-2 (trastuzumab IgG + JS40 scFv) and JSC-48-2 (trastuzumab IgG + JS48 scFv) , heavy and light chain expression vectors of
- JSB-40-1, JSB-40-2, JSB-48-1, JSB-48-2 expressing and purified antibodies as in the above example are anti-C ⁇ resin, JSC-40-1, The size and purity of JSC-40-2, JSC-48-1 and JSC-48-2 were analyzed by SDS-PAGE (FIG. 14).
Abstract
본 발명은 인간 Fc알파 수용체와의 결합력이 증대된 항체 및 이를 이용한 항체의 작용기작 극대화 기술에 관한 것으로, 본 발명에 따른 Fc 알파 수용체에 특이적인 항체들 또는 이의 면역학적 활성을 가진 단편들은 IgG 형태로 효과기(effector) 세포들, 특히, 포유류에서 가장 높은 비율을 차지하는 호중구의 Fc 알파 수용체와 결합함으로써 종래의 IgA 항체의 단점들을 극복하면서 다양한 항체 치료제에 효과기 기능을 극대화하여 항체의 작용기작 (ADCC 및 ADCP)를 극대화시키는 효과가 있으므로, 이를 이용한 다양한 Fc-융합 단백질 치료제를 효과기 기능이 향상된 항체 의약품으로 유용하게 활용할 수 있다.
Description
본 발명은 인간 Fc알파 수용체와의 결합력이 증대된 항체 및 이를 이용한 항체의 작용기작 극대화 기술에 관한 것이다.
항체는 체액성 및 세포성 면역계 사이의 연결고리를 제공하며, 항체의 Fab 영역이 항원을 인식하는 반면, Fc 부분은 모든 면역 적격 세포에 의해 차별적으로 발현되는 Fc 수용체 (FcR)에 결합한다. 다가 항원/항체 복합체에 의한 수용체의 가교로, 표적 세포의 탈과립화, 세포용해 또는 포식작용 및 사이토카인-암호화 유전자의 전사-활성화가 촉발된다 (Deo, Y.M. et al., Immunol. Today 18(3):127-135 (1997)). 항체는, 항체 Fc 영역 상의 Fc 수용체 결합 부위가 세포 상의 Fc 수용체 (FcR) 에 결합함으로써 Fc 영역을 통해 세포에 결합한다. 면역글로블린의 Fc 영역에 대한 수용체는 단핵구, 대식세포 및 다형핵 세포의 많은 방어적 기능을 촉발하는 데 중요하다. 이들 세포 상의 면역글로불린에 대한 수용체 (Fc 수용체 또는 FcR)들은 광범위하게 연구되었으며, 이들 수용체에 대한 모노클로날 항체를 발생시켜 이것이 치료적으로 유효하다는 것을 밝혔다. 항체가 세포 표면 상의 Fc 수용체에 결합하면 항체-코팅 입자의 포식 및 파괴, 면역 복합체의 제거, 살세포에 의한 항체-코팅 표적 세포의 용해 (항체-의존적 세포-매개 세포독성, 또는 ADCC 라 알려짐), 염증 매개체의 방출, 태반 이동 및 면역글로불린 생성의 제어를 포함하여 중요하고도 다양한 여러 생물학적 반응을 촉발한다.
IgG (감마 수용체), IgE (엡실론 수용체), IgA (알파 수용체) 및 IgM (뮤 수용체)를 포함하는 상이한 종류의 항체에 특이적인 몇 가지 Fc 수용체가 존재한다. 이 중, IgA 수용체 (Fcα수용체 또는 CD89)는 효과기(effector) 세포의 기능을 증진시킬 수 있다. 리간드가 Fcα수용체에 결합하면 백혈구 및 Fcα수용체-보유 세포주의 식세포작용(antibody-dependent cellular phagocytosis, ADCP)과 항체-매개성 세포독성작용(antibody dependent cellular cytotoxicity, ADCC)이 촉발된다. 또한, Fcα수용체는 효과기 세포 상의 IgG에 대한 수용체와 협력하여 표적 세포에 대한 식세포작용을 강화시킬 수 있다. 항체 Fc 영역에 의해 매개되는 효과기 기능(effector function)은 두 카테고리로 나눌 수 있다: (1) 항체가 항원에 결합한 후 작동하는 효과기 기능 (이러한 기능은, 예컨대 보체 연쇄증폭반응에의 관여 또는 Fc 수용체 (FcR)-보유 세포를 포함함); 및 (2) 항원 결합과는 별개로 작동하는 효과기 기능 (이러한 기능은, 예컨대 트랜스사이토시스(transcytosis)에 의해 세포 장벽을 가로질러 이동하는 능력 및 순환 중 지속성을 부여함). 예를 들어, 보체의 Cl 성분이 항체에 결합하면 보체 시스템이 활성화된다. 보체의 활성화는 세포 병원체의 옵소닌화 및 용해에 있어 중요하다. 보체의 활성화는 또한 염증 반응을 자극하며 자가면역 과민증에 관련될 수도 있다. 이와 같이, Fcα수용체 또는 CD89는 IgA의 Fc 부분과 결합하는 수용체이며 (Kerr, M. A. 1990, Biochem. J. 271: 285-296), 주로 다형핵 백혈구 (PMN), 단핵구, 대식세포, 호중구 및 호산구를 비롯한 세포독성 면역 효과기 세포상에서 항상 발현된다 (Morton, H. C., et al., 1996, Critical Reviews in Immunology 16: 423). 또한, Fcα수용체가 림프구 아개체군 상에서 발현 (Morton, H. C., et al., 1996, Critical Reviews in Immunology 16: 423)되고, 사구체 혈관사이 세포(mesangial cell) 상에서도 발현되는 것이 보고되었다 (Gomez-Guerrero, C., et al., 1996, J. Immunol. 156: 4369-4376). 인간 Fcα수용체의 α-쇄는 많이 글리코실화되어 있고, IgG 및 IgE에 대한 수용체도 포함하는 Ig 수퍼-유전자 군에 속하는 타입 I 막횡단 분자이다. 19번 염색체 상에 위치한 1개의 유전자는 FcαRI 알파 쇄의, 다양하게 스플라이싱 (splicing)된 다수의 이소타입들을 코딩한다 (55 내지 110 kDa; Morton, H. C., et al., 1996, Critical Reviews in Immunology 16: 423). 골수세포성 Fcα수용체는, Fcα수용체 신호 전달에 역할을 하는 FcR γ-쇄와 연관되어 있는 것으로 밝혀졌다 (Morton, H. C. et al. 1995, J. Biol. Chem. 270: 29781; Pfefferkorn, L. C., et al. 1995, J. Immunol. 153: 3228-3236; Saito, K. et al., 1995, J. Allergy Clin. Immunol. 96: 1152). Fcα수용체는 항원이 결합된 IgA1 및 IgA2, 및 모노머성 IgA1 및 IgA2에 모두 결합하며 (Mazangera, R. L. et al., 1990, Biochem. J. 272: 159-165), 이것은 FcγR 및 FcεRI이 각각 IgG 및 IgE로 포화되는 것과 같은 동일한 방법으로 생체내에서 상기 수용체가 모노머성 IgA 항원으로 포화되어 있는 것과 일치한다. 골수 효과기 세포 상의 Fcα수용체와, 중합성 IgA, IgA 면역 복합체, 또는 리간드 결합 도메인 내부 또는 외부의 에피토프에 대해 특이적인 mAb의 교차 결합은 탈과립화, 과산화물 방출, 염증성 사이토카인의 분비, 내포작용(endocytosis) 및 식세포작용을 자극한다 (Patty, C.,A. Herbelin, A. Lihuen, J. F. Bach, and R. C. Monteiro, 1995, Immunology 86: 1-5; Stewart, W. W., R. L. MazYegera, L. Shen, and M. A. Kerr, 1994, J. Leucocyte Biology 56: 481-487; Stewart, W. W., and M. A. Kerr, 1990, Immunology 71: 328-334; Shen, L., 1992, J. Leukocyte Biology 51: 373-378). Fcα수용체에 의해 촉발된 이러한 생리학적 반응은 점막 표면 상에서 제1선의 체액성 방어에 중요할 수 있다 (Morton, H. C., M. van Egmond, and J. G. J. van de Winkel, 1996, Critical Reviews in Immunology 16: 423).
한편, 다수의 연구 결과는 Fc-수용체-의존성 메카니즘이 종양에 대한 세포독성 항체의 작용에 실질적인 원인이 됨을 시사하며, 종양에 대한 최적 항체는 활성화 Fc 수용체에 우선적으로 결합한다는 것을 보여준다 (Clynes, R. A., et al., Nature Medicine 6(4):443-446 (2000); Kalergis, A. M.,and Ravetch, J. V., J. Exp. Med. 195 (12):1653-1659 (2002년 6월). 종종, 성공적인 항암 단일클론 항체는, ADCC 외에, 세포 신호전달 캐스케이드를 활성화시키거나 또는 성장 인자에의 접근을 차단하여 표적 세포 생존, 증식 또는 세포사를 조절하는 Fc-독립적인 직접적 신호전달 메카니즘을 유도한다. (Selenko, N., et al., J Clin. Immunol. 22 (3):124-130 (2002)). 예를 들어, CD20+ B 세포를 리툭시맙으로 처리하면 Mab-유도된 세포자가사멸(apoptosis)의 유도 및 보체 매개된 세포용해와 ADCC를 유도하는 것으로 확인된 바 있다. (Selenko, N., et al., J. Clin. Immunol. 22 (3):124-130 (2002)). 또한, 림프종 세포의 리툭시맙 유도된 세포자가사멸은 세포를 죽일 뿐 아니라 항원 제시 수지상 세포(DC)에 의한 림프종 세포 유도된 펩티드의 흡수 및 교차 제시를 촉진하며, DC의 성숙을 유도하고, 특이적 세포독성 T 림프구(CTL)를 생성한다.
Fc 수용체로는 IgG (감마 수용체), IgE (엡실론 수용체), IgA (알파 수용체) 및 IgM (뮤 수용체)를 포함하는 상이한 종류의 항체에 특이적인 몇 가지가 존재한다. 이 중, IgA 수용체 (Fcα수용체 또는 CD89)는 효과기(effector) 세포의 기능을 증진시킬 수 있다. 리간드가 Fcα수용체에 결합하면 백혈구 및 Fcα수용체-보유 세포주의 식세포작용(antibody-dependent cellular phagocytosis, ADCP)과 항체-매개성 세포독성작용(antibody dependent cellular cytotoxicity, ADCC)이 촉발된다. 또한, Fcα수용체는 효과기 세포 상의 IgG에 대한 수용체와 협력하여 표적 세포에 대한 식세포작용을 강화시킬 수 있다. 항체 Fc 영역에 의해 매개되는 효과기 기능(effector function)은 두 카테고리로 나눌 수 있다: (1) 항체가 항원에 결합한 후 작동하는 효과기 기능 (이러한 기능은, 예컨대 보체 연쇄증폭반응에의 관여 또는 Fc 수용체 (FcR)-보유 세포를 포함함); 및 (2) 항원 결합과는 별개로 작동하는 효과기 기능 (이러한 기능은, 예컨대 트랜스사이토시스(transcytosis)에 의해 세포 장벽을 가로질러 이동하는 능력 및 순환 중 지속성을 부여함). 예를 들어, 보체의 Cl 성분이 항체에 결합하면 보체 시스템이 활성화된다. 보체의 활성화는 세포 병원체의 옵소닌화 및 용해에 있어 중요하다. 보체의 활성화는 또한 염증 반응을 자극하며 자가면역 과민증에 관련될 수도 있다. 이와 같이, Fcα수용체 또는 CD89는 IgA의 Fc 부분과 결합하는 수용체이며 (Kerr, M. A. 1990, Biochem. J. 271: 285-296), 주로 다형핵 백혈구 (PMN), 단핵구, 대식세포, 호중구 및 호산구를 비롯한 세포독성 면역 효과기 세포상에서 항상 발현된다 (Morton, H. C., et al., 1996, Critical Reviews in Immunology 16: 423). 또한, Fcα수용체가 림프구 아개체군 상에서 발현 (Morton, H. C., et al., 1996, Critical Reviews in Immunology 16: 423)되고, 사구체 혈관사이 세포(mesangial cell) 상에서도 발현되는 것이 보고되었다 (Gomez-Guerrero, C., et al., 1996, J. Immunol. 156: 4369-4376). 인간 Fcα수용체의 α-쇄는 많이 글리코실화되어 있고, IgG 및 IgE에 대한 수용체도 포함하는 Ig 수퍼-유전자 군에 속하는 타입 I 막횡단 분자이다. 19번 염색체 상에 위치한 1개의 유전자는 FcαRI 알파 쇄의, 다양하게 스플라이싱 (splicing)된 다수의 이소타입들을 코딩한다 (55 내지 110 kDa; Morton, H. C., et al., 1996, Critical Reviews in Immunology 16: 423). 골수세포성 Fcα수용체는, Fcα수용체 신호 전달에 역할을 하는 FcR γ-쇄와 연관되어 있는 것으로 밝혀졌다 (Morton, H. C. et al. 1995, J. Biol. Chem. 270: 29781; Pfefferkorn, L. C., et al. 1995, J. Immunol. 153: 3228-3236; Saito, K. et al., 1995, J. Allergy Clin. Immunol. 96: 1152). Fcα수용체는 항원이 결합된 IgA1 및 IgA2, 및 모노머성 IgA1 및 IgA2에 모두 결합하며 (Mazangera, R. L. et al., 1990, Biochem. J. 272: 159-165), 이것은 FcγR 및 FcεRI이 각각 IgG 및 IgE로 포화되는 것과 같은 동일한 방법으로 생체내에서 상기 수용체가 모노머성 IgA 항원으로 포화되어 있는 것과 일치한다. 골수 효과기 세포 상의 Fcα수용체와, 중합성 IgA, IgA 면역 복합체, 또는 리간드 결합 도메인 내부 또는 외부의 에피토프에 대해 특이적인 mAb의 교차 결합은 탈과립화, 과산화물 방출, 염증성 사이토카인의 분비, 내포작용(endocytosis) 및 식세포작용을 자극한다 (Patty, C.,A. Herbelin, A. Lihuen, J. F. Bach, and R. C. Monteiro, 1995, Immunology 86: 1-5; Stewart, W. W., R. L. MazYegera, L. Shen, and M. A. Kerr, 1994, J. Leucocyte Biology 56: 481-487; Stewart, W. W., and M. A. Kerr, 1990, Immunology 71: 328-334; Shen, L., 1992, J. Leukocyte Biology 51: 373-378). Fcα수용체에 의해 촉발된 이러한 생리학적 반응은 점막 표면 상에서 제1선의 체액성 방어에 중요할 수 있다 (Morton, H. C., M. van Egmond, and J. G. J. van de Winkel, 1996, Critical Reviews in Immunology 16: 423).
그러나, 이와 같이 포유류에서 가장 높은 비율을 가지는 백혈구의 효과기 기능을 이용하는 IgA는 이합체 형태가 존재할뿐만 아니라, 복잡한 글리코실화, 테일피스(tailpiece) 등을 거켜 IgG보다 생산성이 현저히 떨어지며, 체내에서 항체의 재활용(recycle)에 관여한다고 알려진 FcRn에 결합하지 못해 3주의 반감기를 가지는 IgG와 비교하여 짧은 1주의 반감기를 가진다는 매우 큰 단점이 있다.
본 발명에서는 생산성이 떨어지고 짧은 반감기를 가지는 IgA 항체의 단점을 개선하고, 치료용 단백질 의약품의 효과기 기능을 극대화시키기 위해, Fc 알파 수용체에 결합하는 신규한 IgG 항체 또는 이의 면역학적 활성을 가진 단편을 제공하고, 상기 항체를 치료용 항체로 활용하기 위하여 다양한 형태의 이중 또는 다중 항체 플랫폼을 제시하는 것을 목적으로 한다.
상기 목적을 달성하기 위해, 본 발명은 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편을 제공한다.
또한, 본 발명은 이중특이적 또는 다중특이적 항체를 제공한다.
또한, 본 발명은 상기 항체를 코딩하는 단리된 핵산 분자, 이를 포함하는 벡터 및 상기 벡터로 형질전환된 숙주 세포를 제공한다.
또한, 본 발명은 이중특이적 또는 다중특이적 항체를 유효성분으로 포함하는 약학적 조성물을 제공한다.
또한, 본 발명은 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편을 제조하는 방법을 제공한다.
아울러, 본 발명은 이중특이적 또는 다중특이적 항체를 제조하는 방법을 제공한다.
본 발명에 따른 Fc 알파 수용체에 특이적인 항체들 또는 이의 면역학적 활성을 가진 단편들은 IgG 형태로 효과기(effector) 세포들, 특히, 포유류에서 가장 높은 비율을 차지하는 호중구의 Fc 알파 수용체와 결합함으로써 종래의 IgA 항체의 단점들을 극복하면서 다양한 항체 치료제에 효과기 기능을 극대화하여 항체의 작용기작 (ADCC 및 ADCP)를 극대화시키는 효과가 있으므로, 이를 이용한 다양한 Fc-융합 단백질 치료제를 효과기 기능이 향상된 항체 의약품으로 유용하게 활용할 수 있다.
도 1은 제작된 이합체 Fc 알파 수용체-ECD 영역 항원 단백질 및 사합체 Fc 알파 수용체-ECD 영역 항원 단백질의 벡터 및 이의 SDS-PAGE 분석 결과를 나타낸 도이다.
