WO2022055243A1 - 인플루엔자 a 바이러스에 대한 항바이러스용 조성물 - Google Patents

인플루엔자 a 바이러스에 대한 항바이러스용 조성물 Download PDF

Info

Publication number
WO2022055243A1
WO2022055243A1 PCT/KR2021/012191 KR2021012191W WO2022055243A1 WO 2022055243 A1 WO2022055243 A1 WO 2022055243A1 KR 2021012191 W KR2021012191 W KR 2021012191W WO 2022055243 A1 WO2022055243 A1 WO 2022055243A1
Authority
WO
WIPO (PCT)
Prior art keywords
virus
influenza
subtype
seq
scfv
Prior art date
Application number
PCT/KR2021/012191
Other languages
English (en)
French (fr)
Inventor
김태현
김영준
오광지
이건섭
이용준
Original Assignee
주식회사 노블젠
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 노블젠 filed Critical 주식회사 노블젠
Priority to CN202180052536.6A priority Critical patent/CN116367856A/zh
Priority to EP21867109.7A priority patent/EP4212548A4/en
Priority to JP2023515629A priority patent/JP2023540373A/ja
Priority to US18/021,989 priority patent/US20240018218A1/en
Priority claimed from KR1020210119473A external-priority patent/KR20220033038A/ko
Publication of WO2022055243A1 publication Critical patent/WO2022055243A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1018—Orthomyxoviridae, e.g. influenza virus
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17—Amino acids, peptides or proteins
    • A23L33/18—Peptides; Protein hydrolysates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/11—Immunoglobulins specific features characterized by their source of isolation or production isolated from eggs
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/14—Specific host cells or culture conditions, e.g. components, pH or temperature
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77—Internalization into the cell

Definitions

  • the present invention relates to a composition for antiviral against influenza A virus.
  • Influenza commonly known as 'the flu', is a contagious febrile respiratory disease caused by an influenza virus. Influenza A and B viruses spread to people and cause seasonal flu outbreaks each year. According to the World Health Organization (WHO), influenza virus transmission causes about 3 to 5 million severe cases and about 290,000 to 650,000 deaths. The WHO recommends annual influenza vaccination for high-risk groups, and vaccines are generally effective against three to four types of influenza. However, because viruses evolve rapidly, a vaccine made in one year may not be useful the following year. The genomes of influenza A and B viruses can be mutated in two ways: antigenic drift and antigenic shift, and thus existing vaccines or antiviral agents show low antiviral efficacy against viruses. Therefore, even if a mutation occurs in the genome of the influenza virus, there is a need to develop a material exhibiting excellent antiviral efficacy.
  • WHO World Health Organization
  • An object of the present invention is to provide a composition for antiviral against influenza A virus.
  • An object of the present invention is to provide a pharmaceutical composition for the prevention or treatment of influenza A virus infection disease.
  • An object of the present invention is to provide a food composition for preventing or improving influenza A virus infection disease.
  • Heavy chain CDR1 represented by SEQ ID NO: 1 (VH CDR1), VH CDR2 represented by SEQ ID NO: 2, and VH CDR3 represented by SEQ ID NO: 3, light chain CDR1 represented by SEQ ID NO: 4 (VL CDR1), SEQ ID NO: 5
  • An antiviral composition for influenza A virus comprising an antibody or fragment thereof comprising the VL CDR2 represented by and the VL CDR3 represented by SEQ ID NO: 6.
  • influenza A virus is influenza A virus H1 subtype, influenza A virus H2 subtype, influenza A virus H5 subtype and influenza A virus H6 subtype, influenza A virus H3 subtype, influenza A virus
  • An antiviral composition which is at least one selected from the group consisting of H4 subtype, influenza A virus H14 subtype, and variants thereof.
  • influenza A virus is at least one selected from the group consisting of influenza A virus N1 subtype, influenza A virus N2 subtype, and variants thereof.
  • influenza A virus is at least one of H1N1 subtype, H3N2 subtype, and variants thereof.
  • influenza A virus is an oseltamivir-resistant influenza A virus.
  • a pharmaceutical composition for preventing or treating influenza A virus infection disease comprising the composition of any one of items 1 to 8 above.
  • a food composition for preventing or improving influenza A virus infection disease comprising the composition of any one of items 1 to 8 above.
  • the antibody or fragment thereof contained in the antiviral composition of the present invention may penetrate into virus-infected cells, bind to influenza A virus RNA and degrade it.
  • Antiviral composition of the present invention exhibits an excellent antiviral effect on influenza A virus by specifically binding to influenza A virus and hydrolyzing it, and influenza A It may exhibit the effect of preventing, treating, or ameliorating a viral infection disease.
  • the antiviral composition of the present invention may exhibit excellent antiviral efficacy against various subtypes of influenza A virus or its variants.
  • the antiviral composition of the present invention may exhibit excellent antiviral efficacy against oseltamivir-resistant influenza A virus.
  • FIG 1 shows the sequence of an antibody or fragment thereof according to an embodiment.
  • FIG. 2 shows a partial structure of a recombinant vector for the production of an antibody fragment according to an embodiment.
  • Figure 3 shows the intracellular penetration activity of the antibody fragment according to an embodiment.
  • FIG 4 shows the viral RNA (NA and NP) hydrolytic activity of the antibody fragment according to an embodiment.
  • 5 shows the results of confirming the intracellular toxicity of the antibody fragment according to an embodiment through MTT analysis.
  • FIG. 6 shows a schematic diagram and test results for testing the antiviral effect (cell viability) of 3D8 scFv pretreatment against influenza A virus strains (H1N1/PR8, H3N2/X-31 and H1N1/H275Y) (*P ⁇ 0.05 , **P ⁇ 0.01, ***P ⁇ 0.001).
  • FIG. 7 shows a schematic diagram and test results for testing the antiviral effect (cell viability) of 3D8 scFv post-treatment against influenza A virus strains (H1N1/PR8, H3N2/X-31 and H1N1/H275Y) (*P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001).
  • Figure 8 shows the results of the test results of the antiviral effect (viral RNA/protein expression level) of the 3D8 scFv pre/post-treatment on the H1N1/PR8 strain.
  • Figure 9 shows the results of the antiviral effect (viral RNA/protein expression level) test results of the 3D8 scFv pre/post-treatment on the H3N2/X-31 strain.
  • FIG. 11 shows the results of detection of viral protein HA in cells infected with influenza virus after 3D8 scFv was pre-treated (nucleus: DAPI (blue), 3D8 scFv: Alexa flour 488 (green), virus HA: TRITC (red)) .
  • FIG. 12 shows the results of detecting viral protein HA after 3D8 scFv was post-treated in cells infected with influenza virus (nucleus: DAPI (blue), 3D8 scFv: Alexa flour 488 (green), virus HA: TRITC (red)) ).
  • FIG. 13 shows a schematic diagram of the 3D8 scFv treatment and H1N1/H275Y infection protocol in mice for in vivo antiviral activity testing.
  • 17 shows the average body weight of influenza virus-infected mice.
  • FIG. 20 shows the results of qRT-PCR analysis of viral RNA (HA, NP) and IFN- ⁇ expression in influenza virus-infected mice.
  • 21 shows the viral titer of influenza virus-infected mice through plaque assay.
  • Figure 23 is a schematic diagram of a proposed model of the mechanism of action of an antibody fragment according to an embodiment.
  • Figure 23 (A) shows the replication pathway of the influenza virus
  • Figure 23 (B) shows the cell penetration mechanism of the antibody fragment according to an embodiment.
  • Figure 23 (C) shows the hydrolysis mechanism of influenza A virus RNA by the antibody fragment according to an embodiment in the cytoplasm.
  • HA hemagglutinin
  • the present invention relates to a heavy chain CDR1 represented by SEQ ID NO: 1 (VH CDR1), a VH CDR2 represented by SEQ ID NO: 2, and a VH CDR3 represented by SEQ ID NO: 3, a light chain CDR1 represented by SEQ ID NO: 4 (VL CDR1), SEQ ID NO: It provides an antiviral composition for influenza A virus comprising an antibody or fragment thereof comprising the VL CDR2 represented by 5 and the VL CDR3 represented by SEQ ID NO: 6.
  • complementarity determining region is a region involved in antigen recognition, and the specificity of the antibody to the antigen is determined as the sequence of this region changes.
  • VH CDRs refer to the heavy chain complementarity determining regions present in the heavy chain variable region
  • VL CDRs refer to the light chain complementarity determining regions present in the light chain variable regions.
  • variable region refers to a region that shows sequence variation while performing a function of specifically binding to an antigen, and CDR1, CDR2 and CDR3 exist in the variable region.
  • a framework region (FR) portion exists between the CDRs, which may serve to support the CDRs. Irrespective of the framework regions, CDRs may be important regions that allow an antibody or fragment thereof to exhibit a specific function.
  • the antibody or fragment thereof may include a heavy chain variable region comprising a heavy chain CDR1 (VH CDR1) represented by SEQ ID NO: 1, a VH CDR2 represented by SEQ ID NO: 2, and a VH CDR3 represented by SEQ ID NO: 3; and a light chain variable region comprising a light chain CDR1 (VL CDR1) represented by SEQ ID NO: 4, a VL CDR2 represented by SEQ ID NO: 5, and a VL CDR3 represented by SEQ ID NO: 6.
  • the antibody or fragment thereof may include a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7. According to one embodiment, the antibody or fragment thereof may include a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 7.
  • the antibody or fragment thereof may include a light chain variable region comprising the amino acid sequence of SEQ ID NO: 8. According to one embodiment, the antibody or fragment thereof may include a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 8.
  • Fragments of antibodies are single chain antibodies, Fv, scFv, di-scFv, Fab, Fab', F(ab') 2 , Fd, LC, dAb, CDR, scFv-Fc, and the group consisting of diabodies It may be at least one selected from.
  • the fragment of the antibody may comprise the amino acid sequence of SEQ ID NO: 9.
  • the antibody fragment may be composed of the amino acid sequence of SEQ ID NO: 9.
  • the antibody fragment may be an scFv consisting of the amino acid sequence of SEQ ID NO: 9.
  • the antibody or fragment thereof may be a humanized antibody or fragment thereof; Or it may be a chimeric antibody or a fragment thereof.
  • Humanized antibodies can be prepared by methods known in the art.
  • the antibody fragment may be a humanized scFv comprising the CDR sequences of the scFv of SEQ ID NO: 9.
  • the antibody or fragment thereof of the present invention can penetrate into the cytoplasm of a virus-infected host cell.
  • the penetrating effect of the antibody or fragment thereof into the cytoplasm can be considered to be due to Caveolae mediated endocytosis.
  • the antibody or fragment thereof of the present invention may specifically bind to a nucleic acid of influenza A virus. Specifically, the antibody or fragment thereof of the present invention may specifically bind to RNA of influenza A virus.
  • the antibody or fragment thereof of the present invention has nuclease activity and can degrade RNA and DNA of viruses.
  • the antibody or fragment thereof of the present invention can penetrate into the cytoplasm of a host infected with influenza A virus, and by removing naked viral RNA from the infected cells, it induces a decrease in the amount of viral gene replication and a decrease in the viral protein, and the efficacy of virus treatment can have
  • Influenza A virus as a surface antigen may be divided into hemagglutinin (HA) subtype and neuraminidase (NA) subtype or variants thereof.