도 2는 유세포 분석기를 이용한 항체 탐색 모식도를 나타낸 도이다.
도 3은 Fc 알파 수용체-ECD에 높은 결합 친화도를 보이는 scFv 인간 항체 변이체 6종의 아미노산 서열 분석결과를 나타낸 도이다.
도 4는 6종의 scFv 항체 변이체의 Fc 알파 수용체 결합력 분석 결과이다.
도 5는 6종의 scFv 항체 변이체를 각각 포함하는 IgG (JS9, JS19, JS30, JS40, JS41 및 JS48)들의 벡터, 및 발현 및 정제 후 SDS-PAGE 젤 사진을 나타낸 도이다.
도 6은 6종의 scFv 항체 변이체를 각각 포함하는 IgG 항체 (JS9, JS30, JS40, JS41 및 JS48)들의 항원 결합력을 확인한 도이다.
도 7은 초고속 탐색 시스템으로 발굴된 Fc 알파 수용체-ECD에 증가한 결합 친화도를 보이는 신규한 3종의 scFv 인간 항체 변이체의 아미노산 서열 분석 결과를 나타낸 도이다.
도 8은 Fc 알파 수용체-ECD에 대한 결합력이 증가한 신규한 3종의 scFv 항체 변이체 JS116, JS144 및 JS140의 Fc 알파 수용체-ECD에 대한 결합력을 유세포 분석기로 분석한 결과를 나타낸 도이다.
도 9는 Fc 알파 수용체-ECD에 대한 결합력이 증가한 신규한 3종의 scFv 항체 변이체를 IgG 형태로 제작하기 위한 동물세포 발현 벡터와 이를 동물세포에서 발현 및 정제한 후 SDS-PAGE로 확인한 도이다.
도 10은 IgG 형태로 제작한 Fc 알파 수용체-ECD에 대한 결합력이 증가한 3종 항체의 Fc 알파 수용체-ECD에 대한 결합력을 ELISA로 확인한 결과를 나타낸 도이다.
도 11은 JS40의 VH 영역을 가지면서 JS48의 VL 영역을 가지는 JS40-1 항체 및 JS48의 VH 영역을 가지면서 JS40의 VL 영역을 가지는 JS48-1 항체를 제작하기 위한 동물세포 발현 벡터와 이를 동물세포에서 발현 및 정제한 후 SDS-PAGE로 확인한 도이다.
도 12는 JS40-1 항체 및 JS48-1 항체의 Fc 알파 수용체-ECD에 대한 결합력을 ELISA로 확인한 결과를 나타낸 도이다.
도 13은 IgG 항체 JS40 및 JS48와 트라스트주맙을 이용하여 제작한 2종의 항원 (Fc 알파 수용체 및 Her-2)에 결합하는 이중 항체들 (8 종)의 발현 벡터를 나타낸 도이다.
도 14는 동물세포 발현 및 정제한 8종의 이중 항체들의 SDS-PAGE 젤 사진을 나타낸 도이다.
도 15는 이중 항체의 항원 2종에 대한 결합력을 확인한 도이다:
A 및 B: Fc 알파 수용체에 대한 결합력; 및
C 및 D: Her-2에 대한 결합력.
이하, 첨부된 도면을 참조하여 본 발명의 구현예로 본 발명을 상세히 설명하기로 한다. 다만, 하기 구현예는 본 발명에 대한 예시로 제시되는 것으로, 당업자에게 주지 저명한 기술 또는 구성에 대한 구체적인 설명이 본 발명의 요지를 불필요하게 흐릴 수 있다고 판단되는 경우에는 그 상세한 설명을 생략할 수 있고, 이에 의해 본 발명이 제한되지는 않는다. 본 발명은 후술하는 특허청구범위의 기재 및 그로부터 해석되는 균등 범주 내에서 다양한 변형 및 응용이 가능하다.
또한, 본 명세서에서 사용되는 용어(terminology)들은 본 발명의 바람직한 실시예를 적절히 표현하기 위해 사용된 용어들로서, 이는 사용자, 운용자의 의도 또는 본 발명이 속하는 분야의 관례 등에 따라 달라질 수 있다. 따라서, 본 용어들에 대한 정의는 본 명세서 전반에 걸친 내용을 토대로 내려져야 할 것이다. 명세서 전체에서, 어떤 부분이 어떤 구성요소를 "포함"한다고 할 때, 이는 특별히 반대되는 기재가 없는 한 다른 구성요소를 제외하는 것이 아니라 다른 구성 요소를 더 포함할 수 있는 것을 의미한다.
본 명세서 전반을 통하여, 천연적으로 존재하는 아미노산에 대한 통상의 1문자 및 3문자 코드가 사용될 뿐만 아니라 Aib(α-아미노이소부티르산), Sar(N-methylglycine) 등과 같은 다른 아미노산에 대해 일반적으로 허용되는 3문자 코드가 사용된다. 또한 본 발명에서 약어로 언급된 아미노산은 하기와 같이 IUPAC-IUB 명명법에 따라 기재되었다:
알라닌: A, 아르기닌: R, 아스파라긴: N, 아스파르트산: D, 시스테인: C, 글루탐산: E, 글루타민: Q, 글리신: G, 히스티딘: H, 이소류신: I, 류신: L, 리신: K, 메티오닌: M, 페닐알라닌: F, 프롤린: P, 세린: S, 트레오닌: T, 트립토판: W, 티로신: Y 및 발린: V.
일 측면에서, 본 발명은 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편에 관한 것이다.
일 구현예에서, 상기 항체는 IgG일 수 있으며, 면역학적 활성을 가진 단편은 Fab, Fd, Fab', dAb, F(ab'), F(ab')2, scFv(single chain fragment variable), Fv, 단일쇄 항체, Fv 이량체, 상보성 결정 영역 단편, 인간화 항체, 키메라 항체 및 디아바디(diabody)로 이루어진 군으로부터 선택되는 어느 하나일 수 있으며, scFv인 것이 더욱 바람직하다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 1 내지 3의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRH(Complementarity determining regions Heavy chain)1, 서열번호 4 내지 7의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRH2, 및 서열번호 8 내지 15의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는 (b) 서열번호 16 내지 21의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRL(Complementarity determining regions Light chain)1, 서열번호 22 내지 27의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRL2, 및 서열번호 28 내지 32의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRL3를 포함하는 VL 도메인을 포함할 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 33 내지 36의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR1, 서열번호 37 내지 41의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR2, 서열번호 42 내지 44의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR3, 및 서열번호 45 또는 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 47 내지 52의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR1, 서열번호 53 내지 56의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR2, 서열번호 57 내지 63의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR3 및 서열번호 64 내지 67의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR4를 포함하는 VL 도메인을 포함할 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 33의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 37의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 11의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 47의 아미노산 서열을 포함하는 FR1, 서열번호 16의 아미노산 서열을 포함하는 CDRL1, 서열번호 53의 아미노산 서열을 포함하는 FR2, 서열번호 24의 아미노산 서열을 포함하는 CDRL2, 서열번호 57의 아미노산 서열을 포함하는 FR3, 서열번호 28의 아미노산 서열을 포함하는 CDRL3 및 서열번호 64의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS40일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 34의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 37의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 11의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 49의 아미노산 서열을 포함하는 FR1, 서열번호 17의 아미노산 서열을 포함하는 CDRL1, 서열번호 54의 아미노산 서열을 포함하는 FR2, 서열번호 23의 아미노산 서열을 포함하는 CDRL2, 서열번호 59의 아미노산 서열을 포함하는 FR3, 서열번호 30의 아미노산 서열을 포함하는 CDRL3 및 서열번호 65의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS48일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 33의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 37의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 8의 아미노산 서열을 포함하는 CDRH3 및 서열번호 45의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 47의 아미노산 서열을 포함하는 FR1, 서열번호 16의 아미노산 서열을 포함하는 CDRL1, 서열번호 53의 아미노산 서열을 포함하는 FR2, 서열번호 22의 아미노산 서열을 포함하는 CDRL2, 서열번호 57의 아미노산 서열을 포함하는 FR3, 서열번호 28의 아미노산 서열을 포함하는 CDRL3 및 서열번호 64의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS116일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 33의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 37의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 9의 아미노산 서열을 포함하는 CDRH3 및 서열번호 45의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 47의 아미노산 서열을 포함하는 FR1, 서열번호 16의 아미노산 서열을 포함하는 CDRL1, 서열번호 53의 아미노산 서열을 포함하는 FR2, 서열번호 22의 아미노산 서열을 포함하는 CDRL2, 서열번호 57의 아미노산 서열을 포함하는 FR3, 서열번호 28의 아미노산 서열을 포함하는 CDRL3 및 서열번호 64의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS144일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 34의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 38의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 10의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 48의 아미노산 서열을 포함하는 FR1, 서열번호 17의 아미노산 서열을 포함하는 CDRL1, 서열번호 54의 아미노산 서열을 포함하는 FR2, 서열번호 23의 아미노산 서열을 포함하는 CDRL2, 서열번호 58의 아미노산 서열을 포함하는 FR3, 서열번호 29의 아미노산 서열을 포함하는 CDRL3 및 서열번호 65의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS140일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은, (a) 서열번호 34의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 37의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 11의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 49의 아미노산 서열을 포함하는 FR1, 서열번호 16의 아미노산 서열을 포함하는 CDRL1, 서열번호 54의 아미노산 서열을 포함하는 FR2, 서열번호 24의 아미노산 서열을 포함하는 CDRL2, 서열번호 59의 아미노산 서열을 포함하는 FR3, 서열번호 28의 아미노산 서열을 포함하는 CDRL3 및 서열번호 65의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS40-1일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 33의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 37의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 11의 아미노산 서열을 포함하는 CDRH3 및 서열번호 45의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 47의 아미노산 서열을 포함하는 FR1, 서열번호 17의 아미노산 서열을 포함하는 CDRL1, 서열번호 53의 아미노산 서열을 포함하는 FR2, 서열번호 23의 아미노산 서열을 포함하는 CDRL2, 서열번호 57의 아미노산 서열을 포함하는 FR3, 서열번호 30의 아미노산 서열을 포함하는 CDRL3 및 서열번호 64의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS40-1일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 35의 아미노산 서열을 포함하는 FR1, 서열번호 2의 아미노산 서열을 포함하는 CDRH1, 서열번호 39의 아미노산 서열을 포함하는 FR2, 서열번호 6의 아미노산 서열을 포함하는 CDRH2, 서열번호 43의 아미노산 서열을 포함하는 FR3, 서열번호 23의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 50의 아미노산 서열을 포함하는 FR1, 서열번호 18의 아미노산 서열을 포함하는 CDRL1, 서열번호 55의 아미노산 서열을 포함하는 FR2, 서열번호 25의 아미노산 서열을 포함하는 CDRL2, 서열번호 60의 아미노산 서열을 포함하는 FR3, 서열번호 31의 아미노산 서열을 포함하는 CDRL3 및 서열번호 66의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS9일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 33의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 41의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 15의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 52의 아미노산 서열을 포함하는 FR1, 서열번호 21의 아미노산 서열을 포함하는 CDRL1, 서열번호 56의 아미노산 서열을 포함하는 FR2, 서열번호 27의 아미노산 서열을 포함하는 CDRL2, 서열번호 63의 아미노산 서열을 포함하는 FR3, 서열번호 32의 아미노산 서열을 포함하는 CDRL3 및 서열번호 67의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS19일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 36의 아미노산 서열을 포함하는 FR1, 서열번호 3의 아미노산 서열을 포함하는 CDRH1, 서열번호 40의 아미노산 서열을 포함하는 FR2, 서열번호 7의 아미노산 서열을 포함하는 CDRH2, 서열번호 44의 아미노산 서열을 포함하는 FR3, 서열번호 13의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 51의 아미노산 서열을 포함하는 FR1, 서열번호 19의 아미노산 서열을 포함하는 CDRL1, 서열번호 54의 아미노산 서열을 포함하는 FR2, 서열번호 26의 아미노산 서열을 포함하는 CDRL2, 서열번호 61의 아미노산 서열을 포함하는 FR3, 서열번호 30의 아미노산 서열을 포함하는 CDRL3 및 서열번호 65의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS30일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 (a) 서열번호 36의 아미노산 서열을 포함하는 FR1, 서열번호 3의 아미노산 서열을 포함하는 CDRH1, 서열번호 40의 아미노산 서열을 포함하는 FR2, 서열번호 7의 아미노산 서열을 포함하는 CDRH2, 서열번호 44의 아미노산 서열을 포함하는 FR3, 서열번호 14의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는 (b) 서열번호 51의 아미노산 서열을 포함하는 FR1, 서열번호 20의 아미노산 서열을 포함하는 CDRL1, 서열번호 54의 아미노산 서열을 포함하는 FR2, 서열번호 23의 아미노산 서열을 포함하는 CDRL2, 서열번호 62의 아미노산 서열을 포함하는 FR3, 서열번호 30의 아미노산 서열을 포함하는 CDRL3 및 서열번호 65의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는 JS41일 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 서열번호 68의 아미노산 서열을 포함하는 CL, 서열번호 69의 아미노산 서열을 포함하는 CH1, 서열번호 70의 아미노산 서열을 포함하는 CH2 또는 서열번호 71의 아미노산 서열을 포함하는 CH3 서열을 포함할 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 Fc 알파 수용체의 세포외부영역(Extra Cellular Domain, ECD)에 특이적으로 결합할 수 있으며, Fc 알파 수용체의 세포외부영역은 서열번호 72의 아미노산 서열을 포함할 수 있다.
일 구현예에서, 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편은 효과기 작용을 증가시킬 수 있으며, 백혈구 및 CD89-보유 세포주의 식세포작용 (antibody-dependent cellular phagocytosis, ADCP) 또는 항체-매개성 세포독성작용 (antibody dependent cellular cytotoxicity, ADCC)을 증가시킬 수 있다.
본 발명에서 용어, "Fc 알파 수용체(Fcα수용체)"는 IgA 수용체 또는 CD89로도 혼용될 수 있다.
상기 항체는 전체(whole) 항체 형태일 뿐 아니라 항체 분자의 기능적인 단편을 포함한다. 전체 항체는 2개의 전체 길이의 경쇄(light chain) 및 2개의 전체 길이의 중쇄(heavy chain)를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합(disulfide bond)으로 연결되어 있다. 항체 분자의 기능적인 단편이란 항원 결합 기능을 보유하고 있는 단편을 뜻하며, 항체 단편의 예는 (a) 경쇄의 가변영역(VL) 및 중쇄의 가변영역(VH)과 경쇄의 불변영역(CL) 및 중쇄의 첫번째 불변 영역(CH1)으로 이루어진 Fab 단편; (b) VH 및 CH1 도메인으로 이루어진 Fd 단편; (c) 단일 항체의 VL 및 VH 도메인으로 이루어진 Fv 단편; (d) VH 도메인으로 이루어진 dAb 단편(Ward ES et al., Nature 341:544-546 (1989)]; (e) 분리된 CDR 영역; (f) 2개의 연결된 Fab 단편을 포함하는 2가 단편인 F(ab')2 단편; (g) VH 도메인 및 VL 도메인이 항원 결합 부위를 형성하도록 결합시키는 펩타이드 링커에 의해 결합된 단일쇄 Fv 분자(scFv); (h) 이특이적인 단일쇄 Fv 이량체(PCT/US92/09965) 및 (i) 유전자 융합에 의해 제작된 다가 또는 다특이적인 단편인 디아바디(diabody) WO94/13804) 등을 포함한다.
본 발명의 항체 또는 이의 면역학적 활성을 가진 단편은 동물 유래 항체, 키메릭 항체, 인간화 항체, 인간 항체, 및 이들의 면역학적 활성을 가진 단편으로 이루어진 군에서 선택된 것일 수 있다. 상기 항체는 재조합적 또는 합성적으로 생산된 것일 수 있다.
원하는 항원을 피면역 동물에게 면역시켜 생산하는 동물 유래 항체는 일반적으로 치료 목적으로 인간에 투여시 면역거부반응이 일어날 수 있으며, 이러한 면역거부반응을 억제하고자 키메릭 항체(chimeric antibody)가 개발되었다. 키메릭 항체는 유전공학적 방법을 이용하여 항-아이소타입(anti-isotype) 반응의 원인이 되는 동물 유래 항체의 불변 영역을 인간 항체의 불변 영역으로 치환한 것이다. 키메릭 항체는 동물 유래 항체에 비하여 항-아이소타입 반응에 있어서 상당 부분 개선되었으나, 여전히 동물 유래 아미노산들이 가변 영역에 존재하고 있어 잠재적인 항-이디오타입(anti-idiotypic) 반응에 대한 부작용을 내포하고 있다. 이러한 부작용을 개선하고자 개발된 것이 인간화 항체(humanized antibody)이다. 이는 키메릭 항체의 가변 영역 중 항원의 결합에 중요한 역할을 하는 CDR(complementaritiy determining regions) 부위를 인간 항체 골격(framework)에 이식하여 제작된다.