  • HA hemagglutinin
  • NA neuraminidase
  • the mutant may be a mutant of an influenza A virus subtype, for example, a mutation in hemagglutinin and/or neuraminidase of the influenza A virus.
  • the mutant is a mutant of the influenza A virus subtype, and may be one in which Oseltamivir (Tamiflu) resistance is exhibited due to a mutation in neuraminidase of the influenza A virus.
  • the variant may be H1N1/H275Y.
  • H1N1/H275Y is a protein mutation resulting from H1N1/pdm09.
  • Tamiflu The mechanism of action of Tamiflu is to prevent the spread by inhibiting the spike protein of neuraminidase of H1N1.
  • H1N1/H275Y where the amino acid mutation of H275Y of neuraminidase of H1N1 occurs, has very weak binding force between neuraminidase and Tamiflu, so Tamiflu is resistant. This appears.
  • Hemagglutinin can play a role in recognizing the surface of the host cell and penetrating the inside of the cell. In addition, it can induce various inflammatory responses inside the cell and play a role in replicating itself.
  • Influenza A virus may be of various types of subtypes defined by hemagglutinin or variants thereof.
  • the subtypes defined by hemagglutinin are H1 subtype, H2 subtype, H3 subtype, H4 subtype, H5 subtype, H6 subtype, H7 subtype, H8 subtype, H9 subtype, H10 subtype , H11 subtype, H12 subtype, H13 subtype, H14 subtype, H15 subtype, and H16 subtype ( FIG. 24 ).
  • Influenza A virus H1, H2 and H3 subtypes cause disease mainly in humans.
  • Influenza A virus is a subtype comprising H1 hemagglutinin, a subtype comprising H2 hemagglutinin, a subtype comprising H3 hemagglutinin, a subtype comprising H4 hemagglutinin, and H5 hemagglutinin.
  • the influenza A virus may be at least one of the remaining 15 subtypes except for the H1 subtype among 16 subtypes defined by hemagglutinin (HA).
  • HA hemagglutinin
  • an antibody or fragment thereof of the present invention may comprise influenza A virus H1 subtype, influenza A virus H2 subtype, influenza A virus H5 subtype and influenza A virus H6 subtype, influenza A virus H3 subtype, influenza A virus It may exhibit antiviral efficacy against at least one selected from the group consisting of H4 subtype, influenza A virus H14 subtype, and variants thereof.
  • the antibody or fragment thereof of the present invention may exhibit antiviral efficacy against at least one selected from the group consisting of influenza A virus H1 subtype, influenza A virus H3 subtype, and variants thereof.
  • influenza A virus may be a variety of subtypes and variants thereof defined by neuraminidase (NA).
  • NA neuraminidase
  • Neuraminidase is an enzyme that acts as a 'scissor' so that the virus that has proliferated in the host cell can break through the cell membrane, and can play a key role in the spread of the virus.
  • influenza A virus is influenza A virus N1 subtype, N2 subtype, N3 subtype, N4 subtype, N5 subtype, N6 subtype, N7 subtype, N8 subtype, N9 subtype and variants thereof.
  • the influenza A virus may be a subtype comprising N1 neuraminidase, a subtype comprising N2 neuraminidase, and variants thereof.
  • the antibody or fragment thereof of the present invention may exhibit antiviral efficacy against at least one selected from the group consisting of influenza A virus N1 subtype, influenza A virus N2 subtype, and variants thereof.
  • the antibody or fragment thereof of the present invention exhibits antiviral efficacy against at least one selected from the group consisting of H1N1 subtype, H3N2 subtype, and variants thereof.
  • the antibody or fragment thereof of the present invention may exhibit antiviral efficacy against H1N1/PR8, H3N2/X-31, H1N1/H275Y virus strains.
  • the present invention provides a pharmaceutical composition for preventing or treating influenza A virus infection disease comprising the antiviral composition described above.
  • antiviral composition antibody or fragment thereof, and influenza A virus have been described above, so a detailed description thereof will be omitted.
  • the present invention provides a pharmaceutical composition capable of treating influenza A virus infection disease comprising the above-described antiviral composition.
  • prevention refers to any action that suppresses a disease caused by a virus or delays the onset of the disease.
  • treatment refers to any action in which the symptoms of a disease caused by a virus are improved or beneficially changed.
  • Influenza A virus may be a subtype defined by hemagglutinin (HA) or a variant thereof.
  • the subtypes defined by hemagglutinin (HA) are H1 subtype, H2 subtype, H3 subtype, H4 subtype, H5 subtype, H6 subtype, H7 subtype, H8 subtype, H9 subtype type, H10 subtype, H11 subtype, H12 subtype, H13 subtype, H14 subtype, H15 subtype, and H16 subtype ( FIG. 24 ).
  • the influenza A virus may be a variety of subtypes and variants thereof defined by neuraminidase (NA).
  • NA neuraminidase
  • influenza A virus is influenza A virus N1 subtype, N2 subtype, N3 subtype, N4 subtype, N5 subtype, N6 subtype, N7 subtype, N8 subtype, N9 subtype and variants thereof.
  • NA neuraminidase
  • influenza A virus may be at least one selected from the group consisting of H1N1 subtype, H3N2 subtype, and variants thereof.
  • Influenza A virus infectious diseases include fever, vomiting, diarrhea, malaise, cough, dyspnea, pneumonia, headache, muscle pain, sputum, sore throat, flu, cold, pain/pressure in the chest, and dizziness. It may include, but is not limited thereto, if it is a disease caused by a viral infection.
  • Influenza A virus infectious disease is not limited as long as it is a disease showing clinical symptoms of influenza A.
  • the pharmaceutical composition of the present invention may be used alone or in combination with methods using surgery, drug therapy, and biological response modifiers for the prevention and treatment of diseases.
  • the pharmaceutical composition may include an additional component effective against influenza A virus infection, and the additional component may be any component known to be effective against viral infection, including compounds, natural products, proteins, peptides, nucleic acids, and the like.
  • the pharmaceutical composition may further include suitable carriers, excipients and diluents conventionally used in the preparation of the composition.
  • Carriers, excipients and diluents include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate or mineral oil.
  • the pharmaceutical composition of the present invention may be formulated in the form of oral dosage forms such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, external preparations, suppositories, and sterile injection solutions according to conventional methods, such formulations can be performed by a method commonly performed in the pharmaceutical field. In the case of formulation, it may be prepared by additionally using diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, and surfactants.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, and the like, and such solid preparations include at least one excipient, for example, starch, calcium carbonate, sucrose or lactose ( lactose), gelatin, etc. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used.
  • Liquid formulations for oral administration include suspensions, internal solutions, emulsions, syrups, etc., and various excipients, such as wetting agents, sweeteners, fragrances, and preservatives, in addition to water and liquid paraffin, which are commonly used simple diluents, may be included.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories.
  • a non-aqueous agent and suspending agent propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate may be used.
  • a base of the suppository witepsol, macrogol, tween, cacao butter, laurin, glycerogelatin, and the like can be used.
  • the present invention provides a food composition for the prevention or improvement of influenza A virus infection disease comprising the above-described antiviral composition.
  • Antiviral compositions, antibodies or fragments thereof, influenza A virus and diseases have been described above, and thus detailed descriptions thereof will be omitted.
  • the present invention provides a food composition that can improve influenza A virus infection disease comprising the antiviral composition described above.
  • improvement refers to any action that reduces the symptoms of a disease caused by a virus.
  • the food composition may be used together with other foods or food ingredients, and may be appropriately used according to a conventional method.
  • the mixing amount of the active ingredient included in the food composition may be suitably determined according to the purpose of its use (for prevention or improvement).
  • the type of food composition is not particularly limited, and for example, meat, sausage, bread, chocolate, candy, snacks, confectionery, pizza, ramen, other noodles, gums, dairy products including ice cream, various soups, beverages, tea, drinks, It may be alcoholic beverages and vitamin complexes.
  • the food composition may further include additional ingredients, such as flavoring agents or natural carbohydrates, in addition to active ingredients, like conventional food.
  • Natural carbohydrates include monosaccharides such as glucose and fructose; disaccharides such as maltose and sucrose; and polysaccharides such as dextrin and cyclodextrin; It may be a sugar alcohol such as xylitol, sorbitol, or erythritol.
  • the sweetener include natural sweeteners such as taumatin and stevia extract; and synthetic sweeteners such as saccharin and aspartame.
  • the health food of the present invention includes various nutrients, vitamins, electrolytes, flavoring agents, colorants, pectic acid and its salts, alginic acid and its salts, organic acids, protective colloidal thickeners, pH adjusters, stabilizers, preservatives, glycerin, alcohol , a carbonation agent used in carbonated beverages, and the like.
  • it may contain the pulp for the production of natural fruit juice, fruit juice beverage and vegetable beverage.
  • the present invention provides a method for preventing or treating influenza A virus infection disease comprising administering the above-described antiviral composition to a subject.
  • the present invention provides a method for treating influenza A virus-infected disease comprising administering the above-described antiviral composition to a subject.
  • the subject may be a human and/or a non-human animal, and specifically, a mammal capable of exhibiting beneficial effects by treatment using the drug of the present invention.
  • Subjects may include all subjects who have or are at risk of having symptoms of influenza A virus-infected disease (eg, fever, malaise, cough, dyspnea, pneumonia, phlegm, sore throat, flu, cold, etc.) there is.
  • influenza A virus is the same as described above, and a detailed description thereof will be omitted.
  • An amount effective for preventing or treating an influenza A virus-infected disease means an amount capable of achieving a desired outcome in a subject in need thereof, or an amount capable of providing an objective or subjective benefit to a subject in need of treatment.
  • An amount effective to prevent or treat an influenza A virus infection disease may be a single or multiple doses.
  • An effective amount for preventing or treating influenza A virus infection disease may be the amount when the drug of the present invention is provided alone, but when provided in combination with one or more other compositions (eg, other respiratory disease treatment agents, etc.) It may be a quantity.
  • the present invention provides the use of a pharmaceutical composition comprising the above-described antiviral composition for the prevention or treatment of influenza A virus infection disease.
  • the present invention provides the use of a pharmaceutical composition comprising the above-mentioned antiviral composition for the treatment of influenza A virus-infected disease.
  • MDCK cells were preserved in Eagle's minimal essential medium (EMEM) containing 5% fetal bovine serum (Gibco, Cergy Pontois, France), 100 U/ml penicillin and 100 ⁇ g/ml streptomycin (Hyclone, Logan, UT, USA).
  • EMEM Eagle's minimal essential medium
  • HeLa and Vero cells were cultured in DMEM (Dulbecco's Modified Eagle's medium), and A549 cells were cultured in Roswell park Memorial Institute 1640 medium (RPMI 1640 medium; Hyclone) containing the same serum as the MDCK culture medium.
  • RPMI 1640 medium Roswell park Memorial Institute 1640 medium; Hyclone
  • Influenza strains A/Puerto Rico/8/34 (H1N1/PR8) and A/X-31 (H3N2/X-31) were provided by Professor Kweon (Sungkyunkwan University, Korea).
  • the Pandemic H1N1/H275Y NA mutant virus (A/Korea/2785/2009pdm: NCCP 42017; Oseltamivir-resistant) was obtained from the National Pathogen Resources Bank.
  • H1N1/H275Y is a variant resulting from H1N1/pdm09. Viruses were propagated in the allantoic sacs of 9-day-old eggs at 37°C for 3 days. Allantoic fluid was harvested and removed using density gradient centrifugation. Viral titers were determined using plaque assay.