인간화 항체를 제작하기 위한 CDR 이식(grafting) 기술에 있어서 가장 중요한 것은 동물 유래 항체의 CDR 부위를 가장 잘 받아들일 수 있는 최적화된 인간 항체를 선정하는 것이며, 이를 위하여 항체 데이터베이스의 활용, 결정구조(crystal structure)의 분석, 분자모델링 기술 등이 활용된다. 그러나, 최적화된 인간 항체 골격에 동물 유래 항체의 CDR 부위를 이식할지라도 동물 유래 항체의 골격에 위치하면서 항원 결합에 영향을 미치는 아미노산이 존재하는 경우가 있기 때문에, 항원 결합력이 보존되지 못하는 경우가 상당수 존재하므로, 항원 결합력을 복원하기 위한 추가적인 항체 공학 기술의 적용은 필수적이라고 할 수 있다.
상기 항체 또는 이의 면역학적 활성을 가진 단편은 생체에서 분리된 (생체에 존재하지 않는) 것 또는 비자연적으로 생산(non-naturally occurring)된 것일 수 있으며, 예컨대, 합성적 또는 재조합적으로 생산된 것일 수 있다.
본 발명에서 "항체"라 함은, 면역계 내에서 항원의 자극에 의하여 만들어지는 물질을 의미하는 것으로서, 그 종류는 특별히 제한되지 않으며, 자연적 또는 비자연적(예컨대, 합성적 또는 재조합적)으로 얻어질 수 있다. 항체는 생체 외뿐 아니라 생체 내에서도 매우 안정하고 반감기가 길기 때문에 대량 발현 및 생산에 유리하다. 또한, 항체는 본질적으로 다이머(dimer) 구조를 가지므로 접착능(avidity)이 매우 높다. 완전한 항체는 2개의 전장(full length) 경쇄 및 2개의 전장 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 이황화 결합으로 연결되어 있다. 항체의 불변 영역은 중쇄 불변 영역과 경쇄 불변 영역으로 나뉘어지며, 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고, 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변 영역은 카파(κ) 및 람다(λ) 타입을 가진다.
본 발명에서 용어, "중쇄(heavy chain)"는 항원에 특이성을 부여하기 위해 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VH 및 3개의 불변 영역 도메인 CH1 , CH2 및 CH3 과 힌지(hinge)를 포함하는 전장 중쇄 및 이의 단편을 모두 포함하는 의미로 해석된다. 또한, 용어 "경쇄(light chain)"는 항원에 특이성을 부여하기 위한 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전장 경쇄 및 이의 단편을 모두 포함하는 의미로 해석된다.
본 발명에서 용어, "가변 영역(variable region) 또는 가변 부위 (variable domain)"는 항원과 특이적으로 결합하는 기능을 수행하면서 서열상의 많은 변이를 보이는 항체 분자의 부분을 의미하고, 가변 영역에는 상보성 결정 영역인 CDR1, CDR2 및 CDR3가 존재한다. 상기 CDR 사이에는 프레임 워크 영역(framework region, FR) 부분이 존재하여 CDR 고리를 지지해주는 역할을 한다. 상기 "상보성 결정 영역"은 항원의 인식에 관여하는 고리모양의 부위로서 이 부위의 서열이 변함에 따라 항체의 항원에 대한 특이성이 결정된다.
본 발명에서 사용되는 용어 "scFv(single chain fragment variable)"는 유전자 재조합을 통해 항체의 가변영역만을 발현시켜 만든 단쇄항체를 말하며, 항체의 VH 영역과 VL 영역을 짧은 펩티드 사슬로 연결한 단일쇄 형태의 항체를 말한다. 상기 용어 "scFv"는 달리 명시되지 않거나, 문맥상 달리 이해되는 것이 아니라면, 항원 결합 단편을 비롯한 scFv 단편을 포함하고자 한다. 이는 통상의 기술자에게 자명한 것이다.
본 발명에서 용어, "상보성결정영역(complementarity determining region, CDR)"은 면역글로불린의 중쇄 및 경쇄의 고가변 영역 (hypervariable region)의 아미노산 서열을 의미한다. 중쇄 및 경쇄는 각각 3개의 CDR을 포함할 수 있다 (CDRH1, CDRH2,CDRH3 및 CDRL1, CDRL2, CDRL3). 상기 CDR은 항체가 항원 또는 항원결정부위에 결합하는 데 있어서 주요한 접촉 잔기를 제공할 수 있다.
본 발명에서, 용어, "특이적으로 결합" 또는 "특이적으로 인식"은 당업자에게 통상적으로 공지되어 있는 의미와 동일한 것으로서, 항원 및 항체가 특이적으로 상호작용하여 면역학적 반응을 하는 것을 의미한다.
본 발명에서 용어, "항원결합단편"은 면역글로불린 전체 구조에 대한 그의 단편으로, 항원이 결합할 수 있는 부분을 포함하는 폴리펩타이드의 일부를 의미한다. 예를 들어, scFv, (scFv) 2 , scFv-Fc, Fab, Fab' 또는 F(ab') 2 일 수 있으나, 이에 한정되지 않는다. 상기 항원결합단편 중 Fab는 경쇄 및 중쇄의 가변 영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab') 2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변 영역 및 경쇄 가변 부위만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 당업계에 널리 공지되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변 부위와 경쇄 가변 부위가 연결되어 있고 단쇄 Fv(single-chain Fv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 단쇄의 가변 영역이 공유 결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 상기 링커는 1 내지 100개 또는 2 내지 50개의 임의의 아미노산으로 이루어진 펩타이드 링커일 수 있으며, 당업계에 적절한 서열이 알려져 있다. 상기 항원결합단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab') 2 단편을 얻을 수 있다), 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명에서 용어 "힌지 영역(hunge region)"은 항체의 중쇄에 포함되어 있는 영역으로서, CH1 및 CH2 영역 사이에 존재하며, 항체 내 항원 결합 부위의 유연성(flexibility)를 제공하는 기능을 하는 영역을 의미한다. 예컨대, 상기 힌지는 인간 항체로부터 유래한 것일 수 있으며, 구체적으로, IgA, IgE, 또는 IgG, 예컨대, IgG1, IgG2, IgG3, 또는 IgG4로부터 유래한 것일 수 있다.
일 측면에서, 본 발명은 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편, 및 Fc 알파 수용체 이외의 표적 항원에 결합하는 부분을 포함하는 이중특이적 또는 다중특이적 항체에 관한 것이다.
일 구현예에서, 표적 항원에 결합하는 부분이 항체 또는 이의 면역학적 활성을 가진 단편을 포함할 수 있으며, 면역학적 활성을 가진 단편은 Fab, Fd, Fab', dAb, F(ab'), F(ab')2, scFv, Fv, 단일쇄 항체, Fv 이량체, 상보성 결정 영역 단편, 인간화 항체, 키메라 항체 및 디아바디(diabody)로 이루어진 군으로부터 선택되는 어느 하나일 수 있고, scFv 또는 Fab인 것이 더욱 바람직하다.
일 구현예에서, 표적 항원은 17-1A 항원, GD3 갱글리오시드 R24, EGFRvⅢ, PSMA, PSCA, HLA-DR, EpCAM, MUC1 코어 단백질, 이상 글리코실화 MUC1, ED-B 도메인을 함유하는 피브로넥틴 이형, HER2/neu, 암종배아성 항원(CEA), 가스트린-방출 펩티드(GRP) 수용체 항원, 뮤신(mucine) 항원, 표피 성장 인자 수용체(EGF-R), HER3, HER4, MAGE 항원, SART 항원, MUC1 항원, c-erb-2 항원, TAG 72, 탄산 무수화효소 IX(carbonic anhydrase IX), 알파-태아단백질(alpha-fetoprotein), A3, A33 항체에 특이적인 항원, Ba 733, BrE3-항원, CA125, CDl, CD1a, CD3, CD5, CDl5, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD33, CD38, CD40, CD45, CD52, CD74, CD79a, CD80, CD138, 결장-특이적 항원-p(CSAp), CSAp, EGP-1, EGP-2, Ep-CAM, FIt-1, Flt-3, 폴산염 수용체(folate receptor), HLA-DR, 인간 융모성 성선자극호르몬(HCG) 및 그 소단위체들, 저산소증 유도 인자(HIF-I), Ia, IL-2, IL-6, IL-8, 인슐린 성장 인자-1(IGF-1), KC4-항원, KS-1-항원, KSl-4, Le-Y, 대식세포 억제 인자(MIF), MAGE, MUCl, MUC2, MUC3, MUC4, NCA66, NCA95, NCA90, PAM-4 항체에 특이적인 항원, 태반 성장 인자, p53, 전립선 산성 포스파타제(prostatic acid phosphatase), PSA, RS5, SlOO, TAC, 테나신(tenascin), TRAIL 수용체들, Tn 항원, 톰슨-프리덴라이히(Thomson-Friedenreich) 항원들, 종양 괴사 항원들, VEGF, ED-B 피브로넥틴(fibronectin), 혈관형성 표지(angiogenesis marker), 종양유전자 표지(oncogene marker) 또는 종양유전자 생성물로 이루어지는 군으로부터 선택되는 어느 하나 이상일 수 있으며, 종양유전자는 아폽토시스(Apoptosis) 관련 유전자, 전사인자(Trnscription Factor) 유전자, 전이(Metastasis) 관련 유전자, 혈관신생(Angiogenesis) 관련 유전자 또는 티로신-카이네이즈(Tyrosine-Kinase) 유전자일 수 있다.
일 구현예에서, 상기 아폽토시스 관련 유전자는 ABL1, AKT1, AKT2, BARD1, BAX, BCL11B, BCL2, BCL2A1, BCL2L1, BCL2L12, BCL3, BCL6, BIRC2, BIRC3, BIRC5, BRAF, CARD11, CAV1, CBL, CDC25A, CDKN1A, CFLAR, CNR2, CTNNB1, CUL4A, DAXX, DDIT3, E2F1, E2F3, E2F5, ESPL1, FOXO1, HDAC1, HSPA5, IGF1R, IGF2, JUN, JUNB, JUND, MALT1, MAP3K7, MCL1, MDM2, MDM4, MYB, MYC, NFKB2, NPM1, NTRK1, PAK1, PAX3, PML, PRKCA, PRKCE, PTK2B, RAF1, RHOA, TGFB1, TNFRSF1B, TP73, TRAF6, YWHAG, YWHAQ 또는 YWHAZ일 수 있으며; 상기 전사인자 유전자는 AR, ARID3A, ASCL1, ATF1, ATF3, BCL11A, BCL11B, BCL3, BCL6, CDC5L, CDX2, CREB1, CUX1, DDIT3, DLX5, E2F1, E2F3, E2F5, ELF4, ELK1, ELK3, EN2, ERG, ETS1, ETS2, ETV1, ETV3, ETV4, ETV6, FEV, FEZF1, FLI1, FOS, FOSL1, FOXA1, FOXG1, FOXM1, FOXO1, FOXP1, FOXQ1, GATA1, GATA6, GFI1, GFI1B, GLI1, GLI2, GLI3, HES6, HHEX, HLF, HMGA1, HMGA2, HOXA1, HOXA9, HOXD13, HOXD9, ID1, ID2, IKZF1, IRF2, IRF4, JUN, JUNB, JUND, KAT6A, KDM2A, KDM5B, KLF2, KLF4, KLF5, KLF6, KLF8, KMT2A, LEF1, LHX1, LMX1B, MAF, MAFA, MAFB, MBD1, MECOM, MEF2C, MEIS1, MITF, MYB, MYC, MYCL, MYCN, NANOG, NCOA3, NFIB, NFKB2, NKX2-1, OTX2, PATZ1, PAX2, PAX3, PAX4, PAX8, PBX1, PBX2, PITX2, PLAG1, PLAGL2, PPARG, PPP1R13L, PRDM10, PRDM13, PRDM14, PRDM15, PRDM16, PRDM6, PRDM8, PRDM9, RARA, REL, RERE, RUNX1, RUNX3, SALL4, SATB1, SFPQ, SIX1, SNAI1, SOX2, SOX4, SPI1, SREBF1, STAT3, TAF1, TAL1, TAL2, TBX2, TBX3, TCF3, TFCP2, TFE3, THRA, TLX1, TP63, TP73, TWIST1, WT1, YBX1, YY1, ZBTB16, ZBTB7A, ZIC2, ZNF217 또는 ZNF268일 수 있고; 상기 전이 관련 유전자는 AKT1, AKT2, AR, CBL, CDH1, CRK, CSF1, CTNNB1, CTTN, CXCR4, EGFR, FGFR1, FLT3, FYN, GLI1, ILK, ITGA3, JAK2, MET, PDGFRB, PLXNB1, PRKCI, PTCH1, PTPN11, RAC1, RHOA, RHOC, ROCK1, SMO, SNAI1, SRC, TCF3 또는 WT1일 수 있으며; 상기 혈관신생 관련 유전자는 BRAF, CAV1, CTGF, EGFR, ERBB2, ETS1, FGF4, FGF6, FGFR1, FGFR3, FGFR4, ID1, NRAS, PDGFB, PDGFRA, PDGFRB 또는 SPARC일 수 있고; 상기 티로신-카이네이즈 유전자는 ABL1, ABL2, ALK, AXL, BLK, EGFR, EPHA2, ERBB2, ERBB3, ERBB4, FES, FGFR1, FGFR2, FGFR3, FGFR4, FGR, FLT3, FYN, ITK, JAK1, JAK2, KIT, LCK, MERTK, MET, MST1R, NTRK1, NTRK3, PDGFRA, PDGFRB, PTK2B, PTK7, RET, ROS1, SRC, SYK, TEC 또는 YES1일 수 있다.
일 구현예에서, 종양유전자는 SEPTIN9, ACOD1, ACTN4, ADAM28, ADAM9, ADGRF1, ADRBK2, AFF1, AFF3, AGAP2, AGFG1, AGRN, AHCYL1, AHI1, AIMP2, AKAP13, AKAP9, AKIRIN2, AKTIP, ALDH1A1, ALL1, ANIB1, ANP32C, ANP32D, AQP1, ARAF, ARHGEF1, ARHGEF2, ARHGEF5, ASPSCR1, AURKA, BAALC, BAIAP2L1, BANP, BCAR4, BCKDHB, BCL9, BCL9L, BCR, BMI1, BMP7, BOC, BRD4, BRF2, CABIN1, CAMK1D, CAPG, CBFB, CBLB, CBLL1, CBX7, CBX8, CCDC28A, CCDC6, CCNB1, CCNB2, CCND1, CCNE1, CCNL1, CD24, CDC25C, CDC6, CDH17, CDK1, CDK14, CDK4, CDK5R2, CDK6, CDK8, CDKN1B, CDKN3, CDON, CEACAM6, CENPW, CHD1L, CHIC1, CHL1, CKS1B, CMC4, CNTN2, COPS3, COPS5, CRKL, CRLF2, CROT, CRTC1, CRYAB, CSF1R, CSF3, CSF3R, CSNK2A1, CSNK2A2, CT45A1, CTBP2, CTNND2, CTSZ, CUL7, CXCL1, CXCL2, CXCL3, CYGB, CYP24A1, DCD, DCUN1D1DDB2, DDHD2, DDX6, DEK, DIS3, DNPH1, DPPA2, DPPA4, DSG3, DUSP12, DUSP26, ECHS1, ECT2, EEF1A1, EEF1A2, EEF1D, EIF3E, EIF3I, EIF4E, EIF5A2, ELAVL1, ELL, EML4, EMSY, ENTPD5, EPCAM, EPS8, ERAS, ERGIC1, ERVW-1, EVI2A, EVI5, EWSR1, EZH2, FAM189B, FAM72A, FAM83D, FASN, FDPS, FGF10, FGF3, FGF5, FGF8, FR1OP, FHL2, FIP1L1, FNDC3B, FRAT1, FUBP1, FUS, FZD2, GAB2, GAEC1, GALNT10, GALR2, GLO1, GMNN, GNA12, GNA13, GNAI2, GNAQ, GNAS, GOLPH3, GOPC, GPAT4, GPM6A, GPM6B, GPR132, GREM1, GRM1, GSK3A, GSM1, H19, HAS1, HAX1, HDGFRP2, HMGN5, HNRNPA1, HOTAIR, HOTTIP, HOXA-AS2, HRAS, HSPA1A, HSPA4, HSPB1, HULC, IDH1, IFNG, IGF2BP1, IKBKE, IL7R, INPPL1, INTS1, INTS2, INTS3, INTS4, INTS5, INTS7, INTS8, IRS2, IST1, JUP, KDM4C, KIAA0101, KIAA1524, KIF14, KRAS, KSR2, LAMTOR5, LAPTM4B, LCN2, LDHB, LETMD1, LIN28A, LIN28B, LMO1, LMO2, LMO3, LMO4, LSM1, LUADT1, MACC1, MACROD1, MAGEA11, MALAT1, MAML2, MAP3K8, MAPRE1, MAS1, MCC, MCF2, MCF2L, MCTS1, MEFV, MFHAS1, MFNG, MIEN1, MINA, MKL2, MLANA, MLLT1, MLLT11, MLLT3, MLLT4, MMP12, MMS22L, MN1, MNAT1, MOS, MPL, MPST, MRAS, MRE11A, MSI1, MTCP1, MTDH, MTOR, MUC1, MUC4, MUM1, MYD88, NAAA, NANOGP8, NBPF12, NCOA4, NEAT1, NECTIN4, NEDD4, NEDD9, NET1, NINL, NME1, NOTCH1, NOTCH4, NOV, NSD1, NUAK2, NUP214, NUP98, NUTM1, OLR1, PA2G4, PADI2, PAK7, PARK7, PARM1, PBK, PCAT1, PCAT5, PDGFA, PDZK1IP1, PELP1, PFN1P3, PIGU, PIK3CA, PIK3R1, PIM1, PIM2, PIM3, PIR, PIWIL1, PLAC8, PLK1, PPM1D, PPP1R10, PPP1R14A, PPP2R1A, PRAME, PRDM12, PRMT5, PSIP1, PSMD10, PTCH2, PTMA, PTP4A1, PTP4A2, PTP4A3, PTTG1, PTTG1IP, PTTG2, PVT1, RAB11A, RAB18, RAB22A, RAB23, RAB8A, RALGDS, RAP1A, RASSF1, RBM14, RBM15, RBM3, RBMY1A1, RFC3, RGL4, RGR, RHO, RING1, RINT1, RIT1, RNF43, RPL23, RRAS, RRAS2, RSF1, RUNX1T1, S100A4, S100A7, S100A8, SAG, SART3, SBSN, SEA, SEC62, SERTAD1, SERTAD2, SERTAD3, SET, SETBP1, SETDB1, SGK1, SIRT1, SIRT6, SKI, SKIL, SKP2, SLC12A5, SLC3A2, SMR3B, SMURF1, SNCG, SNORA59A, SNORA80E, SPAG9, SPATA4, SPRY2, SQSTM1, SRSF1, SRSF2, SRSF3, SRSF6, SS18, SSX1, SSX2, SSX2B, STIL, STMN1, STRA6, STYK1, SUZ12, SWAP70, SYT1, TAC1, TACSTD2, TAF15, TALDO1, TAZ, TBC1D1, TBC1D15, TBC1D3, TBC1D3C, TBC1D7, TCL1A, TCL1B, TCL6, TCP1, TFG, TGM3, TINCR, TKTL1, TLE1, TMEM140, TMPOP2, TMPRSS2, TNS4, TPD52, TPR, TRE17, TREH, TRIB1, TRIB2, TRIM28, TRIM32, TRIM8, TRIO, TRIP6, TSPAN1, TSPY1, TXN, TYMS, TYRP1, UBE2C, UBE3C, UCA1, UCHL1, UHRF1, URI1, USP22, USP4, USP6, VAV1, VAV2, VAV3, VIM, WAPL, WHSC1, WHSC1L1, WISP1, WNT1, WNT10A, WNT10B, WNT2, WNT3, WNT5A, WWTR1, XCL1, XIAP, YAP1, YEATS4, YY1AP1, ZEB1-AS1, ZFAND4, ZFAS1, ZMYM2, ZNF703 또는 ZNHIT6일 수 있다.
일 구현예에서, 표적 항원은 세포 표면 항원 또는 자가항원일 수 있으며, 세포 표면 항원은 CEA, ED-B 피브로넥틴, CD20, CD22, CDl9, EGFR, IGFlR, VEFGRl/Flt-1, VEGFR2/KDR, VEGRF3/Flt-4, HER2/neu, CD30, CD33, CD3, CD16, CD64, CD89, CD2, 아데노바이러스 섬유 놉, PfMSP-1, HN/NDV, EpCAM/17-lA, hTR, IL-2R/Tac, CAl9-9, MUCl, HLA 클래스 II, GD2, G250, TAG-72, PSMA, CEACAM6, HMWMAA, CD40, Ml3 외피 단백질 및 GPIIb/IIIa로 이루어지는 군으로부터 선택되는 어느 하나 이상일 수 있다.
일 측면에서, 본 발명은 본 발명의 항체 또는 이의 면역학적 활성을 가진 단편, 또는 본 발명의 이중특이적 또는 다중특이적 항체를 코딩하는 단리된 핵산 분자, 이를 포함하는 벡터, 및 이로 형질전환된 숙주 세포에 관한 것이다.
본 발명의 핵산 분자는 단리된 것이거나 재조합된 것일 수 있으며, 단일쇄 및 이중쇄 형태의 DNA 및 RNA뿐만 아니라 대응하는 상보성 서열이 포함된다. 단리된 핵산은 천연 생성 원천에서 단리된 핵산의 경우, 핵산이 단리된 개체의 게놈에 존재하는 주변 유전 서열로부터 분리된 핵산이다. 주형으로부터 효소적으로 또는 화학적으로 합성된 핵산, 예컨대 PCR 산물, cDNA 분자, 또는 올리고뉴클레오타이드의 경우, 이러한 절차로부터 생성된 핵산이 단리된 핵산분자로 이해될 수 있다. 단리된 핵산분자는 별도 단편의 형태 또는 더 큰 핵산 구축물의 성분으로서의 핵산 분자를 나타낸다. 핵산은 다른 핵산 서열과 기능적 관계로 배치될 때 작동가능하게 연결된다. 예를 들면, 전서열 또는 분비 리더(leader)의 DNA는 폴리펩타이드가 분비되기 전의 형태인 전단백질(preprotein)로서 발현되는 경우 폴리펩타이드의 DNA에 작동가능하게 연결되고, 프로모터 또는 인핸서는 폴리펩타이드 서열의 전사에 영향을 주는 경우 코딩 서열에 작동가능하게 연결되며, 또는 리보솜 결합 부위는 번역을 촉진하도록 배치될 때 코딩 서열에 작동가능하게 연결된다. 일반적으로 작동가능하게 연결된은 연결될 DNA 서열들이 인접하여 위치함을 의미하며, 분비 리더의 경우 인접하여 동일한 리딩 프레임 내에 존재하는 것을 의미한다. 그러나 인핸서는 인접하여 위치할 필요는 없다. 연결은 편리한 제한 효소 부위에서 라이게이션에 의해 달성된다. 이러한 부위가 존재하지 않는 경우, 합성 올리고뉴클레오타이드 어댑터 또는 링커를 통상적인 방법에 따라 사용한다.
본 발명의 항체 또는 이의 면역학적 활성을 가진 단편, 또는 본 발명의 이중특이적 또는 다중특이적 항체를 코딩하는 단리된 핵산 분자는 코돈의 축퇴성(degeneracy)으로 인하여 또는 상기 항체를 발현시키고자 하는 생물에서 선호되는 코돈을 고려하여, 코딩영역으로부터 발현되는 항체의 아미노산 서열을 변화시키지 않는 범위 내에서 코딩영역에 다양한 변형이 이루어질 수 있고, 코딩영역을 제외한 부분에서도 유전자의 발현에 영향을 미치지 않는 범위 내에서 다양한 변형 또는 수식이 이루어질 수 있으며, 그러한 변형 유전자 역시 본 발명의 범위에 포함됨을 당업자는 잘 이해할 수 있을 것이다. 즉, 본 발명의 핵산 분자는 이와 동등한 활성을 갖는 단백질을 코딩하는 한, 하나 이상의 핵산 염기가 치환, 결실, 삽입 또는 이들의 조합에 의해 변이될 수 있으며, 이들 또한 본 발명의 범위에 포함된다. 이러한 핵산 분자의 서열은 단쇄 또는 이중쇄일 수 있으며, DNA 분자 또는 RNA(mRNA)분자일 수 있다.
본 발명에 따른 본 발명의 항체 또는 이의 면역학적 활성을 가진 단편, 또는 본 발명의 이중특이적 또는 다중특이적 항체를 코딩하는 단리된 핵산 분자는 단백질 발현을 위해 발현벡터에 삽입될 수 있다. 발현벡터는, 통상 조절 또는 제어 (regulatory) 서열, 선별마커, 임의의 융합 파트너, 및/또는 추가적 요소와 작동가능하게 연결된, 즉, 기능적 관계에 놓인 단백질을 포함한다. 적절한 상태에서, 핵산으로 형질전환된 숙주세포, 바람직하게는, 본 발명의 항체 또는 이의 면역학적 활성을 가진 단편, 또는 본 발명의 이중특이적 또는 다중특이적 항체를 코딩하는 단리된 핵산 분자 함유 발현벡터를 배양하여 단백질 발현을 유도하는 방법에 의해 본 발명의 항체 또는 이의 면역학적 활성을 가진 단편, 또는 본 발명의 이중특이적 또는 다중특이적 항체가 생산될 수 있다. 포유류 세포, 박테리아, 곤충 세포, 및 효모를 포함하는 다양한 적절한 숙주세포가 사용될 수 있으나, 이에 제한하는 것은 아니다. 외인성 핵산을 숙주세포에 도입하는 방법은 당해 기술분야에 공지되어 있으며, 사용되는 숙주세포에 따라 달라질 것이다. 바람직하게는, 생산비가 저렴하여 산업적 이용가치가 높은 대장균을 숙주세포로 생산할 수 있다.
본 발명의 벡터는 플라스미드 벡터, 코즈미드 벡터, 박테리오 파아지 벡터 및 바이러스 벡터 등을 포함하나 이에 제한되지 않는다. 적합한 벡터는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 폴리아데닐화 시그널 및 인핸서 같은 발현 조절 엘리먼트 외에도 막 표적화 또는 분비를 위한 시그널 서열 또는 리더 서열을 포함하며 목적에 따라 다양하게 제조될 수 있다. 벡터의 프로모터는 구성적 또는 유도성일 수 있다. 상기 시그널 서열에는 숙주가 에쉐리키아속(Escherichia sp.)균인 경우에는 PhoA 시그널 서열, OmpA 시그널 서열 등이, 숙주가 바실러스속(Bacillus sp.)균인 경우에는 α-아밀라아제 시그널 서열, 서브틸리신 시그널 서열 등이, 숙주가 효모(yeast)인 경우에는 MFα 시그널 서열, SUC2 시그널 서열 등이, 숙주가 동물세포인 경우에는 인슐린 시그널 서열, α-인터페론 시그널 서열, 항체 분자 시그널 서열 등을 이용할 수 있으나, 이에 제한되지 않는다. 또한 벡터는 벡터를 함유하는 숙주 세포를 선택하기 위한 선택 마커를 포함할 수 있고, 복제 가능한 발현벡터인 경우 복제 기원을 포함한다.
본 발명에서 용어, "벡터"는 핵산 서열을 복제할 수 있는 세포로의 도입을 위해서 핵산 서열을 삽입할 수 있는 전달체를 의미한다. 핵산 서열은 외생 (exogenous) 또는 이종 (heterologous)일 수 있다. 벡터로서는 플라스미드, 코스미드 및 바이러스(예를 들면 박테리오파지)를 들 수 있으나, 이에 제한되지 않는다. 당업자는 표준적인 재조합 기술에 의해 벡터를 구축할 수 있다(Maniatis, et al., Molecular Cloning , A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988; 및 Ausubel et al., In: Current Protocols in Molecular Biology , John, Wiley & Sons, Inc, NY, 1994 등).
일 구현예에서, 상기 벡터의 제작 시, 상기 항체를 생산하고자 하는 숙주세포의 종류에 따라 프로모터(promoter), 종결자(terminator), 인핸서(enhancer) 등과 같은 발현조절 서열, 막 표적화 또는 분비를 위한 서열 등을 적절히 선택하고 목적에 따라 다양하게 조합할 수 있다.
본 발명에서, 용어 "발현 벡터"는 전사되는 유전자 산물 중 적어도 일부분을 코딩하는 핵산 서열을 포함한 벡터를 의미한다. 일부의 경우에는 그 후 RNA 분자가 단백질, 폴리펩타이드, 또는 펩타이드로 번역된다. 발현 벡터에는 다양한 조절서열을 포함할 수 있다. 전사 및 번역을 조절하는 조절서열과 함께 벡터 및 발현 벡터에는 또 다른 기능도 제공하는 핵산 서열도 포함될 수 있다.
본 발명에서, 용어 "숙주세포"는 진핵생물 및 원핵생물을 포함하며, 상기 벡터를 복제할 수 있거나 벡터에 의해 코딩되는 유전자를 발현할 수 있는 임의의 형질 전환 가능한 생물을 의미한다. 숙주세포는 상기 벡터에 의해 형질감염(transfected) 또는 형질전환(transformed) 될 수 있으며, 이는 외생의 핵산분자가 숙주세포 내에 전달되거나 도입되는 과정을 의미한다.
일 구현예에서, 상기 숙주 세포는 박테리아 또는 동물세포일 수 있으며, 동물 세포주는 CHO 세포, HEK 세포 또는 NSO 세포일 수 있고, 박테리아는 대장균일 수 있다.
일 측면에서, 본 발명은 본 발명의 항체 또는 이의 면역학적 활성을 가진 단편, 및 Fc 알파 수용체 이외의 표적 항원에 결합하는 부분을 포함하는 이중특이적 또는 다중특이적 항체를 유효성분으로 포함하는 암, 자가면역 질환, 퇴행성신경 질환(neurodegerative disease), 알츠하이머병, 대사 질환(metabolic disease), 심혈관 질환(cardiovascular disease), 죽상동맥경화증(atherosclerosis), 기관 이식 거부반응, 진균, 바이러스, 박테리아 또는 기생충에 의하여 유발되는 질환 또는 증상으로 이루어진 군으로부터 선택되는 질병 또는 질환의 예방 또는 치료용 약학적 조성물에 관한 것이다.
일 구현예에서, 상기 암은 뇌종양, 흑색종, 골수종, 비소세포성폐암, 구강암, 간암, 위암, 결장암, 유방암, 폐암, 골암, 췌장암, 피부암, 두부 또는 경부암, 자궁경부암, 난소암, 대장암, 소장암, 직장암, 나팔관암종, 항문부근암, 자궁내막암종, 질암종, 음문암종, 호지킨병(Hodgkin's disease), 식도암, 임파선암, 방광암, 담낭암, 내분비선암, 갑상선암, 부갑상선암, 부신암, 연조직 육종, 요도암, 음경암, 전립선암, 만성 또는 급성 백혈병, 림프구 림프종, 신장 또는 수뇨관암, 신장세포 암종, 신장골반암종, 중추신경계 종양, 1차 중추신경계 림프종, 척수 종양, 뇌간 신경교종 및 뇌하수체 선종으로 이루어진 군으로부터 선택되는 어느 하나일 수 있다.
본 발명에서, 용어 "예방"이란 본 발명에 따른 조성물의 투여에 의해 질병 또는 질환의 발생, 확산 및 재발을 억제 또는 지연시키는 모든 행위를 의미한다.
본 발명에서 사용된 용어 "치료"란 본 발명에 따른 조성물의 투여로 질병 또는 질환 및 이로 인한 합병증의 증세를 호전시키거나 이롭게 변경하는 모든 행위를 의미한다. 본 발명이 속하는 기술분야에서 통상의 지식을 가진 자라면, 대한의학협회 등에서 제시된 자료를 참조하여 본원의 조성물이 효과가 있는 질환의 정확한 기준을 알고, 개선, 향상 및 치료된 정도를 판단할 수 있을 것이다.
본 발명에서 유효성분과 결합하여 사용된 "치료학적으로 유효한 양"이란 용어는 질병 또는 질환을 예방 또는 치료하는데 유효한 양을 의미하며, 본 발명의 조성물의 치료적으로 유효한 양은 여러 요소, 예를 들면 투여방법, 목적부위, 환자의 상태 등에 따라 달라질 수 있다. 따라서, 인체에 사용 시 투여량은 안전성 및 효율성을 함께 고려하여 적정량으로 결정되어야 한다. 동물실험을 통해 결정한 유효량으로부터 인간에 사용되는 양을 추정하는 것도 가능하다. 유효한 양의 결정시 고려할 이러한 사항은, 예를 들면 Hardman and Limbird, eds., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 10th ed.(2001), Pergamon Press; 및 E.W. Martin ed., Remington's Pharmaceutical Sciences, 18th ed.(1990), Mack PublishingCo.에 기술되어있다.
본 발명의 약학적 조성물은 약학적으로 유효한 양으로 투여한다. 본 발명에서 사용되는 용어, "약학적으로 유효한 양"은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미하며, 유효용량 수준은 환자의 건강상태, 질병 또는 질환의 종류, 질병 또는 질환의 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고, 종래의 치료제와 순차적으로 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 상기한 요소들을 모두 고려하여, 부작용없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 약학적 조성물은 생물학적 제제에 통상적으로 사용되는 담체, 희석제, 부형제 또는 둘 이상의 이들의 조합을 포함할 수 있다. 본 발명에서 사용되는 용어, "약학적으로 허용가능한"이란 상기 조성물에 노출되는 세포나 인간에게 독성이 없는 특성을 나타내는 것을 의미한다. 상기 담체는 조성물을 생체 내 전달에 적합한 것이면 특별히 제한되지 않으며, 예를 들면, Merck Index, 13th ed., Merck & Co. Inc. 에 기재된 화합물, 식염수, 멸균수, 링거액, 완충 식염수, 덱스트로스 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 이용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한, 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주이용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다. 더 나아가 당 분야의 적정한 방법으로 또는 Remington's Pharmaceutical Science(Mack PublishingCompany, Easton PA, 18th, 1990)에 개시되어 있는 방법을 이용하여 각 질환에 따라 또는 성분에 따라 바람직하게 제제화할 수 있다.
일 구현예에서, 상기 약학적 조성물은 경구형 제형, 외용제, 좌제, 멸균 주사용액 및 분무제를 포함하는 군으로부터 선택되는 하나 이상의 제형일 수 있으며, 경구형 또는 주사 제형이 더욱 바람직하다.