  • the 3D8 scFv was eluted with 0.1 M acetic acid (pH 3.4). The eluted fractions were neutralized with 0.1 volume of 1 M Tris-HCl (pH 9.0). The concentration of purified 3D8 scFv was determined based on the extinction coefficient at 280 nm. Proteins were analyzed by electrophoresis on a 12% SDS polyacrylamide gel and detected by Coomassie blue staining.
  • A549, HeLa, Vero and MDCK cells (2x10 4 ) were cultured in 8-well chamber slides (Nunc Lab-Tek). Cells were treated with 3 ⁇ M 3D8 scFv and incubated at 37° C. with 5% CO 2 for 24 hours. Next, the slides were washed twice with PBS and fixed in methanol at 25° C. for 15 minutes. Samples were permeabilized for 5 minutes using Intracellular Staining Perm wash buffer (BioLegend, San Diego, CA, USA).
  • samples were incubated with monoclonal mouse anti-3D8 scFv antibody (1:1000 dilution; AbClon, Seoul, Korea) at 4°C for 24 hours.
  • samples were incubated with goat anti-mouse IgG Alexa Fluor 488 secondary antibody (1:1000 dilution; Abcam, Cambridge, MA, USA) for 1 h at 25 °C and slides were incubated with DAPI (Vectashield, Burlingame, CA, USA) was mounted on antifade Mounting Medium. Samples were then visualized using a Zeiss LSM 700 confocal microscope.
  • the reaction was terminated by adding 10X loading buffer (Takara, Otsu, Shinga, Japan), and the reaction was analyzed by electrophoresis on a 1% agarose gel and stained with ethidium bromide. As a result of the analysis, it was confirmed that viral RNA was degraded by 3D8 scFv treatment (FIG. 4).
  • MDCK cells (2 ⁇ 10 4 ) were cultured in 96-well plates. Cells were treated with 3D8 scFv (1-10 ⁇ M) and incubated at 37° C. with 5% CO 2 for 48 hours. Then, 10 ⁇ l of MTT solution was added and the cells were incubated at 37° C., 5% CO 2 for 4 hours. Formazan crystals formed were dissolved with DMSO and the absorbance of each well was read at 595 nm using an ELISA microplate reader (TECAN, Mannedorf, Switzerland).
  • Cytotoxicity was confirmed by treating MDCK cells with different concentrations of 3D8 scFv (0 to 10 ⁇ M). A minimal cytotoxicity of less than 5% was observed at all concentrations, indicating that the toxicity of the 3D8 scFv was kept to a minimum at the concentration at which the experiment was performed ( FIG. 5 ).
  • 3D8 scFv pretreatment 3D8 scFv (3, 5, 7 ⁇ M) was added to MDCK cells at 37° C., 5% CO 2 . After 24 hours of treatment, 3D8 scFv-treated cells were independently treated with three influenza virus strains (H1N1/PR8, H3N2/X-31 and H1N1/H275Y) in MEM-free medium at 37°C for 1
  • the infection medium was then removed and the cells were cultured in serum-free MEM-free medium (1% BSA) containing tosylphenylalanyl chloromethyl ketone (TPCK)-treated trypsin (1 ⁇ g/ml) at 37°C, 5% CO. Incubated for 48 hours at 2 (top of FIG. 6).
  • TPCK tosylphenylalanyl chloromethyl ketone
  • H1N1/H275Y-infected cells displayed a drug-resistant phenotype, whereas H1N1/PR8 and H3N2/X-31-infected cells did not. didn't
  • the survival rate of the 3D8 scFv untreated group (0 ⁇ M) was about 62.7%, whereas the survival rate of the group post-treated with 5 ⁇ M 3D8 scFv was 84.4% (H3N2/X-31 in FIG. 7 ). Post)).
  • the survival rate of the 3D8 scFv untreated group (0 ⁇ M) was about 58.4%, whereas the survival rate of all 3D8 scFv-treated groups was about 77.4% (H1N1/H275Y (Post) in FIG. 7 ).
  • Treatment of 3D8 scFv before or after viral infection in vitro increased the viability of virus-infected cells by 20%.
  • MEM-free medium 1% BSA
  • TPCK tosyl phenylalanyl chloromethyl ketone
  • the group pretreated with 3D8 scFv decreased viral HA and NP RNA expression by more than 40% compared to the group untreated with 3D8 scFv (H3N2/X-31 (Pre) in FIG. 9), In the group treated with 3D8 scFv, HA and NP RNA expression of the virus was reduced by 40% or more compared to the group not treated with 3D8 scFv (H3N2/X-31 (Post) in FIG. 9 ).
  • the group pretreated with 3D8 scFv showed a 35% or more decrease in viral HA and NP RNA expression compared to the group untreated with 3D8 scFv (H1N1/H275Y(Pre) in FIG. 10) and 3D8 scFv
  • the post-treatment group also showed a decrease in viral HA and NP RNA expression by 40% or more compared to the 3D8 scFv untreated group (H1N1/H275Y(Post) in FIG. 10).
  • MDCK cells (2 ⁇ 10 4 ) were cultured in 8-well chamber slides. 3D8 scFv treatment and virus infection (H1N1/PR8 and H1N1/H275Y) were performed in the same manner as described in (1) above (upper side of FIG. 8). The slides were washed twice with PBS and fixed for 15 minutes using methanol cooled at 25°C. The sample was permeabilized with Intracellular Staining Perm wash buffer for 5 minutes. After blocking with PBST containing 1% BSA for 1 h, cells were incubated with monoclonal mouse anti-3D8 scFv antibody or polyclonal rabbit anti-HA antibody (1:1000 dilution, Invitrogen) at 4 °C for 24 h. did.
  • the cells were then incubated with goat anti-mouse IgG Alexa Fluor 488 secondary antibody or goat anti-rabbit IgG TRITC secondary antibody (1:1000 dilution, Abcam) at 25° C. for 1 hour, respectively. Slides were mounted using anti-fade mounting medium containing DAPI and cells were visualized using a Zeiss LSM 700 confocal microscope.
  • the 3D8 scFv pre-treated group of H1N1/H275Y-infected cells had a lower detection signal of viral HA protein than the 3D8 scFv untreated group (H1N1/H275Y in FIG. 11 ).
  • the 3D8 scFv post-treatment group had a lower viral HA protein signal than the 3D8 scFv untreated group ( FIG. 12 ).
  • mice were housed under standard laboratory conditions. These mice were divided into 5 groups of 8-10 mice.
  • SPF pathogen-free
  • mice PBS treatment prior to virus infection in each group of mice; PBS treatment after viral infection; 3D8 scFv treatment prior to viral infection; 3D8 scFv treatment after viral infection; And Oseltamivir phosphate (Sigma-Aldrich, ST. Louis, MO, USA) was orally administered for 5 days after viral infection.
  • Mice in each group were intranasally infected with 50 ⁇ l lethal dose of 50% H1N1/H275Y virus (5 ⁇ 10 4 PFU). Mice were infected with H1N1/H275Y and monitored daily for clinical signs (weight change, cough, slouched back, coarse hair, flocking (fever), abnormal secretions, survival, etc.) until day 11 (Fig. 13).
  • mice did not show abnormal clinical signs, and histopathologically, abnormal changes in the lung parenchyma and its stroma did not appear ( FIG. 14 ).
  • 3D8 scFv was found to be localized to the epithelial lining of bronchioles and alveoli for 48 hours after administration ( FIG. 15 ).
  • the average body weight of the PBS pretreatment group was 21.1 g after infection 0 (0 dpi), and decreased by 27% to 15.5 g after 11 infection (11 dpi).
  • the average body weight of the 3D8 scFv pretreatment group was 22.2 g at 0 dpi, and decreased by about 18% from 7 dpi to 18.2 g.
  • the average body weight decreased by 21.8 g at 0 dpi and 30% at 7 dpi, and rebounded at 11 dpi.
  • the average body weight was 20.8 g at 0 dpi, but no mice survived at 8 dpi.
  • the average body weight of the 3D8 scFv post-treatment group was 23 g at 0 dpi and decreased by about 30% from 10 dpi to 16 g, but the average body weight recovered thereafter ( FIG. 17 ).
  • Each lung lobe was assigned a number reflecting the approximate percentage of total lung volume. The total score for all lobes formed an estimate of the percentage of total lungs with grossly visible pneumonia.
  • lung tissue was fixed in 10% neutral buffered formalin. After fixation, the tissue was dehydrated through a series of alcohol solutions and xylene, and embedded in paraffin wax. Sections (5 ⁇ m) were prepared from each tissue and hematoxylin and eosin (HE) staining was performed.
  • HE hematoxylin and eosin
  • the total lung lesion score was significantly lower in the 3D8 scFv pre-treatment group than in the 3D8 scFv post-treatment group (P ⁇ 0.05).
  • the oseltamivir-treated group had a significantly lower total lung lesion score than the PBS-treated group (P ⁇ 0.05) (bottom of FIG. 18).
  • the microscopic lesion was characterized by a thickened alveolar septum with increased numbers of interstitial macrophages and lymphocytes in the PBS and oseltamivir treated groups.
  • Lungs of 3D8 scFv pre-treatment and WT group were normal (top of FIG. 19 ).
  • the 3D8 scFv pre-treatment group had significantly lower microscopic lesion scores than the other groups (P ⁇ 0.01)
  • the 3D8 scFv post-treatment group had significantly lower microscopic lesion scores than the PBS and oseltamivir-treated groups (P ⁇ 0.05).
  • There was no significant difference in the microscopic lung lesion score between the PBS-treated group and the oseltamivir-treated group bottom of FIG. 19).
  • RNA and interferon levels were measured in the lungs of mice.
  • Total RNA was extracted from lysed mouse lung tissue (5 dpi) samples using TRI reagent according to the manufacturer's instructions. RNA concentration was determined using a spectrophotometer.
  • cDNA was synthesized using CellScript All-in-One 5x First Strand cDNA Synthesis Master Mix according to the manufacturer's protocol. The genes (HA, NP and IFN- ⁇ ) were amplified with the primers in Table 3 using qRT-PCR as previously described. GAPDH was amplified as an internal control.
  • virus titers were confirmed in the lungs of influenza A virus-infected mice.
  • Mouse lung tissue was homogenized in 1 ml of MEM-free medium using TissueRuptor (Qiagen, Chadstone, Victoria, Australia). A homogenate was obtained by centrifugation at 6,000 ⁇ g for 5 min at 4°C.
  • Confluent MDCK cells were cultured in 12-well plates. After infecting the tissue supernatant (1:1000 dilution) in MEM-free medium at 37° C. for 1 hour, the infection medium was removed. The medium was replaced with 1 ⁇ Dulbecco's modified eagle medium containing TPCK-treated trypsin (1 ⁇ g/ml) and 1% agarose.
  • the viral titer of the lungs was reduced by about 70% in the 3D8 scFv pretreatment group compared to the PBS pretreatment group ( FIG. 21 ).
  • the viral titer of the lungs was reduced by about 60% in the 3D8 scFv post-treatment group compared to the PBS post-treatment group ( FIG. 21 ).
  • tissue sections After deparaffinizing and rehydrating the tissue sections, antigen recovery was performed at 95° C. for 20 minutes using citrate buffer. Slides were washed with TBST (TBS, 0.025% Triton X-100) and blocked with 10% fetal bovine serum + 1% BSA solution (in TBST) for 2 hours. Tissue sections were incubated with polyclonal rabbit anti-HA antibody (1:750 dilution) overnight at 4°C. The tissue slides were then each incubated with goat anti-rabbit IgG TRITC secondary antibody (1:1000 dilution) at 25° C. for 1 hour.
  • Anti-fade mounting medium containing DAPI was put on tissue section slides, a cover glass was put on, and cells were visualized using an LSM 700 Zeiss confocal microscope.
  • the signal of viral HA was reduced in the alveolar epithelial cell inner layer (left in Fig. 22), and the number of distinct positive signals was significantly lower in the 3D8 scFv pre-treated group compared to the oseltamivir-treated group (P ⁇ 0.05) (Fig. 22). right).
  • 3D8 scFv not only exhibits a prophylactic effect of protecting the host from viral infection, but also exhibits a therapeutic effect by alleviating excessive inflammation and potential additional etiology after viral infection.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Communicable Diseases (AREA)
  • Pulmonology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Mycology (AREA)
  • Engineering & Computer Science (AREA)
  • Nutrition Science (AREA)
  • Polymers & Plastics (AREA)
  • Food Science & Technology (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Coloring Foods And Improving Nutritive Qualities (AREA)

Abstract

본 발명은 인플루엔자 A 바이러스에 대한 항바이러스용 조성물에 관한 것으로, 보다 상세하게는 서열번호 1로 표시되는 중쇄 CDR1(VH CDR1), 서열번호 2로 표시되는 VH CDR2, 및 서열번호 3으로 표시되는 VH CDR3, 서열번호 4로 표시되는 경쇄 CDR1(VL CDR1), 서열번호 5로 표시되는 VL CDR2 및 서열번호 6으로 표시되는 VL CDR3을 포함하는 항체 또는 이의 단편을 포함함으로써 인플루엔자 A 바이러스에 대한 우수한 항바이러스 효능을 나타내고, 인플루엔자 A 바이러스에 의해 유발되는 질환의 예방, 치료 또는 개선 효과를 나타낸다.

Description

인플루엔자 A 바이러스에 대한 항바이러스용 조성물
본 발명은 인플루엔자 A 바이러스에 대한 항바이러스용 조성물에 관한 것이다.
일반적으로 ‘독감(the flu’)으로 알려진 인플루엔자는 인플루엔자 바이러스에 의해 유발되는 전염성 발열성 호흡기 질환이다. A형 및 B형 인플루엔자 바이러스는 사람들에게 퍼지며 매년 계절성 독감 유행을 유발한다. 세계 보건 기구(WHO)에 따르면 인플루엔자 바이러스 전염에 의해 약 300만~500만 건의 중증 환자가 발생하고, 약 290,000~650,000명이 사망한다. WHO는 고위험군에 대해 매년 인플루엔자에 대한 예방 접종을 권장하며 백신은 일반적으로 3~4가지 유형의 인플루엔자에 효과적이다. 그러나 바이러스가 빠르게 진화하기 때문에 1년 동안 만든 백신은 다음 해에는 유용하지 않을 수 있다. 인플루엔자 A 및 B 바이러스의 게놈은 항원 드리프트(antigenic drift)와 항원 이동(antigenic shift)의 두 가지 방식으로 돌연변이가 일어날 수 있고, 이에 기존의 백신이나 항바이러스제는 바이러스에 대한 낮은 항바이러스 효능을 나타낸다. 따라서 인플루엔자 바이러스의 게놈에 돌연변이가 일어나더라도 우수한 항바이러스 효능을 나타내는 물질의 개발이 필요한 실정이다.
본 발명은 인플루엔자 A 바이러스에 대한 항바이러스용 조성물을 제공하는 것을 목적으로 한다.
본 발명은 인플루엔자 A 바이러스 감염 질환의 예방 또는 치료용 약학 조성물을 제공하는 것을 목적으로 한다.
본 발명은 인플루엔자 A 바이러스 감염 질환의 예방 또는 개선용 식품 조성물을 제공하는 것을 목적으로 한다.
1. 서열번호 1로 표시되는 중쇄 CDR1(VH CDR1), 서열번호 2로 표시되는 VH CDR2, 및 서열번호 3으로 표시되는 VH CDR3, 서열번호 4로 표시되는 경쇄 CDR1(VL CDR1), 서열번호 5로 표시되는 VL CDR2 및 서열번호 6으로 표시되는 VL CDR3을 포함하는 항체 또는 이의 단편을 포함하는 인플루엔자 A 바이러스에 대한 항바이러스용 조성물.
2. 위 1에 있어서, 상기 항체 또는 이의 단편은 서열번호 7의 아미노산 서열을 포함하는 중쇄가변영역을 포함하는 항바이러스용 조성물.
3. 위 1에 있어서, 상기 항체 또는 이의 단편은 서열번호 8의 아미노산 서열을 포함하는 경쇄가변영역을 포함하는 항바이러스용 조성물.
4. 위 1에 있어서, 상기 단편은 서열번호 9의 아미노산 서열을 포함하는 scFv인 항바이러스용 조성물.
5. 위 1에 있어서, 상기 인플루엔자 A 바이러스는 인플루엔자 A 바이러스 H1 서브타입, 인플루엔자 A 바이러스 H2 서브타입, 인플루엔자 A 바이러스 H5 서브타입 및 인플루엔자 A 바이러스 H6 서브타입, 인플루엔자 A 바이러스 H3 서브타입, 인플루엔자 A 바이러스 H4 서브타입, 인플루엔자 A 바이러스 H14 서브타입 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나인 항바이러스용 조성물.
6. 위 1에 있어서, 상기 인플루엔자 A 바이러스는 인플루엔자 A 바이러스 N1 서브타입, 인플루엔자 A 바이러스 N2 서브타입 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나인 항바이러스용 조성물.
7. 위 1에 있어서, 상기 인플루엔자 A 바이러스는 H1N1 서브타입, H3N2 서브타입 및 이들의 변이체 중 적어도 하나인 항바이러스용 조성물.
8. 위 1에 있어서, 상기 인플루엔자 A 바이러스는 오셀타미비르 저항성 인플루엔자 A 바이러스인 항바이러스용 조성물.
9. 위 1 내지 8 중 어느 한 항목의 조성물을 포함하는 인플루엔자 A 바이러스 감염 질환의 예방 또는 치료용 약학 조성물.
10. 위 9에 있어서, 인플루엔자 A 바이러스 감염 질환의 치료용 약학 조성물.
11. 위 1 내지 8 중 어느 한 항목의 조성물을 포함하는 인플루엔자 A 바이러스 감염 질환의 예방 또는 개선용 식품 조성물.
12. 위 11에 있어서, 인플루엔자 A 바이러스 감염 질환의 개선용 식품 조성물.
본 발명의 항바이러스용 조성물에 포함된 항체 또는 이의 단편은 바이러스에 감염된 세포 내에 침투할 수 있고, 인플루엔자 A 바이러스 RNA에 결합하고 이를 분해할 수 있다.
본 발명의 항바이러스용 조성물은 인플루엔자 A 바이러스에 특이적으로 결합하고 이를 가수분해함으로써 인플루엔자 A 바이러스에 대한 우수한 항바이러스 효과를 나타내고, 인플루엔자 A 바이러스 감염 질환의 예방, 치료 또는 개선 효과를 나타낼 수 있다.
본 발명의 항바이러스용 조성물은 다양한 서브타입의 인플루엔자 A 바이러스 또는 그 변이체에 대해 우수한 항바이러스 효능을 나타낼 수 있다.
본 발명의 항바이러스용 조성물은 오셀타미비르 저항성 인플루엔자 A 바이러스에 대해 우수한 항바이러스 효능을 나타낼 수 있다.
도 1은 일 실시예에 따른 항체 또는 이의 단편의 서열을 나타낸다.
도 2는 일 실시예에 따른 항체 단편의 제조를 위한 재조합 벡터의 일부 구조를 나타낸다.
도 3은 일 실시예에 따른 항체 단편의 세포 내 침투 활성을 나타낸다.
도 4는 일 실시예에 따른 항체 단편의 바이러스 RNA(NA 및 NP) 가수분해 활성을 나타낸다.
도 5는 MTT 분석을 통해 일 실시예에 따른 항체 단편의 세포 내 독성을 확인한 결과를 나타낸다.
도 6은 인플루엔자 A 바이러스 균주(H1N1/PR8, H3N2/X-31 및 H1N1/H275Y)에 대한 3D8 scFv 전처리의 항바이러스 효과(세포 생존율)를 테스트하기 위한 개략도 및 테스트 결과를 나타낸다 (*P < 0.05, **P < 0.01, ***P < 0.001).
도 7은 인플루엔자 A 바이러스 균주(H1N1/PR8, H3N2/X-31 및 H1N1/H275Y)에 대한 3D8 scFv 후처리의 항바이러스 효과(세포 생존율)를 테스트하기 위한 개략도 및 테스트 결과를 나타낸다 (*P < 0.05, **P < 0.01, ***P < 0.001).
도 8은 H1N1/PR8 균주에 대한 3D8 scFv 전/후처리의 항바이러스 효과(바이러스 RNA/단백질 발현 수준) 테스트 결과를 나타낸다.
도 9는 H3N2/X-31 균주에 대한 3D8 scFv 전/후처리의 항바이러스 효과(바이러스 RNA/단백질 발현 수준) 테스트 결과를 나타낸다.
도 10은 H1N1/H275Y 균주에 대한 3D8 scFv 전/후처리의 항바이러스 효과(바이러스 RNA/단백질 발현 수준) 테스트 결과를 나타낸다.
도 11은 3D8 scFv가 전처리된 후 인플루엔자 바이러스에 감염된 세포에서 바이러스 단백질 HA를 검출한 결과를 나타낸다(핵: DAPI(파란색), 3D8 scFv: Alexa flour 488(녹색), 바이러스 HA: TRITC(빨간색)).
도 12는 인플루엔자 바이러스에 감염된 세포에 3D8 scFv가 후처리된 후 바이러스 단백질 HA를 검출한 결과를 나타낸다(핵: DAPI(파란색), 3D8 scFv: Alexa flour 488(녹색), 바이러스 HA: TRITC(빨간색)).
도 13은 생체 내 항바이러스 활성 시험을 위한 마우스 내 3D8 scFv 처리 및 H1N1/H275Y 감염 프로토콜의 개략도를 나타낸다.
도 14는 일 실시예에 따른 항체 단편의 생체 내 약리학적 특성을 평가한 결과를 나타낸다.
도 15는 일 실시예에 따른 항체 단편의 생체 내 약리학적 특성을 평가한 결과를 나타낸다.
도 16은 인플루엔자 바이러스 감염 마우스의 생존율을 나타낸다.
도 17은 인플루엔자 바이러스 감염 마우스의 평균 체중을 나타낸다.
도 18은 인플루엔자 바이러스 감염 마우스 폐의 형태학적 비교 및 폐 병변 점수를 나타낸다.
도 19는 인플루엔자 바이러스 감염 마우스 폐 절편의 조직병리학적 비교 및 현미경적 폐 병변 점수를 나타낸다.
도 20은 인플루엔자 바이러스 감염 마우스의 바이러스 RNA(HA, NP) 및 IFN-β의 발현을 qRT-PCR로 분석한 결과를 나타낸다.
도 21은 plaque assay를 통한 인플루엔자 바이러스 감염 마우스의 바이러스 역가를 나타낸다.