본 발명에서 사용되는 용어, "투여"란, 임의의 적절한 방법으로 개체 또는 환자에게 소정의 물질을 제공하는 것을 의미하며, 목적하는 방법에 따라 비 경구 투여(예를 들어 정맥 내, 피하, 복강 내 또는 국소에 주사 제형으로 적용)하거나 경구 투여할 수 있으며, 투여량은 환자의 체중, 연령, 성별, 건강상태, 식이, 투여시간, 투여방법, 배설률 및 질환의 중증도 등에 따라 그 범위가 다양하다. 본 발명의 조성물의 경구 투여를 위한 액상 제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데, 통상적으로 사용되는 단순 희석제인 물, 액체 파라핀 이외에 다양한 부형제, 예컨대 습윤제, 감미제, 방향제, 보존제 등이 함께 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성 용제, 현탁제, 유제, 동결건조 제제, 좌제 등이 포함된다. 본 발명의 약학적 조성물은 활성 물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수도 있다. 바람직한 투여방식 및 제제는 정맥 주사제, 피하 주사제, 피내주사제, 근육 주사제, 점적 주사제 등이다. 주사제는 생리식염액, 링겔액 등의 수성 용제, 식물유, 고급 지방산 에스테르(예, 올레인산에칠 등), 알코올 류(예, 에탄올, 벤질알코올, 프로필렌글리콜, 글리세린 등) 등의 비수성 용제 등을 이용하여 제조할 수 있고, 변질 방지를 위한 안정화제(예, 아스코르빈산, 아황산수소나트륨, 피로아황산나트륨, BHA, 토코페롤, EDTA 등), 유화제, pH 조절을 위한 완충제, 미생물 발육을 저지하기 위한 보존제 (예, 질산페닐수은, 치메로살, 염화벤잘코늄, 페놀, 크레솔, 벤질알코올 등) 등의 약학적 담체를 포함할 수 있다.
본 발명에서 사용되는 용어, "개체"란, 상기 질병 또는 질환이 발병하였거나 발병할 수 있는 인간을 포함한 원숭이, 소, 말, 양, 돼지, 닭, 칠면조, 메추라기, 고양이, 개, 마우스, 박쥐, 낙타, 쥐, 토끼 또는 기니아 피그를 포함한 모든 동물을 의미하고, "검체"란 이로부터 분리한 비말, 가래, 전혈, 혈장, 혈청, 뇨 또는 타액일 수 있다.
본 발명의 약학적 조성물은 약제학적으로 허용 가능한 첨가제를 더 포함할 수 있으며, 이때 약제학적으로 허용 가능한 첨가제로는 전분, 젤라틴화 전분, 미결정셀룰로오스, 유당, 포비돈, 콜로이달실리콘디옥사이드, 인산수소칼슘, 락토스, 만니톨, 엿, 아라비아고무, 전호화전분, 옥수수전분, 분말셀룰로오스, 히드록시프로필셀룰로오스, 오파드라이, 전분글리콜산나트륨, 카르나우바 납, 합성규산알루미늄, 스테아린산, 스테아린산마그네슘, 스테아린산알루미늄, 스테아린산칼슘, 백당, 덱스트로스, 소르비톨 및 탈크 등이 사용될 수 있다. 본 발명에 따른 약제학적으로 허용 가능한 첨가제는 상기 조성물에 대해 0.1 중량부 내지 90 중량부 포함되는 것이 바람직하나, 이에 한정되는 것은 아니다.
일 측면에서, 본 발명은 검체로부터 분리된 시료를 본 발명의 이중특이적 또는 다중특이적 항체와 접촉시켜 항원-항체 복합체를 형성시키는 단계; 및 상기 복합체의 형성을 검출하는 단계를 포함하는, 암, 자가면역 질환, 퇴행성신경 질환, 알츠하이머병, 대사 질환, 심혈관 질환, 죽상동맥경화증, 기관 이식 거부반응, 진균, 바이러스, 박테리아 또는 기생충에 의하여 유발되는 질환 또는 증상으로 이루어진 군으로부터 선택되는 질병 또는 질환의 진단에 관한 정보를 제공하는 방법.
일 측면에서, 본 발명은 본 발명의 항체 또는 이의 면역학적 활성을 가진 단편을 코딩하는 단리된 핵산 분자를 포함하는 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및 숙주 세포 배양물로부터 항체 또는 이의 면역학적 활성을 가진 단편을 회수하는 단계를 포함하는 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편을 제조하는 방법에 관한 것이다.
일 측면에서, 본 발명은 본 발명의 이중특이적 또는 다중특이적 항체를 코딩하는 단리된 핵산 분자를 포함하는 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및 숙주 세포 배양물로부터 항체 또는 이의 면역학적 활성을 가진 단편을 회수하는 단계를 포함하는 Fc 알파 수용체 및 Fc 알파 수용체 이외의 표적 항원에 결합하는 이중특이적 또는 다중특이적 항체를 제조하는 방법에 관한 것이다.
일 측면에서, 본 발명은 본 발명의 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편의 항체 치료제의 제조에 사용하기 위한 용도에 관한 것이다.
일 측면에서, 본 발명은 본 발명의 이중특이적 또는 다중특이적 항체의 암, 자가면역 질환, 퇴행성신경 질환(neurodegerative disease), 알츠하이머병, 대사 질환(metabolic disease), 심혈관 질환(cardiovascular disease), 죽상동맥경화증(atherosclerosis), 기관 이식 거부반응, 진균, 바이러스, 박테리아 또는 기생충에 의하여 유발되는 질환 또는 증상으로 이루어진 군으로부터 선택되는 질병 또는 질환의 예방 또는 치료 용도에 관한 것이다.
일 측면에서, 본 발명은 본 발명의 이중특이적 또는 다중특이적 항체를 약학적으로 유효한 양으로 암에 걸린 개체에 투여하는 단계를 포함하는 암 치료 방법에 관한 것이다.
하기의 실시예를 통하여 본 발명을 보다 상세하게 설명한다. 그러나 하기 실시예는 본 발명의 내용을 구체화하기 위한 것일 뿐 이에 의해 본 발명이 한정되는 것은 아니다.
실시예 1.
Fc 알파 수용체를 이용한 항원 제작
Fc 알파 수용체와 결합하여 효과기 기능(effector function)을 갖는 IgG를 발굴하기 위하여 Fc 알파 수용체의 세포외부영역(Extra Cellular Domain, ECD)을 항원으로 준비하였다. 또한, 유세포 분리기를 이용하여 항체를 스크리닝하기에 적합한 항원을 제작하고자 GST(Glutathione-S-transferase) 태그를 융합(fusion)한 이합체(dimeric) 형태 및 스트렙타비딘(Streptavidin) 태그를 융합한 사합체(tetrameric) 형태의 항원을 생산할 동물 세포 발현용 벡터를 제작하였다 (도 1). 그 후, 2x106 cells/ml의 밀도로 하루 동안 배양한 Expi293F 세포에 PEI (Polyscience, 23966)을 이용하여 트랜스펙션하였다. 그 후 진탕배양기에서 37℃, 125 rpm 및 8 % CO2의 조건으로 7일간 배양한 후 원심 분리하여 상등액만 취하였다. 상등액을 25x PBS를 이용해 평형을 맞춘 뒤 바틀탑 필터를 이용해 0.2 μm 필터 (Merck Millipore)로 여과하였다. 여과된 배양액에 각각 GSH 레진(resin) 및 Ni-NTA 레진 1 ml을 넣어 주고 4 ℃에서 16 시간 교반한 뒤 컬럼을 통해 레진을 회수 한 후 5 ml PBS로 세척하고 pH 8.0의 50 mM Tris-HCl & 10 mM 환원된 글루타치온 (SIGMA) 4 ml와 250 mM 이미다졸로 용출하였다. Centrifugal filter units 3K (Merck Millipore)을 사용하여 PBS로 버퍼 교체한 후 SDS-PAGE를 통해 각각 정제된 2종 항원 단백질 (GST-ECD 및 스트렙타비딘-ECD)의 크기와 순도를 분석하였다 (도 1).
실시예 2.
초고속 탐색 시스템을 이용한 인간 항체 스크리닝
유세포 분리기를 이용한 스크리닝에 이용하기 위해 상기 실시예에서 준비한 항원 단백질 중 스트렙타비딘이 융합된 항원 단백질에 Alexa488 형광분자를 표지화하였다. 이 후, 본 발명자들이 구축한 박테리아 디스플레이된 인간 scFv 항체 라이브러리를 이용하여 Fc 알파 수용체의 ECD 영역에 결합하는 인간 항체 스크리닝을 진행하였다. 구체적으로, 라이브러리 세포 1 ml을 2% 글루코스 및 40 ㎍/ml의 클로람페니콜(chloramphenicol)이 포함된 25 ml TB 배지에서 37℃에서 250 rpm으로 4시간 배양한 뒤, 배양된 세포를 40 ㎍/ml의 클로람페니콜이 포함된 100 ml의 TB 배지에 1:100 비율로 OD600=0.5까지 배양하고 20분간 25℃ 및 250 rpm에서 쿨링(cooling)한 후 1 mM IPTG를 첨가하여 25℃ 및 250 rpm로 5시간 동안 인덕션(Induction)하여 단백질이 과발현된 대장균을 OD600=8을 기준으로 수득(harvest)하였다. 세포들을 유세포 분리기를 이용한 스크리닝에 적합한 스페로플라스트(spheroplasts) 형태로 만들기 위해 세포를 1ml의 10Mm Tris-HCl (pH 8.0)을 사용하여 재부유하여 2번 세척하여 잔여 배지를 제거한 뒤, 1 ml의 STE [0.5 M sucrose, 10 Mm Tris-HCl 및 10 Mm EDTA (pH 8.0)] 용액에서 37℃로 30분간 로테이션하여 삼투압 충격(osmotic shock)을 주는 방법으로 세포 외막을 제거하였다. 그 후 1 ml의 Solution A 및 50 mg/ml lysozyme solution 20 ㎕를 혼합한 용액에서 37℃로 15분간 로테이션하여 펩티도글리칸(peptidoglycan) 층을 제거하였고 1 ml의 PBS로 세척한 뒤 300 ㎕를 700 ㎕의 PBS와 200 nM (monomer 기준)의 Fc 알파 수용체-ECD-스트렙타비딘-Alexa488 프로브를 넣고 상온에서 1시간 동안 로테이션하여 스페로플라스트에 형광 프로브를 표지하였다. 이 후 항원 결합력 증가로 높은 형광을 보이는 클론들을 유세포분리기를 이용하여 회수하였으며, 회수된 클론들에서 scFv 유전자들을 PCR방법으로 증폭하고, 배양, 발현유도, 세포외막 및 펩티도글리칸 층을 제거하는 스페로플라스팅(spheroplasting) 과정, 항원 표지 및 유세포 분석의 선택적인 게이팅(gating)을 통해 Fc 알파 수용체-ECD 영역에 높은 친화도를 보이는 스페로플라스트들을 선별하는 과정을 반복하였다. 유세포 분석기를 이용한 선별 과정 및 선별 순도(purity)를 높이기 위한 재선별 과정 후에, 농축 과정, PCR 증폭을 통한 선별된 scFv 변이체 유전자 확보 과정, 서브클로닝 과정, 및 트랜스포메이션 과정을 거치고, 원하는 클론들을 증폭(enrich)하기 위해 다음 라운드의 선별 과정을 수행하였다 (도 2). 이와 같은 반복되는 여러 회차(round)의 탐색 과정으로 Fc 알파 수용체-ECD 영역에 결합력이 우수한 scFv 변이체 클론들을 확보하였다.
실시예 3.
Fc 알파 수용체 결합 항체 변이체들의 유전자 서열 확인
상기 실시예 2에서 확보한 scFv 변이체 클론들의 유전자 서열을 확인하기 위하여 Sanger sequencing으로 DNA 염기 서열을 분석하였으며, 분석을 통해 항체 서열을 갖는 scFv 항체 변이체 6종 JS9, JS19, JS30, JS40, JS41 및 JS48을 선별하였다 (도 3). 또한, 상기 6종의 scFv 변이체들의 VH 및 VL 아미노산 서열과 각 변이체들의 VH의 FR1, CDRH1, FR2, CDRH2, FR3, CDRH3 및 FR4의 아미노산 서열 및 VL의 FR1, CDRL1, FR2, CDRL2, FR3, CDRL3 및 FR4의 아미노산 서열을 확인하였다 (표 1).
부위 | 변이체명 | 서열 |
VH | ||
CDRH1 | JS40-1, JS48-1, JS116, JS144, JS140, JS19, JS40, JS48 | GFTFSNFA |
JS9 | GFNFDDHA | |
JS30, JS41 | GGSISSRDW | |
CDRH2 | JS40-1, JS48-1, JS116, JS144, JS19, JS40, JS48 | ISDDGTIT |
JS140 | ISDDGTTT | |
JS9 | ISGSGGDT | |
JS30, JS41 | IYHSGTT | |
CDRH3 | JS116 | VRVPPPAPVQGPDY |
JS144 | VRVPSPAPVQGPDY | |
JS140 | VRVPSPAPMQGPDY | |
JS40-1, JS48-1, JS40, JS48 | VKVPSPAPMQGPDY | |
JS9 | ATEARGLAH | |
JS30 | VTYSASDAAFDS | |
JS41 | VTYSAYDAAFDS | |
JS19 | VKVPSPAPMQGPDH | |
VL | ||
CDRL1 | JS116, JS144, JS40-1, JS40 | QGISNYLAWF |
JS140, JS48-1, JS48 | QSISTYLNWY | |
JS9 | KLGERYACWY | |
JS30 | QSISTCLNWY | |
JS41 | QSISTYLSWY | |
JS19 | SSNIGSNTVNRY | |
CDRL2 | JS116, JS144 | AASSLQGGVP |
JS140, JS48-1, JS41, JS48 | GASNLQSGVS | |
JS40-1, JS40 | AASSLQSGVP | |
JS9 | QDTKRPSGI | |
JS30 | GASILQSGVS | |
JS19 | SDNQRPSGVP | |
CDRL3 | JS116, JS144, JS40-1, JS40 | QQYHSYPLT |
JS140 | QQGNNVPLT | |
JS48-1, JS30, JS41, JS48 | QQGNSVPLT | |
JS9 | QAWDSSTVV | |
JS19 | AVWDDSLNGPGYV | |
VH | ||
FR1 | JS116, JS144, JS48-1, JS40, JS19 | QVQLQESGGGLVQPGGSLRLACAGS |
JS140, JS40-1, JS48 | QVQLQESGGGLVQPGGSLRLTCAGS | |
JS9 | EVQLVGSGGGVVQPGRSLRLSCAAS | |
JS30, JS41 | EVQLVESGPGQVKPSETLSLTCSVS | |
FR2 | JS116, JS144, JS40-1, JS48-1, JS40, JS48 | MAWVRLAPGKGLEWVSG |
JS140 | MAWVRLAPGEGLEWVSG | |
JS9 | MHWVRQAPGKGLEWVSS | |
JS30, JS41 | WGWVRQPPGEGLEWIGE | |
JS19 | MAWVRQAPGKGLEWVSG | |
FR3 | JS116, JS144, JS140, JS40-1, JS48-1, JS19, JS40, JS48 | DYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC |
JS9 | YYADSVKGRFTIARDNSKNTLYLQMNSLRAEDTAVYYC | |
JS30, JS41 | NYNPSLKSRVTMSMDTSKNQLSLKLTGVTAVDTAVYYC | |
FR4 | JS116, JS144, JS48-1 | WGQGTTVTVSS |
JS140, JS40-1, JS9, JS30, JS41, JS19, JS40, JS48 | WGQGTLVTVSS | |
VL | ||
FR1 | JS116, JS144, JS48-1, JS40 | DVVMTQSPSAMSASVGDRVTITCRAS |
JS140 | ETTLTQSPSSLSASVGDRVSITCRAS | |
JS40-1, JS48 | ETTLTQSPSSLSASVGDRVTITCRAS | |
JS9 | SSELTQDPAVSVALGQTASITCSGH | |
JS30, JS41 | ETTLTQSPSSLSASVGDRITITCRAS | |
JS19 | QSALTQPPSASGTPGQRVTISCSGS | |
FR2 | JS116, JS144, JS48-1, JS40 | QQKPGKVPKRLIY |
JS140, JS40-1, JS30, JS41, JS48 | QQKPGKAPKSLIY | |
JS9 | QQKPGQSPVLVIY | |
JS19 | QQLPGTAPKLLIY | |
FR3 | JS116, JS144, JS48-1, JS40 | SRFRGRGSGTDFTLSISCLQSEDFATYYC |
JS140 | SQFSGRGPGADFTLTISSLQPEDFATYYC | |
JS40-1, JS48 | SQFSGRGPGTDFTLTISSLQPEDFATYYC | |
JS9 | PERFSGSNTGNTATLTITGTQAMDEADYYC | |
JS30 | SQFSGSGPGTDFTLTIGSLQPEGFATYYC | |
JS41 | SQFRGSGPGTDFTLTISSLQPEDFATYYC | |
JS19 | DRFSGSKSGTSASLAISGLQSEDEADYYC | |
FR4 | JS116, JS144, JS48-1, JS40 | FGGGTKLSVLG |
JS140, JS40-1, JS30, JS41, JS48 | FGGGTKVDIKR | |
JS9 | FGGGTKLTVLG | |
JS19 | FGTGTKVEIKR | |
변이체 | ||
VH | JS9 | EVQLVGSGGGVVQPGRSLRLSCAAS~GFNFDDHA~~MHWVRQAPGKGLEWVSS~ISGSGGDT~YYADSVKGRFTIARDNSKNTLYLQMNSLRAEDTAVYYC~ATEARGLAH~~~~~~WGQGTLVTVSS |
SSELTQDPAVSVALGQTASITCSGH~~KLGERYACWY~~~QQKPGQSPVLVIY~~~QDTKRPSGI~~~~PERFSGSNTGNTATLTITGTQAMDEADYYC~~~QAWDSSTVV~~FGGGTKLTVLG | ||
VL | ||
VH | JS30 | EVQLVESGPGQVKPSETLSLTCSVS~GGSISSRDW~WGWVRQPPGEGLEWIGE~IYHSGTT~~NYNPSLKSRVTMSMDTSKNQLSLKLTGVTAVDTAVYYC~VTYSASDAAFDS~~~WGQGTLVTVSS |
VL | ETTLTQSPSSLSASVGDRITITCRAS~QSISTCLNWY~~~QQKPGKAPKSLIY~~~GASILQSGVS~~~SQFSGSGPGTDFTLTIGSLQPEGFATYYC~~~QQGNSVPLT~~~FGGGTKVDIKR | |
VH | JS41 | EVQLVESGPGQVKPSETLSLTCSVS~GGSISSRDW~WGWVRQPPGEGLEWIGE~IYHSGTT~~NYNPSLKSRVTMSMDTSKNQLSLKLTGVTAVDTAVYYC~VTYSAYDAAFDS~~~WGQGTLVTVSS |
ETTLTQSPSSLSASVGDRITITCRAS~~~QSISTYLSWY~~~QQKPGKAPKSLIY~~~GASNLQSGVS~~~SQFRGSGPGTDFTLTISSLQPEDFATYYC~~~QQGNSVPLT~~~FGGGTKVDIKR | ||
VL | ||
VH | JS19 | QVQLQESGGGLVQPGGSLRLACAGS~GFTFSNFA~~MAWVRQAPGKGLEWVSG~ISDDGTIT~DYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC~VKVPSPAPMQGPDH~WGQGTTVTVSS |
VL | QSALTQPPSASGTPGQRVTISCSGS~~~SSNIGSNTVNRY~~QQLPGTAPKLLIY~~~SDNQRPSGVP~~~DRFSGSKSGTSASLAISGLQSEDEADYYC~~AVWDDSLNGPGYVFGTGTKVEIKR | |
VH | JS40 | QVQLQESGGGLVQPGGSLRLACAGS~GFTFSNFA~~MAWVRLAPGKGLEWVSG~ISDDGTIT~DYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC~VKVPSPAPMQGPDY~WGQGTTVTVSS |
VL | DVVMTQSPSAMSASVGDRVTITCRAS~~QGISNYLAWF~~~~QQKPGKVPKRLIY~~~AASSLQSGVP~~~SRFRGRGSGTDFTLSISCLQSEDFATYYC~~~QQYHSYPLT~~~FGGGTKLSVLG | |
VH | JS48 | QVQLQESGGGLVQPGGSLRLTCAGS~GFTFSNFA~~MAWVRLAPGKGLEWVSG~ISDDGTIT~DYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC~VKVPSPAPMQGPDY~WGQGTLVTVSS |
VL | ETTLTQSPSSLSASVGDRVTITCRAS~~QSISTYLNWY~~~~QQKPGKAPKSLIY~~~GASNLQSGVS~~~SQFSGRGPGTDFTLTISSLQPEDFATYYC~~~QQGNSVPLT~~~FGGGTKVDIKR |
실시예 4.