도 22는 인플루엔자 바이러스 감염 마우스의 폐에서 바이러스 단백질 HA의 감소 정도를 확인한 결과를 나타낸다 (*P < 0.05, **P < 0.01, ***P < 0.001).
도 23은 일 실시예에 따른 항체 단편의 작용기전의 제안 모델을 도식화한 것이다. 도 23(A)는 인플루엔자 바이러스의 복제 경로를 나타내며, 도 23(B)는 일 실시예에 따른 항체 단편의 세포 침투 메커니즘을 나타낸다. 도 23(C)는 세포질에서 일 실시예에 따른 항체 단편에 의한 인플루엔자 A 바이러스 RNA의 가수분해 메커니즘을 나타낸다.
도 24는 헤마글루티닌(hemagglutinin, HA)에 의해 정의된 16종의 인플루엔자 A 바이러스 서브타입을 나타낸다.
이하, 본 발명을 상세하게 설명한다.
본 발명은 서열번호 1로 표시되는 중쇄 CDR1(VH CDR1), 서열번호 2로 표시되는 VH CDR2, 및 서열번호 3으로 표시되는 VH CDR3, 서열번호 4로 표시되는 경쇄 CDR1(VL CDR1), 서열번호 5로 표시되는 VL CDR2 및 서열번호 6으로 표시되는 VL CDR3을 포함하는 항체 또는 이의 단편을 포함하는 인플루엔자 A 바이러스에 대한 항바이러스용 조성물을 제공한다.
용어 “상보성 결정 영역(complementarity determining region, CDR)”은 항원의 인식에 관여하는 영역으로서 이 영역의 서열이 변함에 따라 항체의 항원에 대한 특이성이 결정된다. 본 명세서에서 VH CDR은 중쇄가변영역에 존재하는 중쇄 상보성 결정 영역을 의미하고, VL CDR은 경쇄가변영역에 존재하는 경쇄 상보성 결정 영역을 의미한다.
용어 “가변영역”은 항원과 특이적으로 결합하는 기능을 수행하면서 서열상의 변이를 보이는 영역을 의미하고, 가변영역에는 CDR1, CDR2 및 CDR3가 존재한다. 상기 CDR 사이에는 프레임 워크 영역(framework region, FR) 부분이 존재하며, 이는 CDR을 지지해주는 역할을 할 수 있다. 프레임 워크 영역에 무관하게 CDR이 항체 또는 이의 단편이 특정 기능을 나타나게 하는 중요한 영역일 수 있다.
항체 또는 이의 단편은 서열번호 1로 표시되는 중쇄 CDR1(VH CDR1), 서열번호 2로 표시되는 VH CDR2, 및 서열번호 3으로 표시되는 VH CDR3을 포함하는 중쇄가변영역; 및 서열번호 4로 표시되는 경쇄 CDR1(VL CDR1), 서열번호 5로 표시되는 VL CDR2 및 서열번호 6으로 표시되는 VL CDR3을 포함하는 경쇄 가변영역을 포함할 수 있다.
항체 또는 이의 단편은 서열번호 7의 아미노산 서열을 포함하는 중쇄가변영역을 포함할 수 있다. 일 실시예에 따르면 항체 또는 이의 단편은 서열번호 7의 아미노산 서열로 이루어진 중쇄가변영역을 포함할 수 있다.
항체 또는 이의 단편은 서열번호 8의 아미노산 서열을 포함하는 경쇄가변영역을 포함할 수 있다. 일 실시예에 따르면 항체 또는 이의 단편은 서열번호 8의 아미노산 서열로 이루어진 경쇄가변영역을 포함할 수 있다.
항체의 단편은 단일 사슬 항체, Fv, scFv, di-scFv, Fab, Fab', F(ab')2, Fd, LC, dAb, CDR, scFv-Fc, 및 디아바디(diabody)로 구성되는 군에서 선택되는 적어도 하나일 수 있다.
항체의 단편은 서열번호 9의 아미노산 서열을 포함할 수 있다. 일 실시예에 따르면 항체의 단편은 서열번호 9의 아미노산 서열로 이루어진 것일 수 있다. 일 실시예에 따르면 항체의 단편은 서열번호 9의 아미노산 서열로 이루어진 scFv일 수 있다.
항체 또는 이의 단편은 인간화된 항체 또는 그의 단편; 또는 키메릭 항체 또는 그 단편일 수 있다. 인간화된 항체는 당업계에 공지된 방법으로 제조될 수 있다.
실시예에 따르면 항체의 단편은 서열번호 9의 scFv의 CDR 서열들을 포함하는 인간화된 scFv일 수 있다.
본 발명의 항체 또는 이의 단편은 바이러스가 감염된 숙주세포의 세포질로 침투될 수 있다. 항체 또는 이의 단편의 세포질로 침투 효과는 Caveolae mediated endocytosis에 의한 것으로 볼 수 있다.
본 발명의 항체 또는 이의 단편은 인플루엔자 A 바이러스의 핵산에 특이적으로 결합할 수 있다. 구체적으로, 본 발명의 항체 또는 이의 단편은 인플루엔자 A 바이러스의 RNA에 특이적으로 결합할 수 있다. 본 발명의 항체 또는 이의 단편은 뉴클레아제 활성을 가져 바이러스의 RNA 및 DNA를 분해할 수 있다.
본 발명의 항체 또는 이의 단편은 인플루엔자 A 바이러스에 감염된 숙주의 세포질로 침투될 수 있고, 감염된 세포에서 naked viral RNA를 제거함으로써 바이러스의 유전자의 복제양의 저하 및 바이러스 단백질의 저하를 유도하고 바이러스 치료 효능을 가질 수 있다.
인플루엔자 A 바이러스는 표면항원으로 헤마글루티닌(hemagglutinin, HA) 서브타입과 뉴라미니데이즈(neuraminidase, NA) 서브타입 또는 이들의 변이체로 구분될 수 있다.
상기 변이체는 인플루엔자 A 바이러스 서브타입의 돌연변이체일 수 있고, 예컨대 인플루엔자 A 바이러스의 헤마글루티닌 및/또는 뉴라미니데이즈에 돌연변이가 발생한 것일 수 있다.
구체적으로, 상기 변이체는 인플루엔자 A 바이러스 서브타입의 돌연변이체로, 인플루엔자 A 바이러스의 뉴라미니데이즈에 돌연변이가 발생하여 Oseltamivir(타미플루) 저항성이 나타난 것일 수 있다. 예컨대 상기 변이체는 H1N1/H275Y일 수 있다. H1N1/H275Y는 H1N1/pdm09으로부터 발생한 단백질 변이이다.
타미플루의 작용기전은 H1N1의 뉴라미니데이즈의 스파이크 단백질을 억제하여 확산을 방지하는 것인데, H1N1의 뉴라미니데이즈의 H275Y 아미노산 변이가 발생한 H1N1/H275Y은 뉴라미니데이즈와 타미플루간의 결합력이 매우 약해 타미플루의 저항성이 나타난다.헤마글루티닌은 숙주 세포의 표면을 인식하고 세포 내부로 침투하는 역할을 할 수 있다. 또한, 세포 내부에서 여러가지 염증 반응을 유발하고 자신을 복제하는 역할을 할 수 있다.
인플루엔자 A 바이러스는 헤마글루티닌에 의해 정의된 다양한 종류의 서브타입 또는 이들의 변이체일 수 있다.
헤마글루티닌에 의해 정의된 서브타입은 H1 서브타입, H2 서브타입, H3 서브타입, H4 서브타입, H5 서브타입, H6 서브타입, H7 서브타입, H8 서브타입, H9 서브타입, H10 서브타입, H11 서브타입, H12 서브타입, H13 서브타입, H14 서브타입, H15 서브타입, 및 H16 서브타입일 수 있다(도 24). 인플루엔자 A 바이러스 H1, H2 및 H3 서브타입이 주로 인간에게 질병을 일으킨다.
인플루엔자 A 바이러스는 H1 헤마글루티닌을 포함하는 서브타입, H2 헤마글루티닌을 포함하는 서브타입, H3 헤마글루티닌을 포함하는 서브타입, H4 헤마글루티닌을 포함하는 서브타입, H5 헤마글루티닌을 포함하는 서브타입, H6 헤마글루티닌을 포함하는 서브타입, H6 헤마글루티닌을 포함하는 서브타입, H7 헤마글루티닌을 포함하는 서브타입, H8 헤마글루티닌을 포함하는 서브타입, H9 헤마글루티닌을 포함하는 서브타입, H10 헤마글루티닌을 포함하는 서브타입, H11 헤마글루티닌을 포함하는 서브타입, H12 헤마글루티닌을 포함하는 서브타입, H13 헤마글루티닌을 포함하는 서브타입, H14 헤마글루티닌을 포함하는 서브타입, H15 헤마글루티닌을 포함하는 서브타입, H16 헤마글루티닌을 포함하는 서브타입 및/또는 이들의 변이체일 수 있다.
인플루엔자 A 바이러스는 헤마글루티닌(hemagglutinin, HA)에 의해 정의된 16종의 서브타입 중 H1 서브타입을 제외한 나머지 15 종의 서브타입 중 적어도 하나일 수 있다.
예를 들어, 본 발명의 항체 또는 이의 단편은 인플루엔자 A 바이러스 H1 서브타입, 인플루엔자 A 바이러스 H2 서브타입, 인플루엔자 A 바이러스 H5 서브타입 및 인플루엔자 A 바이러스 H6 서브타입, 인플루엔자 A 바이러스 H3 서브타입, 인플루엔자 A 바이러스 H4 서브타입, 인플루엔자 A 바이러스 H14 서브타입 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나에 대한 항바이러스 효능을 나타낼 수 있다. 일 실시예에 따르면, 본 발명의 항체 또는 이의 단편은 인플루엔자 A 바이러스 H1 서브타입, 인플루엔자 A 바이러스 H3 서브타입, 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나에 대한 항바이러스 효능을 나타낼 수 있다.
또한, 인플루엔자 A 바이러스는 뉴라미니데이즈(neuraminidase, NA)에 의해 정의된 다양한 종류의 서브타입 및 이들의 변이체일 수 있다.
뉴라미니데이즈는 숙주 세포 내에서 증식한 바이러스가 세포막을 뚫고 나갈 수 있도록 '가위' 역할을 하는 효소로, 바이러스 확산의 핵심 역할을 할 수 있다.
예를 들어 인플루엔자 A 바이러스는 인플루엔자 A 바이러스 N1 서브타입, N2 서브타입, N3 서브타입, N4 서브타입, N5 서브타입, N6 서브타입, N7 서브타입, N8 서브타입, N9 서브타입 및 이들의 변이체일 수 있다.
인플루엔자 A 바이러스는 N1 뉴라미니데이즈를 포함하는 서브타입, N2 뉴라미니데이즈를 포함하는 서브타입, 및 이들의 변이체일 수 있다.
일 실시예에 따르면, 본 발명의 항체 또는 이의 단편은 인플루엔자 A 바이러스 N1 서브타입, 인플루엔자 A 바이러스 N2 서브타입, 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나에 대한 항바이러스 효능을 나타낼 수 있다.
일 실시예에 따르면 본 발명의 항체 또는 이의 단편은 H1N1 서브타입, H3N2 서브타입 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나에 대한 항바이러스 효능을 나타낸다. 예를 들어, 본 발명의 항체 또는 이의 단편은 H1N1/PR8, H3N2/X-31, H1N1/H275Y 바이러스 균주에 대한 항바이러스 효능을 나타낼 수 있다.
또한, 본 발명은 전술한 항바이러스용 조성물을 포함하는 인플루엔자 A 바이러스 감염 질환의 예방 또는 치료용 약학 조성물을 제공한다.
항바이러스용 조성물, 항체 또는 이의 단편, 인플루엔자 A 바이러스에 대해서는 전술한 바 있어 구체적인 설명은 생략한다.
특히 본 발명은 전술한 항바이러스용 조성물을 포함하는 인플루엔자 A 바이러스 감염 질환을 치료할 수 있는 약학 조성물을 제공한다.
용어 “예방”은 바이러스에 의해 유발된 질환을 억제시키거나 질환의 발병을 지연시키는 모든 행위를 의미한다.
용어 “치료”는 바이러스에 의해 유발된 질환의 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미한다.
인플루엔자 A 바이러스는 헤마글루티닌(hemagglutinin, HA)에 의해 정의된 서브타입 또는 이들의 변이체일 수 있다. 헤마글루티닌(hemagglutinin, HA)에 의해 정의된 서브타입은 H1 서브타입, H2 서브타입, H3 서브타입, H4 서브타입, H5 서브타입, H6 서브타입, H7 서브타입, H8 서브타입, H9 서브타입, H10 서브타입, H11 서브타입, H12 서브타입, H13 서브타입, H14 서브타입, H15 서브타입, 및 H16 서브타입일 수 있다(도 24). 또한, 인플루엔자 A 바이러스는 뉴라미니데이즈(neuraminidase, NA)에 의해 정의된 다양한 종류의 서브타입 및 이들의 변이체일 수 있다. 예를 들어 인플루엔자 A 바이러스는 인플루엔자 A 바이러스 N1 서브타입, N2 서브타입, N3 서브타입, N4 서브타입, N5 서브타입, N6 서브타입, N7 서브타입, N8 서브타입, N9 서브타입 및 이들의 변이체일 수 있다.
일 실시예에 따르면 인플루엔자 A 바이러스는 H1N1 서브타입, H3N2 서브타입 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나일 수 있다.
인플루엔자 A 바이러스의 감염 질환은 발열, 구토, 설사, 권태감, 기침, 호흡곤란, 폐렴, 두통, 근육통, 가래, 인후염, 독감, 감기, 흉통 (pain/pressure in the chest), 어지럼증 (sudden dizziness)을 포함하는 것일 수 있으나, 바이러스 감염으로 인해 발생하는 질환이라면 이에 제한되지 않는다.
인플루엔자 A 바이러스의 감염 질환은 인플루엔자 A 임상증상을 나타내는 질환이면 제한되지 않는다.
본 발명의 약학 조성물은 질환의 예방 및 치료를 위하여 단독으로, 또는 수술, 약물 치료 및 생물학적 반응 조절제를 사용하는 방법들과 병용하여 사용할 수 있다.
약학 조성물은 인플루엔자 A 바이러스 감염에 효과가 있는 추가 성분을 포함할 수 있고, 추가성분은 화합물, 천연물, 단백질, 펩타이드, 핵산 등을 포함하는 바이러스 감염에 효과가 공지된 모든 성분일 수 있다.
약학 조성물은 조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제 및 희석제를 더 포함할 수 있다. 담체, 부형제 및 희석제는 락토즈, 덱스트로즈, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘실리케이트, 셀룰로오스, 메틸 셀룰로오스, 미정질 셀룰로오스, 폴리비닐피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등일 수 있다.
본 발명의 약학 조성물은 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제제화될 수 있으며, 이러한 제제화는 약제학 분야에서 통상적으로 행하여지는 방법으로 수행될 수 있다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 추가로 사용하여 조제될 수 있다.
경구 투여를 위한 고형 제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형 제제는 적어도 하나 이상의 부형제, 예를 들면 전분, 칼슘카보네이트(calcium carbonate), 수크로오스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제된다. 또한, 단순한 부형제 이외에 마그네슘 스테아레이트, 탈크 같은 윤활제들도 사용된다. 경구 투여를 위한 액상 제제로는 현탁액, 내용액제, 유제, 시럽제 등이 해당되는데, 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포 함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조 제제, 좌제가 포함된다. 비수용제, 현탁제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween), 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다.
또한, 본 발명은 전술한 항바이러스용 조성물을 포함하는 인플루엔자 A 바이러스 감염 질환의 예방 또는 개선용 식품 조성물을 제공한다.
항바이러스용 조성물, 항체 또는 이의 단편, 인플루엔자 A 바이러스 및 질환에 대해서는 전술한 바 있어 구체적인 설명은 생략한다.
특히 본 발명은 전술한 항바이러스용 조성물을 포함하는 인플루엔자 A 바이러스 감염 질환을 개선할 수 있는 식품 조성물을 제공한다.
용어 “개선”은 바이러스에 의해 유발된 질환의 증세를 감소시키는 모든 행위를 의미한다.
식품 조성물은 다른 식품 또는 식품 성분과 함께 사용될 수 있고, 통상적인 방법에 따라 적절하게 사용될 수 있다.
식품 조성물에 포함되는 유효성분의 혼합량은 그의 사용 목적(예방 또는 개선용)에 따라 적합하게 결정될 수 있다.
식품 조성물의 종류는 특별히 제한되지 않으며, 예컨대 육류, 소시지, 빵, 초콜릿, 캔디류, 스넥류, 과자류, 피자, 라면, 기타 면류, 껌류, 아이스크림류를 포함한 낙농제품, 각종 스프, 음료수, 차, 드링크제, 알코올음료 및 비타민 복합제 등일 수 있다.
식품 조성물은 통상의 식품처럼 유효성분 외에 향미제 또는 천연 탄수화물 등 추가 성분을 더 포함할 수 있다. 천연 탄수화물은 포도당, 과당과 같은 모노사카라이드; 말토스, 수크로스와 같은 디사카라이드; 및 덱스트린, 사이클로덱스트린과 같은 폴리사카라이드; 자일리톨, 소르비톨, 에리트리톨 등의 당알콜일 수 있다. 감미제로서는 타우마틴, 스테비아 추출물등의 천연 감미제; 및 사카린, 아스파르탐과 같은 합성 감미제 등을 사용할 수 있다.
상기 외에 본 발명의 건강식품은 여러 가지 영양제, 비타민, 전해질, 풍미제, 착색제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알코올, 탄산음료에 사용되는 탄산화제 등을 함유할 수 있다. 그 밖에 천연 과일주스, 과일주스 음료 및 야채 음료의 제조를 위한 과육을 함유할 수 있다.
또한, 본 발명은 전술한 항바이러스용 조성물을 대상체에 투여하는 단계를 포함하는 인플루엔자 A 바이러스 감염 질환의 예방 또는 치료방법을 제공한다. 특히 본 발명은 전술한 항바이러스용 조성물을 대상체에 투여하는 단계를 포함하는 인플루엔자 A 바이러스 감염 질환의 치료방법을 제공한다.
대상체는 인간 및/또는 인간을 제외한 동물일 수 있고, 구체적으로 발명의 약물 등을 이용한 치료로 유익한 효과를 나타낼 수 있는 포유 동물이다.
대상체는 인플루엔자 A 바이러스 감염 질환의 증상(예를 들어, 발열, 권태감, 기침, 호흡곤란, 폐렴, 가래, 인후염, 독감, 감기 등)을 갖거나 이와 같은 증상을 가질 위험이 있는 대상체들이 모두 포함될 수 있다. 인플루엔자 A 바이러스에 대해서는 전술한 내용과 동일하며 구체적인 설명은 생략한다.
인플루엔자 A 바이러스 감염 질환을 예방 또는 치료하는데 유효한 양은 치료가 필요한 대상체에서 원하는 성과를 달성할 수 있는 양, 또는 치료가 필요한 대상체에 객관적이거나 또는 주관적인 이점을 제공할 수 있는 양을 의미한다.
인플루엔자 A 바이러스 감염 질환을 예방 또는 치료하는데 유효한 양은 단일 또는 다중 용량일 수 있다. 인플루엔자 A 바이러스 감염 질환을 예방 또는 치료하는데 유효한 양은 본 발명의 약물을 단독으로 제공하는 경우의 양일 수 있으나, 하나 이상의 다른 조성물들(예를 들어, 다른 호흡기 질환 치료제 등)과 조합되어 제공되는 경우의 양일 수도 있다.
본 명세서에 기재된 수치값은 달리 명시되어 있지 않은 한 균등범위까지 포함하는 것으로 해석되어야 한다.
또한, 본 발명은 인플루엔자 A 바이러스 감염 질환의 예방 또는 치료를 위한 전술한 항바이러스용 조성물을 포함하는 약학 조성물의 용도를 제공한다.
특히 본 발명은 인플루엔자 A 바이러스 감염 질환의 치료를 위한 전술한 항바이러스용 조성물을 포함하는 약학 조성물의 용도를 제공한다.
이하, 본 발명을 구체적으로 설명하기 위해 실시예를 들어 상세하게 설명하기로 한다.
1. 실험 재료: 세포주 및 바이러스
MDCK 세포는 5% 소 태아 혈청(Gibco, Cergy Pontois, France), 100U/ml 페니실린 및 100㎍/ml 스트렙토마이신(Hyclone, Logan, UT, USA)을 포함하는 Eagle’s minimal essential medium(EMEM)에서 보존하였다. HeLa와 Vero 세포는 DMEM(Dulbecco's Modified Eagle's medium)에서 배양하였고, A549 세포는 MDCK 배양 배지와 동일한 혈청을 함유한 Roswell park Memorial Institute 1640 배지(RPMI 1640 배지; Hyclone)에서 배양하였다. 세포주는 한국세포주은행에서 구입하였고 37℃, 5% CO2로 유지하였다. 인플루엔자 균주 A/Puerto Rico/8/34(H1N1/PR8) 및 A/X-31(H3N2/X-31)은 Kweon 교수(성균관대학교, 한국)에 의해 제공되었다. 또한, Pandemic H1N1/H275Y NA 돌연변이 바이러스(A/Korea/2785/2009pdm: NCCP 42017; Oseltamivir-resistant)를 국가병원체자원은행에서 입수하였다. H1N1/H275Y는 H1N1/pdm09으로부터 발생한 변이체이다. 37℃에서 3일 동안 9일 된 부화란의 요막낭에서 바이러스를 증식시켰다. 요막액을 수확하고 밀도 구배 원심분리를 사용하여 제거하였다. 바이러스 역가는 플라크 분석을 사용하여 결정되었다.