Fc 알파 수용체 ECD 영역에 대한 결합력 분석
상기 실시예 3에서 선별한 6종 scFv 항체 변이체들의 Fc 알파 수용체 ECD 영역에 대한 결합력을 확인하기 위해 유세포 분석기를 이용한 결합력 분석을 진행하였다. 이를 위하여 상기 실시예에서 사용된 방식으로 각각의 변이체와 대조군으로 사용될 Fc (야생형)들을 스페로플라스트들로 제조하였다. 준비된 스페로플라스트들에 Fc 알파 수용체-ECD-스트렙타비딘-Alexa488 항원을 50 nM의 농도로 결합시키고 상온에서 1시간 동안 인큐베이션하였다. 그 후 비특이적 결합을 제거하기 위해 PBS로 두 차례 세척하고 유세포 분석기를 이용하여 Fc 알파 수용체 ECD 영역에 대한 결합력을 분석하였다. 그 결과, 6종의 scFv 변이체들이 대조군인 IgG_Fc 및 IgA_Fc에 비해 월등히 증가된 형광 신호를 나타냈으며 (도 4), 이를 통해 Fc 알파 수용체 ECD 영역에 결합하는 scFv 항체 변이체들을 검증하였다.
실시예 5. scFv 변이체 포함 항체 IgG 생산 및 정제
상기 실시예 3에서 선별한 6종의 scFv 항체 변이체가 IgG 형태로도 Fc 알파 수용체와의 결합력을 가지는지를 확인하기 위하여 6종의 scFv의 중쇄(heavy chain) 및 경쇄(light chain) 발현 벡터를 각각 제작한 뒤, Freestyle 293 expression 배양액 (Gibco, 12338-018) 100 ml에 각 변이체들의 중쇄유전자와 경쇄유전자를 1:1의 비율로 먼저 섞고 PEI:변이체유전자=4:1의 비율로 섞어 상온에서 20 분간 두었다가 전날 2x106 cells/ml의 밀도로 계대배양해 놓은 Expi293F 세포에 트랜스펙션하였다. 그 후 진탕배양기에서 37 ℃, 125 rpm 및 8 % CO2의 조건으로 7일간 배양하고 원심 분리하여 상등액만 취하였다. 상등액을 25x PBS를 이용해 평형을 맞춘 뒤 바틀탑 필터를 이용해 0.2 μm 필터 (Merck Millipore)로 여과하였다. 여과된 배양액에 Protein A 레진 500 μl을 넣어 주고 4 ℃에서 16 시간 교반한 뒤 컬럼을 통해 레진을 회수 한 후 5 ml PBS로 세척하고 pH 2.7의 100 mM 글리신(glycine) 버퍼 3 ml로 용출하고 1M Tris-HCl pH 8.0을 이용하여 중화하였다. Centrifugal filter units 3K (Merck Millipore)을 사용하여 PBS로 버퍼 교체한 후 정제된 6종의 scFv 항체 변이체를 각각 포함하는 IgG (JS9, JS19, JS30, JS40, JS41 및 JS48)들의 크기와 순도를 SDS-PAGE를 통해 분석하였다 (도 5).
실시예 6. scFv 변이체 포함 항체들의 Fc 알파 수용체에 대한 결합력 분석
상기 실시예 5에서 제작한 scFv 변이체 포함 항체들 JS9, JS30, JS40, JS41 및 JS48의 Fc 알파 수용체에 대한 항체 결합력을 측정하기 위하여 ELISA 실험을 진행하였다. 구체적으로, pH 9.6의 0.05 M Na2CO3 용액 내의 스트렙타비딘 태그를 융합한 사합체 형태의 Fc 알파 수용체 (항원) 4 μg/ml을 50 μl씩 Flat Bottom Polystyrene High Bind 96웰 마이크로플레이트 (costar)에 4℃에서 16 시간 동안 고정화한 후 100 μl의 4% 스킴밀크 (GenomicBase) (in 0.05% PBST pH 6.0/pH 7.4)로 상온에서 2 시간 동안 블로킹하였다. 0.05% PBST 180 μl로 4 회씩 세척한 뒤 1% 스킴밀크 (in 0.05% PBST)로 연속 희석한 항체 JS9, JS30, JS40, JS41 및 JS48를 50 μl씩 각 웰에 분주하여 상온에서 1 시간 동안 반응시켰다. 세척 과정 후 50 μl의 항-인간 IgG(H+L)-HRP 컨쥬게이트 (Jackson Immunoresearch)과 상온에서 1 시간 동안 각각 항체 반응을 진행하고 세척하였다. 그 후 1-Step Ultra TMB-ELISA Substrate Solution(Thermo Fisher Scientific)를 50 μl씩 첨가해 발색한 뒤 50 μl의 2 M H2SO4를 첨가하여 반응을 종료시킨 다음 Epoch Microplate Spectrophotometer (BioTek)을 이용해 각 항체의 항원인 Fc 알파 수용체에 대한 결합력을 분석하였다 (도 6).
실시예 7. 초고속 탐색 시스템 활용한 Fc 알파 수용체 ECD 영역과 결합력이 향상된 인간 항체 스크리닝
Fc 알파수용체에 대한 결합력이 확인된 2종의 항체 (JS40 및 JS48)를 모항체로하여 Fc 알파수용체와의 결합력을 높이기 위한 실험을 설계하였다. 이를 위하여 scFv로 display 되어있는 JS40 및 JS48 항체에 Error prone PCR을 통해 0.2%로 무작위적인 돌연변이가 들어간 라이브러리를 제작하였다. 또한 1차 항체 발굴에 이용되었던 항원인 Fc 알파 수용체-ECD-Streptavidn-Alexa488 probe와 박테리아 디스플레이된 인간 scFv 항체 Error-prone 라이브러리를 이용하여 Fc 알파수용체에 결합하는 인간 항체 스크리닝을 진행하였다. 라이브러리 세포 1 ml을 2% 글루코스(glucose) 및 40 ㎍/ml의 클로람페니콜(chloramphenicol)이 포함된 25 ml TB배지에서 37℃에서 250 rpm으로 4시간 동안 배양하였다. 배양된 세포를 40 ㎍/ml의 클로람페니콜이 포함된 100 ml의 TB배지에 1:100 비율로 OD600=0.5까지 배양한 후 20분간 25℃에서 250 rpm로 쿨링(cooling)하고 1 mM IPTG 를 첨가하여 25℃에서 250 rpm으로 5시간 동안 인덕션(Induction)하여 단백질이 과발현된 대장균을 OD600=8을 기준으로 수득하였다. 세포들을 유세포 분리기를 이용한 스크리닝에 적합한 스페로플라스트(spheroplast)형태로 만들기 위해 세포를 1 ml의 10 Mm Tris-HCl (pH 8.0)로 재부유하여 2번의 세척을 통해 잔여 배지를 제거하였고 1 ml의 STE [0.5 M sucrose, 10 Mm Tris-HCl, 10 Mm EDTA (pH 8.0)] 용액에서 37℃에서 30분간 로테이션하여 삼투압 충격(osmotic shock)을 주는 방법으로 세포 외막을 제거하였다. 1 ml의 Solution A 및 50 mg/ml의 lysozyme solution 20 ㎕를 혼합한 용액에서 37℃에서 15분간 로테이션하여 펩티도글리칸 층을 제거하였고 1 ml 의 PBS로 세척한 뒤 300 ㎕를 700 ㎕의 PBS 및 200 nM의 Fc 알파 수용체-ECD-Streptavidn-Alexa488 probe (monomer 기준)를 넣고 상온에서 1시간 동안 로테이션하여 스페로플라스트에 형광 프로브를 표지하였다. 항원 결합력 증가로 높은 형광을 보이는 클론들을 유세포분리기를 이용하여 회수하고 (도 2), 회수된 클론들에서 scFv 유전자들을 PCR 방법으로 증폭한 뒤, 상기의 배양, 발현유도, 세포외막 및 펩티도글리칸 층을 제거하는 스페로플라스팅 과정, 항원 표지, 및 유세포분석의 선택적인 게이팅(gating)을 통해 Fc 알파 수용체 ECD 영역에 높은 친화도를 보이는 스페로플라스트들을 선별하는 과정을 반복하였다. 유세포 분석기를 이용한 선별 과정과 선별 순도 (purity)를 높이기 위한 재선별 과정 후에, 농축과정, PCR 증폭을 통한 선별된 scFv 변이체 유전자 확보 과정, 서브클로닝 과정 및 트랜스포메이션(transformation) 과정을 거치고, 원하는 클론들을 증폭(enrich)하기 위해 다음 라운드의 선별 과정을 수행하였다. 반복되는 여러 라운드(round)의 탐색 과정을 통해 Fc 알파 수용체 ECD 영역에 결합력이 향상된 신규한 scFv 변이체 클론들을 확보하였다.
실시예 8. Fc 알파 수용체에 대한 결합력이 증가한 항체 변이체들의 유전자 서열 확인
상기 실시예 7에서 확보한 scFv 변이체 클론들의 유전자 서열을 확인하기 위하여 Sanger sequencing을 이용하여 DNA 염기 서열을 분석하였다 (표 1). 분석을 통해 항체 서열을 갖는 scFv 항체 변이체 3종 JS116, JS144 및 JS140을 선별하였다 (도 7).
실시예 9. Fc 알파 수용체에 대한 결합력이 증가한 항체 변이체들의 ECD 영역에 대한 결합력 분석
선별한 3종의 scFv 항체 변이체 JS116, JS144 및 JS140의 Fc 알파 수용체 ECD 영역에 대한 결합력을 확인하기 위해 유세포 분석기를 이용한 결합력 분석을 수행하였다. 이를 위해, 상기 실시예 7에 기재된 방법으로 각각의 변이체 및 대조군으로 사용될 야생형 Fc를 스페로플라스트로 각각 제조하였다. 준비된 스페로플라스트들에 스크리닝에 이용된 Fc 알파 수용체-ECD-Streptavidn-Alexa488 항원을 50 nM의 농도로 결합시키고 상온에서 1시간 동안 인큐베이션하였다. 비특이적 결합을 제거하기 위해 PBS로 두 차례 세척한 후 유세포 분석기를 이용하여 Fc 알파 수용체 ECD 영역에 대한 결합력을 분석하였다.
그 결과, 3종의 scFv 변이체 JS116, JS144 및 JS140 모두 대조군인 기존의 JS40 또는 JS48보다 증가된 형광 신호를 나타내 (도 8), 이를 통해, 본 발명에서 발굴한 scFv 항체 변이체들이 Fc 알파 수용체 ECD 영역에 결합력이 증가한 변이체임을 확인하였다.
실시예 10. Fc 알파 수용체 ECD 영역에 대한 결합력이 증가한 3종의 scFv 변이체들의 항체 생산 및 정제
상기 실시예에서 선별한 3종의 scFv 변이체 JS116, JS144 및 JS140가 IgG 형태로도 Fc 알파 수용체와의 결합력이 증가하는지를 확인하기 위하여 3종의 scFv의 중쇄(heavy chain) 및 경쇄(light chain) 발현 벡터를 각각 제작한 뒤, Freestyle 293 expression 배양액 (Gibco, 12338-018) 100 ml에 각 변이체들의 중쇄유전자와 경쇄유전자를 1:1의 비율로 먼저 섞고 PEI:변이체유전자=4:1의 비율로 섞어 상온에서 20 분간 두었다가 전날 2x106 cells/ml의 밀도로 계대배양해 놓은 Expi293F 세포에 트랜스펙션하였다. 그 후 진탕배양기에서 37 ℃, 125 rpm 및 8 % CO2의 조건으로 7일간 배양하고 원심 분리하여 상등액만 취하였다. 상등액을 25x PBS를 이용해 평형을 맞춘 뒤 바틀탑 필터를 이용해 0.2 μm 필터 (Merck Millipore)로 여과하였다. 여과된 배양액에 Protein A 레진 500 μl을 넣어 주고 4 ℃에서 16 시간 교반한 뒤 컬럼을 통해 레진을 회수 한 후 5 ml PBS로 세척하고 pH 2.7의 100 mM 글리신(glycine) 버퍼 3 ml로 용출하고 1M Tris-HCl pH 8.0을 이용하여 중화하였다. Centrifugal filter units 3K (Merck Millipore)을 사용하여 PBS로 버퍼 교체한 후 정제된 3종의 scFv 항체 변이체를 각각 포함하는 IgG들의 크기와 순도를 SDS-PAGE를 통해 분석하였다 (도 9).
실시예 11. Fc 알파 수용체 결합에 대한 결합력이 증가한 항체들의 결합력 분석
상기 실시예 10에서 제작한 항체들의 단백질 상에서 Fc 알파 수용체에 대한 결합력을 확인하기 위해 ELISA 실험을 수행하였다. 구체적으로, pH 9.6의 0.05 M Na2CO3에 4 μg/ml로 스트렙타비딘 태그를 융합한 사합체 형태의 Fc 알파 수용체 (항원)를 50 μl씩 Flat Bottom Polystyrene High Bind 96웰 마이크로플레이트 (costar)에 4℃에서 16 시간 동안 고정화한 후 100 μl의 4% 스킴밀크 (GenomicBase) (in 0.05% PBST pH 6.0/pH 7.4)로 상온에서 2 시간 동안 블로킹하였다. 0.05% PBST 180 μl로 4 회씩 세척한 뒤 1% 스킴밀크 (in 0.05% PBST)로 연속 희석한 상기 실시예 10에서 3종의 scFv 변이체를 포함하도록 제작된 3종의 항체들 (JS116, JS144 및 JS140)과 대조군으로서 기존의 항체 2종 (JS40 및 JS48)를 50 μl씩 각 웰에 분주하여 상온에서 1 시간 동안 반응시켰다. 세척 과정 후 50 μl의 항-인간 IgG(H+L)-HRP 컨쥬게이트 (Jackson Immunoresearch)과 상온에서 1 시간 동안 각각 항체 반응을 진행하고 세척하였다. 그 후 1-Step Ultra TMB-ELISA Substrate Solution (Thermo Fisher Scientific)를 50 μl씩 첨가해 발색한 뒤 50 μl의 2 M H2SO4를 첨가하여 반응을 종료시킨 다음 Epoch Microplate Spectrophotometer (BioTek)을 이용해 각 항체의 항원인 Fc 알파 수용체에 대한 결합력을 분석하였다 (도 10).
실시예 12. JS40 및 JS48의 VH 영역과 VL 영역이 치환된 항체 생산 및 정제
상기 실시예 6에서 발굴한 항체 6종 중, 단백질 상에서 Fc 알파 수용체와 가장 높은 결합력을 보인 두 항체인 JS40 및 JS48의 VH 영역은 서열이 매우 비슷하지만 VL은 서열이 전혀 다른 것을 확인하여, 모항체로 이용하였던 JS40 및 JS48의 VH 영역 및 VL 영역을 서로 치환하여 포함하는 IgG 형태의 항체를 제작하였다 (표 1). 이를 위하여 JS40의 VH 영역을 가지면서 JS48의 VL 영역을 가지는 JS40-1 항체 및 JS48의 VH 영역을 가지면서 JS40의 VL 영역을 가지는 JS48-1 항체의 scFv의 중쇄(heavy chain) 및 경쇄(light chain) 발현 벡터를 각각 제작한 뒤, Freestyle 293 expression 배양액 (Gibco, 12338-018) 100 ml에 각 변이체들의 중쇄유전자와 경쇄유전자를 1:1의 비율로 먼저 섞고 PEI:변이체유전자=4:1의 비율로 섞어 상온에서 20 분간 두었다가 전날 2x106 cells/ml의 밀도로 계대배양해 놓은 Expi293F 세포에 트랜스펙션하였다. 그 후 진탕배양기에서 37 ℃, 125 rpm 및 8 % CO2의 조건으로 7일간 배양하고 원심 분리하여 상등액만 취하였다. 상등액을 25x PBS를 이용해 평형을 맞춘 뒤 바틀탑 필터를 이용해 0.2 μm 필터 (Merck Millipore)로 여과하였다. 여과된 배양액에 Protein A 레진 500 μl을 넣어 주고 4 ℃에서 16 시간 교반한 뒤 컬럼을 통해 레진을 회수 한 후 5 ml PBS로 세척하고 pH 2.7의 100 mM 글리신(glycine) 버퍼 3 ml로 용출하고 1M Tris-HCl pH 8.0을 이용하여 중화하였다. Centrifugal filter units 3K (Merck Millipore)을 사용하여 PBS로 버퍼 교체한 후 정제된 2종의 JS40-1 및 JS48-1를 각각 포함하는 IgG들의 크기와 순도를 SDS-PAGE를 통해 분석하였다 (도 11).
실시예 13. JS40-1 및 JS48-1 항체의 Fc 알파 수용체에 대한
결합력 분석
상기 실시예 12에서 제작한 항체 JS40-1 및 JS48-1의 단백질 상에서 Fc 알파 수용체에 대한 결합력을 확인하기 위해 ELISA 실험을 수행하였다. 구체적으로, pH 9.6의 0.05 M Na2CO3에 4 μg/ml로 스트렙타비딘 태그를 융합한 사합체 형태의 Fc 알파 수용체 (항원)를 50 μl씩 Flat Bottom Polystyrene High Bind 96웰 마이크로플레이트 (costar)에 4℃에서 16 시간 동안 고정화한 후 100 μl의 4% 스킴밀크 (GenomicBase) (in 0.05% PBST pH 6.0/pH 7.4)로 상온에서 2 시간 동안 블로킹하였다. 0.05% PBST 180 μl로 4 회씩 세척한 뒤 1% 스킴밀크 (in 0.05% PBST)로 연속 희석한 상기 실시예 12에서 제작된 2종의 항체들 (JS40-1 및 JS48-1)과 대조군으로서 기존의 항체 2종 (JS40 및 JS48)를 50 μl씩 각 웰에 분주하여 상온에서 1 시간 동안 반응시켰다. 세척 과정 후 50 μl의 항-인간 IgG(H+L)-HRP 컨쥬게이트 (Jackson Immunoresearch)과 상온에서 1 시간 동안 각각 항체 반응을 진행하고 세척하였다. 그 후 1-Step Ultra TMB-ELISA Substrate Solution (Thermo Fisher Scientific)를 50 μl씩 첨가해 발색한 뒤 50 μl의 2 M H2SO4를 첨가하여 반응을 종료시킨 다음 Epoch Microplate Spectrophotometer (BioTek)을 이용해 각 항체의 항원인 Fc 알파 수용체에 대한 결합력을 분석하였다 (도 12).
실시예 14.
이중 항체 생산 및 정제
Fc 알파 수용체에 결합하는 항체를 이용하여 호중구의 효과기 기능을 극대화하는 치료용 항체를 제작하기 위해, 상기 실시예에서 Fc 알파 수용체와 결합력이 높았던 JS40 항체 및 JS48 항체를 각각 이중 항체 형태로 제작하였다. 구체적으로, 각각 JS40, JS48 및 Her-2를 타겟으로 하는 트라스트주맙(Trastuzumab)을 각각 scFv 및 Fab 형태로 하여 Fc에 Knob(T366W) 및 Hole(T366S, L368A, Y407V)가 도입된 4종의 이중항체들, JSB-40-1 (JS40 Fab + 트라스트주맙의 scFv), JSB-48-1 (JS48 Fab + 트라스트주맙의 scFv), JSB-40-2 (JS40 scFv + 트라스트주맙의 Fab) 및 JSB-48-2 (JS48 scFv + 트라스트주맙의 Fab)를 제작하였으며, JS40, JS48 및 트라스트주맙이 각각의 항체의 Fc 말단에 scFv 형태로 연결되어 있는 4종의 이중항체 JSC-40-1 (JS40 IgG + 트라스트주맙 scFv), JSC-48-1 (JS48 IgG + 트라스트주맙 scFv), JSC-40-2 (트라스트주맙 IgG + JS40 scFv) 및 JSC-48-2 (트라스트주맙 IgG + JS48 scFv)를 제작하기 위해, 8종의 항체의 중쇄 및 경쇄 발현 백터를 각각 제작하였다 (도 13). 그 후, 상기 실시예에서와 같이 항체들을 발현 및 정제한 JSB-40-1, JSB-40-2, JSB-48-1, JSB-48-2는 anti-Cκ resin, JSC-40-1, JSC-40-2, JSC-48-1 및 JSC-48-2들의 크기와 순도를 SDS-PAGE로 분석하였다 (도 14).
실시예 15.
이중 항체의 두 가지 항원에 대한 결합력 분석
상기 실시예 14에서 제작한 이중 항체들의 두가지 항원인 Fc 알파 수용체 및 Her-2에 대한 결합력을 측정해 보기 위하여 앞선 실험과 동일한 조건으로 ELISA 분석을 진행하였다. 구체적으로, 상기 이중 항체들을 연속 희석하여 반응시킨 뒤 세척한 후 50 μl의 Protein L-HRP 컨쥬게이트 (GenScript)와 상온에서 1 시간 동안 각각 항체 반응을 진행하고 세척하였다. 그 후 1-Step Ultra TMB-ELISA Substrate Solution(Thermo Fisher Scientific)를 50 μl씩 첨가해 발색한 뒤 50 μl의 2 M H2SO4를 첨가하여 반응을 종료시킨 다음 Epoch Microplate Spectrophotometer (BioTek)을 이용해 각 항체의 항원인 Fc 알파 수용체에 대한 결합력을 분석하였다. 그 결과, 이중 항체들 모두 Her-2 항원 및 Fc 알파 수용체에 우수한 결합력을 보였으며, 다양한 이중항체 포맷(format)들은 결합력의 차이가 있지만 모두 두 항원에 특이적으로 결합하였다 (도 15).
Claims (30)
- (a) 서열번호 1 내지 3의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRH(Complementarity determining regions Heavy chain)1, 서열번호 4 내지 7의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRH2, 및 서열번호 8 내지 15의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 16 내지 21의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRL(Complementarity determining regions Light chain)1, 서열번호 22 내지 27의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRL2, 및 서열번호 28 내지 32의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 33 내지 36의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR1, 서열번호 37 내지 41의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR2, 서열번호 42 내지 44의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR3, 및 서열번호 45 또는 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는(b) 서열번호 47 내지 52의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR1, 서열번호 53 내지 56의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR2, 서열번호 57 내지 63의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR3 및 서열번호 64 내지 67의 아미노산 서열로 이루어지는 군으로부터 선택되는 어느 하나를 포함하는 FR4를 포함하는 VL 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 11의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 16의 아미노산 서열을 포함하는 CDRL1, 서열번호 24의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 28의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 11의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 17의 아미노산 서열을 포함하는 CDRL1, 서열번호 23의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 30의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 8의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 16의 아미노산 서열을 포함하는 CDRL1, 서열번호 22의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 28의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 9의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 16의 아미노산 서열을 포함하는 CDRL1, 서열번호 22의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 28의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 10의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 17의 아미노산 서열을 포함하는 CDRL1, 서열번호 23의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 29의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 34의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 37의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 11의 아미노산 서열을 포함하는 CDRH3 및 서열번호 46의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는(b) 서열번호 49의 아미노산 서열을 포함하는 FR1, 서열번호 16의 아미노산 서열을 포함하는 CDRL1, 서열번호 54의 아미노산 서열을 포함하는 FR2, 서열번호 24의 아미노산 서열을 포함하는 CDRL2, 서열번호 59의 아미노산 서열을 포함하는 FR3, 서열번호 28의 아미노산 서열을 포함하는 CDRL3 및 서열번호 65의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 33의 아미노산 서열을 포함하는 FR1, 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 37의 아미노산 서열을 포함하는 FR2, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 서열번호 42의 아미노산 서열을 포함하는 FR3, 서열번호 11의 아미노산 서열을 포함하는 CDRH3 및 서열번호 45의 아미노산 서열을 포함하는 FR4를 포함하는 VH 도메인; 및/또는(b) 서열번호 47의 아미노산 서열을 포함하는 FR1, 서열번호 17의 아미노산 서열을 포함하는 CDRL1, 서열번호 53의 아미노산 서열을 포함하는 FR2, 서열번호 23의 아미노산 서열을 포함하는 CDRL2, 서열번호 57의 아미노산 서열을 포함하는 FR3, 서열번호 30의 아미노산 서열을 포함하는 CDRL3 및 서열번호 64의 아미노산 서열을 포함하는 FR4를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 2의 아미노산 서열을 포함하는 CDRH1, 서열번호 6의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 12의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 18의 아미노산 서열을 포함하는 CDRL1, 서열번호 25의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 31의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 1의 아미노산 서열을 포함하는 CDRH1, 서열번호 4의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 15의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 21의 아미노산 서열을 포함하는 CDRL1, 서열번호 27의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 32의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 3의 아미노산 서열을 포함하는 CDRH1, 서열번호 7의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 13의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 19의 아미노산 서열을 포함하는 CDRL1, 서열번호 26의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 30의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, (a) 서열번호 3의 아미노산 서열을 포함하는 CDRH1, 서열번호 7의 아미노산 서열을 포함하는 CDRH2, 및 서열번호 14의 아미노산 서열을 포함하는 CDRH3를 포함하는 VH 도메인; 및/또는(b) 서열번호 20의 아미노산 서열을 포함하는 CDRL1, 서열번호 23의 아미노산 서열을 포함하는 CDRL2, 및 서열번호 30의 아미노산 서열을 포함하는 CDRL3를 포함하는 VL 도메인을 포함하는 V 도메인을 포함하는, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항에 있어서, 면역학적 활성을 가진 단편은 Fab, Fd, Fab', dAb, F(ab'), F(ab')2, scFv(single chain fragment variable), Fv, 단일쇄 항체, Fv 이량체, 상보성 결정 영역 단편, 인간화 항체, 키메라 항체 및 디아바디(diabody)로 이루어진 군으로부터 선택되는 어느 하나인, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편.
- 제 1항의 항체 또는 이의 면역학적 활성을 가진 단편, 및 Fc 알파 수용체 이외의 표적 항원에 결합하는 부분을 포함하는 이중특이적 또는 다중특이적 항체.
- 제 15항에 있어서, 표적 항원에 결합하는 부분이 항체 또는 이의 면역학적 활성을 가진 단편을 포함하는, 이중특이적 또는 다중특이적 항체.
- 제 15항에 있어서, 표적 항원은 17-1A 항원, GD3 갱글리오시드 R24, EGFRvⅢ, PSMA, PSCA, HLA-DR, EpCAM, MUC1 코어 단백질, 이상 글리코실화 MUC1, ED-B 도메인을 함유하는 피브로넥틴 이형, HER2/neu, 암종배아성 항원(CEA), 가스트린-방출 펩티드(GRP) 수용체 항원, 뮤신(mucine) 항원, 표피 성장 인자 수용체(EGF-R), HER3, HER4, MAGE 항원, SART 항원, MUC1 항원, c-erb-2 항원, TAG 72, 탄산 무수화효소 IX(carbonic anhydrase IX), 알파-태아단백질(alpha-fetoprotein), A3, A33 항체에 특이적인 항원, Ba 733, BrE3-항원, CA125, CDl, CD1a, CD3, CD5, CDl5, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD33, CD38, CD40, CD45, CD52, CD74, CD79a, CD80, CD138, 결장-특이적 항원-p(CSAp), CSAp, EGP-1, EGP-2, Ep-CAM, FIt-1, Flt-3, 폴산염 수용체(folate receptor), HLA-DR, 인간 융모성 성선자극호르몬(HCG) 및 그 소단위체들, 저산소증 유도 인자(HIF-I), Ia, IL-2, IL-6, IL-8, 인슐린 성장 인자-1(IGF-1), KC4-항원, KS-1-항원, KSl-4, Le-Y, 대식세포 억제 인자(MIF), MAGE, MUCl, MUC2, MUC3, MUC4, NCA66, NCA95, NCA90, PAM-4 항체에 특이적인 항원, 태반 성장 인자, p53, 전립선 산성 포스파타제(prostatic acid phosphatase), PSA, RS5, SlOO, TAC, 테나신(tenascin), TRAIL 수용체들, Tn 항원, 톰슨-프리덴라이히(Thomson-Friedenreich) 항원들, 종양 괴사 항원들, VEGF, ED-B 피브로넥틴(fibronectin), 혈관형성 표지(angiogenesis marker), 종양유전자 표지(oncogene marker) 또는 종양유전자 생성물로 이루어지는 군으로부터 선택되는 어느 하나 이상인, 이중특이적 또는 다중특이적 항체.