2. 항체의 단편의 발현 및 정제
E.coli BL21 cell을 host로 이용하여 하기 표 1의 서열번호 9의 아미노산 서열을 갖는 scFv를 생산하였다(도 1 참조). 하기 표 1에 scFv 관련 서열(scFv 서열; 이의 VH, VL, CDR 서열; 및 이의 유전자 서열)을 기재하였다. 구체적으로, 37℃의 100 μg/ml 암피실린과 20 μg/ml 클로람페니콜이 포함된 Luria-Bertani(LB) broth에서 pIg20-3D8 플라스미드 형질전환된 대장균(BL21[DE3]pLysE) 균주를 사용하여 항체 단편(3D8 scFv)를 발현시켰고(도 2 참조), 1mM 이소프로필 1-티올-β-D-갈락토피라노사이드(IPTG)를 첨가하여 26℃에서 18시간 동안 유도하였다. 세포 배양 상층액을 4℃에서 5,200 x g에서 20분간 원심분리하여 얻은 후 0.22 μm 필터를 통과시켰다. IgG Sepharose 6 fast flow(GE Healthcare, Malborough, MA, USA) 친화성 컬럼을 사용하여 상등액으로부터 3D8 scFv를 정제하였다. 컬럼을 10 bed 부피의 PBS(pH 7.4)로 세척한 다음 10 bed 부피의 5mM 암모늄 아세테이트(pH 5.0)로 세척하였다. 다음으로, 0.1 M 아세트산(pH 3.4)으로 3D8 scFv를 용출시켰다. 용출된 분획을 0.1 부피의 1 M Tris-HCl(pH 9.0)로 중화시켰다. 정제된 3D8 scFv의 농도는 280 nm에서의 흡광 계수를 기반으로 결정하였다. 단백질은 12% SDS 폴리아크릴아미드 겔에서 전기영동으로 분석하였고 쿠마시 블루 염색으로 검출하였다.
구분 아미노산 서열 서열번호
VH CDR1 GYTFTSYVMH 서열번호 1
VH CDR2 INPYNDG 서열번호 2
VH CDR3 GAYKRGYAMDY 서열번호 3
VL CDR1 KSSQSLFNSRTRKNYLA 서열번호 4
VL CDR2 WASTRES 서열번호 5
VL CDR3 KQSYYHMYT 서열번호 6
VH EVQLQQSGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCARGAYKRGYAMDYWGQGTSVTVSSR 서열번호 7
VL DLVMSQSPSSLAVSAGEKVTMSCKSSQSLFNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYYHMYTFGSGTKLEIK 서열번호 8
3D8 scFv EVQLQQSGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCARGAYKRGYAMDYWGQGTSVTVSSRGGGGSGGGGSGGGGSDLVMSQSPSSLAVSAGEKVTMSCKSSQSLFNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYYHMYTFGSGTKLEIK 서열번호 9
3D8 scFv 유전자 서열 GAGGTCCAGCTGCAGCAGTCTGGACCTGAGCTGGTAAAGCCTGGGGCTTCAGTGAAGATGTCCTGCAAGGCTTCTGGATACACATTCACTAGCTATGTTATGCACTGGGTGAAGCAGAAGCCTGGGCAGGGCCTTGAGTGGATTGGATATATTAATCCTTACAATGATGGTACTAAGTACAATGAGAAGTTCAAAGGCAAGGCCACACTGACTTCAGACAAATCCTCCAGCACAGCCTACATGGAGCTCAGCAGCCTGACCTCTGAGGACTCTGCGGTCTATTACTGTGCAAGAGGGGCCTATAAAAGGGGATATGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCTAGAGGTGGGGGCGGTTCGGGTGGCGGGGGCTCGGGCGGGGGTGGCTCAGATCTTGTGATGTCACAGTCTCCATCCTCCCTGGCTGTGTCAGCAGGAGAGAAGGTCACTATGAGCTGCAAATCCAGTCAGAGTCTGTTCAACAGTAGAACCCGAAAGAACTACTTGGCTTGGTACCAGCAGAAACCAGGGCAGTCTCCTAAACTGCTGATCTACTGGGCATCCACTAGGGAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGTGTGCAGGCTGAAGACCTGGCAGTTTATTACTGCAAGCAATCTTATTATCACATGTATACGTTCGGATCGGGGACCAAGCTGGAAATAAAA 서열번호 10
3. 항체 단편의 세포 침투 활성 분석
먼저 3D8 scFv의 항바이러스 효과의 중요한 전제 조건인 세포 침투 활성을 확인하였다. A549, HeLa, Vero 및 MDCK 세포(2x104)를 8웰 챔버 슬라이드(Nunc Lab-Tek)에서 배양하였다. 세포에 3μM 3D8 scFv를 처리하고 37℃에서 5% CO2로 24시간 동안 인큐베이션하였다. 다음으로, 슬라이드를 PBS로 2회 세척하고 25℃의 냉각된 메탄올에 15분간 고정하였다. Intracellular Staining Perm wash buffer (BioLegend, San Diego, CA, USA)를 사용하여 샘플을 5분 동안 투과화시켰다. 1% BSA(in PBST)로 1시간 동안 블로킹한 후, 샘플을 단일클론 마우스 항-3D8 scFv 항체(1:1000 희석; AbClon, Seoul, Korea)와 함께 4℃에서 24시간 동안 인큐베이션하였다. 다음으로, 샘플을 염소 항-마우스 IgG Alexa Fluor 488 2차 항체(1:1000 희석; Abcam, Cambridge, MA, USA)와 함께 25℃에서 1시간 동안 인큐베이션하고 슬라이드를 DAPI(Vectashield, Burlingame, CA, USA)가 포함된 antifade Mounting Medium에 장착하였다. 그 후 Zeiss LSM 700 공초점 현미경을 사용하여 샘플을 시각화하였다. 핵은 DAPI 염색(파란색)으로 검출되었고, 3D8 scFv는 Alexa flour 488 fluorescent 염료(녹색)로 컨쥬게이션된 항체로 시각화되었다. 3D8 scFv는 처리 후 24시간 이내에 모든 세포주의 세포질에서 검출되었다(도 3).
4. 항체 단편의 바이러스 RNA 분해 활성
H1N1/PR8에서 total RNA를 분리하고 바이러스 cDNA를 합성하였다. NA 및 NP에 상응하는 서열을 PCR을 사용하여 증폭시키고(표 2), T7 및 SP6 프로모터를 보유하는 벡터인 pGEM-T Easy(Promega, Madison, WI, USA)에 클로닝하였다. NA(Neuramindase) 및 NP(Nucleoprotein) RNA는 HiScribe T7 시험관 내 전사 키트(New England BioLabs, Ipswich, MA, USA)를 사용하여 합성하고, 37℃에서 0.1mM MgCl2를 포함하는 TBS에서 3D8 scFv 정제 단백질(0.5μg)과 함께 1시간 동안 인큐베이션하였다. 10X loading buffer(Takara, Otsu, Shinga, Japan)를 첨가하여 반응을 종료하고 1% 아가로스 겔에서 전기영동으로 분석하고 ethidium bromide로 염색하였다. 분석 결과 3D8 scFv 처리로 인해 바이러스 RNA가 분해된 것을 확인하였다(도 4).
유전자 Forward (5'->3') Reverse (5'->3') Accession No.
Hemagglutinin (HA) GCTACCATGCGAACAATTCAAC (서열번호 11) CTGCACTGCAAAGATCCATTAG (서열번호 12) NC_002017.1
Neuramindase (NA) CCATTGGATCAATCTGTCTGG (서열번호 13) TGTCAATGGTGAATGGCAACTC (서열번호 14) NC_002018.1
Nucleoprotein (NP) ACTGATGGAGAACGCCAGAAT (서열번호 15) ATGTCAAAGGAAGGCACGATC (서열번호 16) NC_002019.1
5. 항체 단편의 세포독성 분석
MDCK 세포(2×104)를 96웰 플레이트에서 배양하였다. 세포를 3D8 scFv(1-10 μM)로 처리하고 48시간 동안 5% CO2와 함께 37℃에서 배양하였다. 그 후 10 μl의 MTT 용액을 첨가하고 세포를 37℃, 5% CO2에서 4시간 동안 인큐베이션하였다. 형성된 포르마잔 결정을 DMSO로 용해시키고 ELISA 마이크로플레이트 판독기(TECAN, Mannedorf, Switzerland)를 사용하여 595 nm에서 각 웰의 흡광도를 판독하였다.
MDCK 세포에 상이한 농도의 3D8 scFv(0 내지 10 μM)를 처리하여 세포독성을 확인하였다. 모든 농도에서 5% 미만의 최소 세포독성이 관찰되었으며, 이는 실험이 수행된 농도에서 3D8 scFv의 독성이 최소로 유지되었음을 나타낸다(도 5).
6. 항체 단편의 인플루엔자 A 바이러스 감염 세포의 생존율 증가 효능
MDCK 세포(2 x 104)를 96웰 플레이트에서 배양하고 다음과 같이 처리하였다: (i) 3D8 scFv 전처리: 37℃, 5% CO2에서 MDCK 세포에 3D8 scFv(3, 5, 7 μM)를 24시간 처리한 후, 3D8 scFv가 처리된 세포를 37℃에서 1시간 동안 MEM-프리 배지에서 독립적으로 3 가지 인플루엔자 바이러스 균주(H1N1/PR8, H3N2/X-31 및 H1N1/H275Y)(MOI = 0.1)로 감염시켰다. 그 후 감염 배지를 제거하고 세포를 토실 페닐알라닐 클로로메틸 케톤(TPCK) 처리된 트립신(1 μg/ml)을 함유하는 혈청 미첨가 MEM-프리 배지(1% BSA)에서 37℃, 5% CO2에서 48시간 동안 배양하였다(도 6의 위쪽). (ii) 3D8 scFv 후처리: MDCK 세포를 37℃에서 1시간 동안 MEM-프리 배지에서 독립적으로 3 가지 인플루엔자 바이러스 균주(H1N1/PR8, H3N2/X-31 및 H1N1/H275Y)(MOI = 0.1)로 감염시킨 후 감염 배지를 제거하였다. 배지를 3D8 scFv(3, 5, 7 μM)와 TPCK 처리된 트립신(1 μg/ml)이 포함된 MEM-free 배지(1% BSA)로 교체한 후 37℃, 5% CO2에서 47시간 동안 배양하였다(도 7의 위쪽). 그 후 10 μl의 MTT 용액을 각 웰에 첨가하고 세포를 37℃, 5% CO2에서 4시간 동안 인큐베이션하였다. 형성된 포르마잔 결정을 DMSO로 용해시키고 ELISA 마이크로플레이트 판독기를 사용하여 595 nm에서의 흡광도를 측정하였다. 참고로 3가지 유형의 바이러스(MOI = 0.1) 각각에 감염된 세포에 다른 농도의 oseltamivir를 처리했을 때 H1N1/H275Y 감염 세포는 약물 내성 표현형을 나타내었지만 H1N1/PR8 및 H3N2/X-31 감염 세포는 그렇지 않았다.
(i) 3D8 scFv가 전처리된 경우, H1N1/PR8 감염 세포에서 3D8 scFv 미처리군(0μM)의 생존율은 66.8%인 반면, 5μM 3D8 scFv로 전처리한 군의 생존율은 약 88.3%였다(도 6의 H1N1/PR8(Pre)). 또한, H3N2/X-31 감염 세포에서 3D8 scFv 미처리군(0μM)의 생존율은 약 54.5%인 반면, 3μM의 3D8 scFv로 전처리한 군의 생존율은 약 74.4%였다(도 6의 H3N2/X-31(Pre)). H1N1/H275Y 감염 세포에서 3D8 scFv 미처리군(0μM)의 생존율은 약 55.6%인 반면, 모든 3D8 scFv 처리군의 생존율은 약 85%였다(도 6의 H1N1/H275Y (Pre)). (ii) 3D8 scFv가 후처리된 경우, H1N1/PR8 감염 세포에서 3D8 scFv 미처리군(0μM)의 생존율은 63.2%인 반면, 5μM 3D8 scFv로 후처리한 군의 생존율은 86.9% 였다(도 7의 H1N1/PR8(Post)). 또한, H3N2/X-31 감염 세포에서 3D8 scFv 미처리군(0μM)의 생존율은 약 62.7%인 반면, 5μM 3D8 scFv로 후처리한 군의 생존율은 84.4% 였다(도 7의 H3N2/X-31(Post)). H1N1/H275Y 감염 세포에서 3D8 scFv 미처리군(0μM)의 생존율은 약 58.4%인 반면, 모든 3D8 scFv 처리군의 생존율은 약 77.4%였다(도 7의 H1N1/H275Y (Post)).