- 제 17항에 있어서, 종양유전자는 SEPTIN9, ACOD1, ACTN4, ADAM28, ADAM9, ADGRF1, ADRBK2, AFF1, AFF3, AGAP2, AGFG1, AGRN, AHCYL1, AHI1, AIMP2, AKAP13, AKAP9, AKIRIN2, AKTIP, ALDH1A1, ALL1, ANIB1, ANP32C, ANP32D, AQP1, ARAF, ARHGEF1, ARHGEF2, ARHGEF5, ASPSCR1, AURKA, BAALC, BAIAP2L1, BANP, BCAR4, BCKDHB, BCL9, BCL9L, BCR, BMI1, BMP7, BOC, BRD4, BRF2, CABIN1, CAMK1D, CAPG, CBFB, CBLB, CBLL1, CBX7, CBX8, CCDC28A, CCDC6, CCNB1, CCNB2, CCND1, CCNE1, CCNL1, CD24, CDC25C, CDC6, CDH17, CDK1, CDK14, CDK4, CDK5R2, CDK6, CDK8, CDKN1B, CDKN3, CDON, CEACAM6, CENPW, CHD1L, CHIC1, CHL1, CKS1B, CMC4, CNTN2, COPS3, COPS5, CRKL, CRLF2, CROT, CRTC1, CRYAB, CSF1R, CSF3, CSF3R, CSNK2A1, CSNK2A2, CT45A1, CTBP2, CTNND2, CTSZ, CUL7, CXCL1, CXCL2, CXCL3, CYGB, CYP24A1, DCD, DCUN1D1DDB2, DDHD2, DDX6, DEK, DIS3, DNPH1, DPPA2, DPPA4, DSG3, DUSP12, DUSP26, ECHS1, ECT2, EEF1A1, EEF1A2, EEF1D, EIF3E, EIF3I, EIF4E, EIF5A2, ELAVL1, ELL, EML4, EMSY, ENTPD5, EPCAM, EPS8, ERAS, ERGIC1, ERVW-1, EVI2A, EVI5, EWSR1, EZH2, FAM189B, FAM72A, FAM83D, FASN, FDPS, FGF10, FGF3, FGF5, FGF8, FR1OP, FHL2, FIP1L1, FNDC3B, FRAT1, FUBP1, FUS, FZD2, GAB2, GAEC1, GALNT10, GALR2, GLO1, GMNN, GNA12, GNA13, GNAI2, GNAQ, GNAS, GOLPH3, GOPC, GPAT4, GPM6A, GPM6B, GPR132, GREM1, GRM1, GSK3A, GSM1, H19, HAS1, HAX1, HDGFRP2, HMGN5, HNRNPA1, HOTAIR, HOTTIP, HOXA-AS2, HRAS, HSPA1A, HSPA4, HSPB1, HULC, IDH1, IFNG, IGF2BP1, IKBKE, IL7R, INPPL1, INTS1, INTS2, INTS3, INTS4, INTS5, INTS7, INTS8, IRS2, IST1, JUP, KDM4C, KIAA0101, KIAA1524, KIF14, KRAS, KSR2, LAMTOR5, LAPTM4B, LCN2, LDHB, LETMD1, LIN28A, LIN28B, LMO1, LMO2, LMO3, LMO4, LSM1, LUADT1, MACC1, MACROD1, MAGEA11, MALAT1, MAML2, MAP3K8, MAPRE1, MAS1, MCC, MCF2, MCF2L, MCTS1, MEFV, MFHAS1, MFNG, MIEN1, MINA, MKL2, MLANA, MLLT1, MLLT11, MLLT3, MLLT4, MMP12, MMS22L, MN1, MNAT1, MOS, MPL, MPST, MRAS, MRE11A, MSI1, MTCP1, MTDH, MTOR, MUC1, MUC4, MUM1, MYD88, NAAA, NANOGP8, NBPF12, NCOA4, NEAT1, NECTIN4, NEDD4, NEDD9, NET1, NINL, NME1, NOTCH1, NOTCH4, NOV, NSD1, NUAK2, NUP214, NUP98, NUTM1, OLR1, PA2G4, PADI2, PAK7, PARK7, PARM1, PBK, PCAT1, PCAT5, PDGFA, PDZK1IP1, PELP1, PFN1P3, PIGU, PIK3CA, PIK3R1, PIM1, PIM2, PIM3, PIR, PIWIL1, PLAC8, PLK1, PPM1D, PPP1R10, PPP1R14A, PPP2R1A, PRAME, PRDM12, PRMT5, PSIP1, PSMD10, PTCH2, PTMA, PTP4A1, PTP4A2, PTP4A3, PTTG1, PTTG1IP, PTTG2, PVT1, RAB11A, RAB18, RAB22A, RAB23, RAB8A, RALGDS, RAP1A, RASSF1, RBM14, RBM15, RBM3, RBMY1A1, RFC3, RGL4, RGR, RHO, RING1, RINT1, RIT1, RNF43, RPL23, RRAS, RRAS2, RSF1, RUNX1T1, S100A4, S100A7, S100A8, SAG, SART3, SBSN, SEA, SEC62, SERTAD1, SERTAD2, SERTAD3, SET, SETBP1, SETDB1, SGK1, SIRT1, SIRT6, SKI, SKIL, SKP2, SLC12A5, SLC3A2, SMR3B, SMURF1, SNCG, SNORA59A, SNORA80E, SPAG9, SPATA4, SPRY2, SQSTM1, SRSF1, SRSF2, SRSF3, SRSF6, SS18, SSX1, SSX2, SSX2B, STIL, STMN1, STRA6, STYK1, SUZ12, SWAP70, SYT1, TAC1, TACSTD2, TAF15, TALDO1, TAZ, TBC1D1, TBC1D15, TBC1D3, TBC1D3C, TBC1D7, TCL1A, TCL1B, TCL6, TCP1, TFG, TGM3, TINCR, TKTL1, TLE1, TMEM140, TMPOP2, TMPRSS2, TNS4, TPD52, TPR, TRE17, TREH, TRIB1, TRIB2, TRIM28, TRIM32, TRIM8, TRIO, TRIP6, TSPAN1, TSPY1, TXN, TYMS, TYRP1, UBE2C, UBE3C, UCA1, UCHL1, UHRF1, URI1, USP22, USP4, USP6, VAV1, VAV2, VAV3, VIM, WAPL, WHSC1, WHSC1L1, WISP1, WNT1, WNT10A, WNT10B, WNT2, WNT3, WNT5A, WWTR1, XCL1, XIAP, YAP1, YEATS4, YY1AP1, ZEB1-AS1, ZFAND4, ZFAS1, ZMYM2, ZNF703 및 ZNHIT6로 이루어지는 군으로부터 선택되는 어느 하나 이상인, 이중특이적 또는 다중특이적 항체.
- 제 15항에 있어서, 표적 항원은 세포 표면 항원인, 이중특이적 또는 다중특이적 항체.
- 제 19항에 있어서, 세포 표면 항원은 CEA, ED-B 피브로넥틴, CD20, CD22, CDl9, EGFR, IGFlR, VEFGRl/Flt-1, VEGFR2/KDR, VEGRF3/Flt-4, HER2/neu, CD30, CD33, CD3, CD16, CD64, CD89, CD2, 아데노바이러스 섬유 놉((fiber knob)), PfMSP-1, HN/NDV, EpCAM/17-lA, hTR, IL-2R/Tac, CAl9-9, MUCl, HLA 클래스 II, GD2, G250, TAG-72, PSMA, CEACAM6, HMWMAA, CD40, Ml3 외피 단백질 및 GPIIb/IIIa로 이루어지는 군으로부터 선택되는 어느 하나 이상인, 이중특이적 또는 다중특이적 항체.
- 제 15항에 있어서, 표적 항원은 자가항원인, 이중특이적 또는 다중특이적 항체.
- 제 1항의 항체 또는 이의 면역학적 활성을 가진 단편 또는 제 15항의 이중특이적 또는 다중특이적 항체를 코딩하는 단리된 핵산 분자.
- 제 22항의 단리된 핵산 분자를 포함하는 벡터.
- 제 23항의 벡터로 형질전환된 숙주 세포.
- 제 15항의 이중특이적 또는 다중특이적 항체를 유효성분으로 포함하는 암, 자가면역 질환, 퇴행성신경 질환(neurodegerative disease), 알츠하이머병, 대사 질환(metabolic disease), 심혈관 질환(cardiovascular disease), 죽상동맥경화증(atherosclerosis), 기관 이식 거부반응, 진균, 바이러스, 박테리아 또는 기생충에 의하여 유발되는 질환 또는 증상으로 이루어진 군으로부터 선택되는 질병 또는 질환의 예방 또는 치료용 약학적 조성물.
- a) 제 1항의 항체 또는 이의 면역학적 활성을 가진 단편을 코딩하는 단리된 핵산 분자를 포함하는 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및b) 숙주 세포 배양물로부터 항체 또는 이의 면역학적 활성을 가진 단편을 회수하는 단계를 포함하는 Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편을 제조하는 방법.
- a) 제 15항의 이중특이적 또는 다중특이적 항체를 코딩하는 단리된 핵산 분자를 포함하는 벡터로 형질전환된 숙주 세포를 배양하는 단계; 및b) 숙주 세포 배양물로부터 항체 또는 이의 면역학적 활성을 가진 단편을 회수하는 단계를 포함하는 Fc 알파 수용체 및 Fc 알파 수용체 이외의 표적 항원에 결합하는 이중특이적 또는 다중특이적 항체를 제조하는 방법.
- 항체 치료제의 제조에 사용하기 위한, Fc 알파 수용체에 특이적인 항체 또는 이의 면역학적 활성을 가진 단편의 용도.
- 이중특이적 또는 다중특이적 항체의 암, 자가면역 질환, 퇴행성신경 질환(neurodegerative disease), 알츠하이머병, 대사 질환(metabolic disease), 심혈관 질환(cardiovascular disease), 죽상동맥경화증(atherosclerosis), 기관 이식 거부반응, 진균, 바이러스, 박테리아 또는 기생충에 의하여 유발되는 질환 또는 증상으로 이루어진 군으로부터 선택되는 질병 또는 질환의 예방 또는 치료 용도.
- 이중특이적 또는 다중특이적 항체를 약학적으로 유효한 양으로 암에 걸린 개체에 투여하는 단계를 포함하는 암 치료 방법.
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP21889549.8A EP4242233A1 (en) | 2020-11-06 | 2021-11-03 | Fc alpha receptor binding antibody |
CN202180075236.XA CN116419928A (zh) | 2020-11-06 | 2021-11-03 | Fcα受体结合抗体 |
US18/035,609 US20230399407A1 (en) | 2020-11-06 | 2021-11-03 | Fc alpha receptor binding antibody |
Applications Claiming Priority (10)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020200147845A KR20220061639A (ko) | 2020-11-06 | 2020-11-06 | Fc 알파 수용체 결합력이 향상된 항체 |
KR1020200147716A KR20220061583A (ko) | 2020-11-06 | 2020-11-06 | Fc 알파 수용체 결합력이 증진된 항체 |
KR10-2020-0147845 | 2020-11-06 | ||
KR1020200147590A KR20220061516A (ko) | 2020-11-06 | 2020-11-06 | Fc 알파 수용체 결합 항체 |
KR10-2020-0147716 | 2020-11-06 | ||
KR10-2020-0147590 | 2020-11-06 | ||
KR1020210135095A KR20230052017A (ko) | 2021-10-12 | 2021-10-12 | 인간 Fc 알파 수용체 결합을 위한 인간 항체들 |
KR10-2021-0135094 | 2021-10-12 | ||
KR1020210135094A KR20230052016A (ko) | 2021-10-12 | 2021-10-12 | 인간 Fc 알파 수용체 표적을 위한 인간 유래 항체들 |
KR10-2021-0135095 | 2021-10-12 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022098084A1 true WO2022098084A1 (ko) | 2022-05-12 |
Family
ID=81458083
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2021/015795 WO2022098084A1 (ko) | 2020-11-06 | 2021-11-03 | Fc 알파 수용체 결합 항체 |
Country Status (4)
Country | Link |
---|---|
US (1) | US20230399407A1 (ko) |
EP (1) | EP4242233A1 (ko) |
CN (1) | CN116419928A (ko) |
WO (1) | WO2022098084A1 (ko) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117327703B (zh) * | 2023-11-22 | 2024-04-23 | 青岛大学附属医院 | 一种靶向平滑肌细胞的Agrin-shRNA及其在制备抗动脉粥样硬化的药物中的应用 |
Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1994013804A1 (en) | 1992-12-04 | 1994-06-23 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
WO1998002463A1 (en) * | 1996-07-11 | 1998-01-22 | Medarex, Inc. | THERAPEUTIC MULTISPECIFIC COMPOUNDS COMPRISED OF ANTI-FCα RECEPTOR ANTIBODIES |
US6018031A (en) * | 1989-10-20 | 2000-01-25 | Trustees Of Dartmouth College | Binding agents specific for IgA receptor |
KR20020047103A (ko) * | 1999-07-30 | 2002-06-21 | 추후제출 | 항-Fc 수용체 결합제를 포함하는 치료 화합물 |
KR20040062873A (ko) * | 2001-02-12 | 2004-07-09 | 메다렉스, 인코포레이티드 | Fc 알파 수용체(CD89)에 대한 인간 모노클로날 항체 |
US9209965B2 (en) | 2014-01-14 | 2015-12-08 | Microsemi Semiconductor Ulc | Network interface with clock recovery module on line card |
WO2016055941A1 (en) * | 2014-10-10 | 2016-04-14 | National Research Council Of Canada | Anti-tau antibody and uses thereof |
-
2021
- 2021-11-03 US US18/035,609 patent/US20230399407A1/en active Pending
- 2021-11-03 WO PCT/KR2021/015795 patent/WO2022098084A1/ko unknown
- 2021-11-03 EP EP21889549.8A patent/EP4242233A1/en active Pending
- 2021-11-03 CN CN202180075236.XA patent/CN116419928A/zh active Pending
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6018031A (en) * | 1989-10-20 | 2000-01-25 | Trustees Of Dartmouth College | Binding agents specific for IgA receptor |
WO1994013804A1 (en) | 1992-12-04 | 1994-06-23 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
WO1998002463A1 (en) * | 1996-07-11 | 1998-01-22 | Medarex, Inc. | THERAPEUTIC MULTISPECIFIC COMPOUNDS COMPRISED OF ANTI-FCα RECEPTOR ANTIBODIES |
KR20020047103A (ko) * | 1999-07-30 | 2002-06-21 | 추후제출 | 항-Fc 수용체 결합제를 포함하는 치료 화합물 |
KR20040062873A (ko) * | 2001-02-12 | 2004-07-09 | 메다렉스, 인코포레이티드 | Fc 알파 수용체(CD89)에 대한 인간 모노클로날 항체 |
US9209965B2 (en) | 2014-01-14 | 2015-12-08 | Microsemi Semiconductor Ulc | Network interface with clock recovery module on line card |
WO2016055941A1 (en) * | 2014-10-10 | 2016-04-14 | National Research Council Of Canada | Anti-tau antibody and uses thereof |
Non-Patent Citations (21)
Title |
---|
"Goodman and Gilman's The Pharmacological Basis of Therapeutics", 2001, PERGAMON PRESS |
"Merck Index", MERCK & CO. INC. |
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY |
AUSUBEL ET AL.: "In: Current Protocols in Molecular Biology", 1994, WILEY & SONS |
CLYNES, R. A. ET AL., NATURE MEDICINE, vol. 6, no. 4, 2000, pages 443 - 446 |
DEO, Y.M ET AL., IMMUNOL. TODAY, vol. 19, no. 3, 1997, pages 127 - 135 |
GOMEZ-GUERRERO, C. ET AL., J. IMMUNOL., vol. 156, 1996, pages 4369 - 4376 |
KALERGIS, A. M.RAVETCH, J. V., J. EXP. MED., vol. 195, no. 12, June 2002 (2002-06-01), pages 1653 - 1659 |
MANIATIS ET AL.: "Molecular Cloning, A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS |
MAZANGERA, R. L ET AL., BIOCHEM. J., vol. 272, 1990, pages 159 - 165 |
MORTON, H. C ET AL., J. BIOL. CHEM., vol. 270, 1995, pages 29781 |
MORTON, H. C.M. VAN EGMONDJ. G. J. VAN DE WINKEL, CRITICAL REVIEWS IN IMMUNOLOGY, vol. 16, 1996, pages 423 |
PATTY, C.A. HERBELINA. LIHUENJ. F. BACHR. C. MONTEIRO, IMMUNOLOGY, vol. 86, 1995, pages 1 - 5 |
PFEFFERKOM, L. C. ET AL., J. IMMUNOL., vol. 153, 1995, pages 3228 - 3236 |
SAITO, K ET AL., J. ALLERGY CLIN. IMMUNOL, vol. 96, 1995, pages 1152 |
SELENKO, N. ET AL., J CLIN. IMMUNOL, vol. 22, no. 3, 2002, pages 124 - 130 |
SELENKO, N. ET AL., J. CLIN. IMMUNOL, vol. 22, no. 3, 2002, pages 124 - 130 |
SHEN, L., J. LEUKOCYTE BIOLOGY, vol. 51, 1992, pages 373 - 378 |
STEWART, W. W.M. A. KERR, IMMUNOLOGY, vol. 71, 1990, pages 328 - 334 |
STEWART, W. W.R. L. MAZYEGERAL. SHENM. A. KERR, J. LEUCOCYTE BIOLOGY, vol. 56, 1994, pages 481 - 487 |
WARD ES ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
Also Published As
Publication number | Publication date |
---|---|
EP4242233A1 (en) | 2023-09-13 |
US20230399407A1 (en) | 2023-12-14 |
CN116419928A (zh) | 2023-07-11 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230046047A1 (en) | Compositions and methods for making antibody conjugates | |
JP2020537509A (ja) | Tigit抗体、その抗原結合断片及びその医療用途 本願は、2019年9月29日に出願された出願番号cn201710908565.3に基づいたものであり、その優先権を主張する。その開示は、その全体が参照により本明細書に組み込まれる。 | |
JPH03501330A (ja) | カケクチンと反応するモノクロナール抗体 | |
EA006310B1 (ru) | Ассоциированные с ганглиозидами рекомбинантные антитела и их применение в диагностике и лечении опухолей | |
TW201930360A (zh) | Pd-l1抗體、其抗原結合片段及醫藥用途 | |
KR102652664B1 (ko) | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 | |
CN112442132A (zh) | 靶向肿瘤的重组双功能融合蛋白及其应用 | |
WO2022098084A1 (ko) | Fc 알파 수용체 결합 항체 | |
JPH07504802A (ja) | 遺伝子操作抗体 | |
JP2022527084A (ja) | Cd38に結合する操作されたバリアント抗体 | |
WO2020063660A1 (zh) | 抗ox40抗体、其抗原结合片段及其医药用途 | |
EA021101B1 (ru) | ГУМАНИЗИРОВАННОЕ АНТИТЕЛО К PcrV, ОБЛАДАЮЩЕЕ АКТИВНОСТЬЮ ПРОТИВ ПСЕВДОМОНАС | |
US9493561B2 (en) | Antibodies to Toso | |
Coomber et al. | Generation of anti-p53 Fab fragments from individuals with colorectal cancer using phage display | |
EP4324848A1 (en) | Human antibody targeting covid-19 virus | |
KR20210128252A (ko) | 코로나-19 바이러스 표적 인간 항체 | |
WO2024005422A1 (ko) | Nkp30 결합력이 향상된 b7-h6 변이체 | |
KR20220061639A (ko) | Fc 알파 수용체 결합력이 향상된 항체 | |
KR20220061583A (ko) | Fc 알파 수용체 결합력이 증진된 항체 | |
KR20220061516A (ko) | Fc 알파 수용체 결합 항체 | |
WO2020242200A1 (ko) | 엔도텔린 수용체 a 결합력이 향상된 항체 | |
JP2007527703A (ja) | 肺炎球菌表面付着因子Aタンパク質(PsaA)に関する結合メンバー | |
Orlandi et al. | Antigenic and immunogenic mimicry of the HER2/neu oncoprotein by phage‐displayed peptides | |
WO2023043125A1 (ko) | 다양한 fc 감마 수용체들과의 결합력이 증대된 fc 변이체 | |
WO2018079997A1 (ko) | 암 치료용 무당화 항체 Fc 영역 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21889549 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2021889549 Country of ref document: EP Effective date: 20230606 |