시험관 내 바이러스 감염 전 또는 후 3D8 scFv의 처리는 바이러스 감염 세포의 생존력을 20%까지 증가시켰다.
7. 항체 단편의 바이러스 RNA/protein 발현 감소 효능
(1) qRT-PCR을 사용한 바이러스 RNA의 발현 측정
MDCK 세포(4 × 105)를 6-웰 플레이트에서 배양하고 다음과 같이 처리하였다: (i) 3D8 scFv 전처리: 37℃, 5% CO2에서 MDCK 세포에 3D8 scFv(3 μM)를 24시간 처리한 후, 3D8 scFv가 처리된 세포를 37℃에서 1시간 동안 MEM-프리 배지에서 독립적으로 3 가지 인플루엔자 바이러스 균주(H1N1/PR8, H3N2/X-31 및 H1N1/H275Y)(MOI = 0.1)로 감염시켰다. 그 후 감염 배지를 제거하고 세포를 토실 페닐알라닐 클로로메틸 케톤(TPCK) 처리된 트립신(1 μg/ml)을 함유하는 MEM-프리 배지(1% BSA)에서 37℃, 5% CO2에서 24시간 동안 배양하였다. (ii) 3D8 scFv 후처리: MDCK 세포를 37℃에서 1시간 동안 MEM-프리 배지에서 독립적으로 3개의 인플루엔자 바이러스 균주(H1N1/PR8, H3N2/X-31 및 H1N1/H275Y)(MOI = 0.1)로 감염시킨 후 감염 배지를 제거하였다. 배지를 3D8 scFv(3, 5, 7 μM)와 TPCK 처리된 트립신(1 μg/ml)이 포함된 MEM-free 배지(1% BSA)로 교체한 후 37℃, 5% CO2에서 24시간 동안 배양하였다(도 8의 위쪽). Total RNA는 제조업체의 지침에 따라 TRI 시약(MRC, Montgomery, OH, USA)을 사용하여 분리하였다. RNA 농도는 분광광도계를 사용하여 결정하였다. cDNA는 제조사의 프로토콜에 따라 CellScript All-in-One 5X First Strand cDNA Synthesis Master Mix (Cell safe, Yongin, Korea)를 사용하여 합성하였다. 정량적 실시간 PCR은 SYBR Premix Ex Taq 및 Rotor-Gene Q 시스템을 사용하여 수행하였다. 데이터는 Rotor-Gene Q series software version 2.3.1 (Qiagen, Chadstone, Victoria, Australia)을 사용하여 분석하였다. 유전자(HA 및 NP)는 아래 표 3에 기재된 프라이머를 사용하여 증폭하였다. GAPDH는 내부 대조군으로 증폭하였다.
유전자 Forward(5'->3') Reverse(5'->3') Accession No.
GAPDH (MDCK Cell Line) AAC ATC ATC CCT GCT TCC ACT (서열번호 17) GGC AGG TCA GAT CCA CAA C (서열번호 18) NM_001003142.2
GAPDH (Mouse) GGC ATT GCT CTC AAT GAC AA (서열번호 19) TGT GAG GGA GAT GCT CAG TG (서열번호 20) NC_000072.7
Hemagglutinin (A/PuertoRico/8/1934 (H1N1)) AGT GCC CAA AAT ACG TCAG G (서열번호 21) CAG TCC ATC CCC CTT CAA TA (서열번호 22) NC_002017.1
Hemagglutinin (A/X-31 (H3N2)) GAA AAT GGT TGG GAG GGA ATG (서열번호 23) GAT GGC TGC TTG AGT GCT TTT (서열번호 24) DQ874876.1
Hemagglutinin (A/California/07/2009(H1N1)) GGA ACG TGT TAC CCA GGA G (서열번호 25) GCT GCC GTT ACA CCT TTG TT (서열번호 26) NC_026433.1
Nucleoprotein (A/PuertoRico/8/1934 (H1N1)) ACC AAT CAA CAG AGG GCA TCT (서열번호 27) TGA TTT CGG TCC TCA TGT CAG (서열번호 28) NC_002019.1
Nucleoprotein (A/X-31 (H3N2)) AAA ATC ATG GCG TCT CAA GGC (서열번호 29) CGG TGC ACA TTT GGA TGT AGA (서열번호 30) AB036779.1
Nucleoprotein (A/California/07/2009(H1N1)) CCA GAT CAG TGT GCA GCC TA (서열번호 31) GGC TTT GCA CTT TCC ATC ATT C (서열번호 32) NC_026436.1
Interferon beta (Mouse) TTA CAC TCG CTT TGC CAT CCA A (서열번호 33) TCC CAC GTC AAT CTT TCC TCT T (서열번호 34) NC_000070.6
3가지 종류의 인플루엔자 바이러스로 감염 후 24시간째에 바이러스 RNA(HA 및 NP)의 발현을 측정한 결과, H1N1/PR8에 감염된 세포에서, 3D8 scFv를 전처리한 군은 3D8 scFv 미처리군에 비해 바이러스의 HA 및 NP RNA 발현이 50%이상 감소하였고(도 8의 H1N1/PR8(Pre)). 3D8 scFv를 후처리한 군은 3D8 scFv 미처리군에 비해 바이러스의 HA 및 NP RNA 발현이 40%이상 감소하였다(도 8의 H1N1/PR8(Post)). H3N2/X-31에 감염된 세포에서, 3D8 scFv를 전처리한 군은 3D8 scFv 미처리군에 비해 바이러스의 HA 및 NP RNA 발현이 40% 이상 감소하였고(도 9의 H3N2/X-31(Pre)), 3D8 scFv를 후처리한 군도 3D8 scFv 미처리군에 비해 바이러스의 HA 및 NP RNA 발현이 40%이상 감소하였다(도 9의 H3N2/X-31(Post)). 또한, H1N1/H275Y에 감염된 세포에서 3D8 scFv를 전처리한 군은 3D8 scFv 미처리군에 비해 바이러스의 HA 및 NP RNA 발현이 35% 이상 감소하였고 (도 10의 H1N1/H275Y(Pre)), 3D8 scFv를 후처리한 군도 3D8 scFv 미처리군에 비해 바이러스의 HA 및 NP RNA 발현이 40%이상 감소하였다(도 10의 H1N1/H275Y(Post)).
(2) 면역세포화학(immunocytochemistry, ICC)을 이용한 바이러스 proetin의 발현 측정
MDCK 세포(2×104)를 8-웰 챔버 슬라이드에서 배양하였다. 위 (1)에 작성한 내용과 동일하게 3D8 scFv 처리 및 바이러스 감염(H1N1/PR8 및 H1N1/H275Y)을 수행하였다(도 8의 위쪽). 슬라이드를 PBS로 2회 세척하고 25℃에서 냉각된 메탄올을 사용하여 15분간 고정하였다. 샘플을 Intracellular Staining Perm wash buffer로 5분 동안 투과화하였다. 1% BSA를 함유하는 PBST로 1시간 동안 블로킹한 후, 세포를 단일클론 마우스 항-3D8 scFv 항체 또는 다중클론 토끼 항-HA 항체(1:1000 희석, Invitrogen)와 함께 4℃에서 24시간 동안 인큐베이션하였다. 그 후 세포를 염소 항-마우스 IgG Alexa Fluor 488 이차 항체 또는 염소 항-토끼 IgG TRITC 이차 항체(1:1000 희석, Abcam)와 각각 25℃에서 1시간 동안 배양하였다. DAPI가 포함된 anti-fade Mounting Medium을 사용하여 슬라이드를 장착하고 Zeiss LSM 700 공초점 현미경을 사용하여 세포를 시각화하였다.
면역형광 분석을 통해 바이러스 HA 단백질 및 3D8 scFv의 존재를 확인하였다. H1N1/PR8 감염 세포의 3D8 scFv 미처리군의 경우 세포질에서 바이러스 HA 단백질이 검출된 반면(적색 신호), 3D8 scFv 전처리군의 경우 바이러스 HA 단백질이 검출되지 않았다(도 11 H1N1/PR8). 3D8 scFv 처리군의 세포질에서 3D8 scFv(녹색 신호)가 발견되었다. H1N1/H275Y-감염 세포의 3D8 scFv 전처리군은 3D8 scFv 미처리군에 비해 바이러스 HA 단백질의 검출 신호가 낮았다(도 11의 H1N1/H275Y). 또한 H1N1/PR8 및 H1N1/H275Y 감염 세포에서 3D8 scFv 후처리군은 3D8 scFv 미처리군에 비해 바이러스 HA 단백질 신호가 낮았다(도 12).
8. 항체 단편의 생체 내( in-vivo ) 항바이러스 활성 시험
(1) H1N1/H275Y 감염 마우스에서 임상적 항바이러스 효능
3D8 scFv의 임상적 항바이러스 효과를 평가하기 위해 실험용 생체 내(in vivo) 모델로 마우스를 실험을 수행하였다. 6주령의 수컷 specific pathogen-free (SPF) BALB/c 마우스(DBL; 체중 18-20g)를 표준 실험실 조건에서 수용하였다. 이들 마우스를 8~10마리씩 5개의 그룹으로 나누었다.
각 그룹의 마우스들에 바이러스 감염 전 PBS 처리; 바이러스 감염 후 PBS 처리; 바이러스 감염 전 3D8 scFv 처리; 바이러스 감염 후 3D8 scFv 처리; 및 바이러스 감염 후 5일 동안 Oseltamivir phosphate(Sigma-Aldrich, ST. Louis, MO, USA)를 경구 투여하였다. 각 그룹의 마우스들은 50 μl 치사량 50%의 H1N1/H275Y 바이러스(5×104 PFU)로 비강내 감염되었다. H1N1/H275Y로 마우스를 감염한 후 11일까지 임상 징후(체중 변화, 기침, 구부정한 등, 거친 털, 무리지어 모이는 것(발열), 비정상적인 분비물, 생존 등)에 대해 매일 모니터링하였다 (도 13). 참고로 3D8 scFv를 투여한 후 마우스는 비정상적인 임상 징후를 나타내지 않았으며, 조직병리학적으로 폐 실질과 그 간질에는 비정상적인 변화가 나타나지 않았다(도 14). 또한, 3D8 scFv는 투여 후 48시간 동안 세기관지 및 폐포의 상피 내벽에 국한된 것으로 밝혀졌다(도 15).
PBS 전처리 그룹은 25%만 생존한 반면, 3D8 scFv 전처리 그룹의 90%가 생존하였다. 3D8 scFv 후처리 그룹의 40%가 생존하였고 PBS 후처리 그룹은 어느 것도 생존하지 않았다. 오셀타미비르 처리 그룹은 30%가 생존하였다(도 16).
체중 변화의 경우 PBS 전처리 그룹의 평균 체중은 감염 0일 후(0dpi) 21.1g이었고, 감염 11 후(11dpi) 15.5g으로 27% 감소하였다. 3D8 scFv 전처리 그룹의 평균 체중은 0dpi에서 22.2g이었고, 7dpi에서 18.2g으로 약 18% 감소하였다. 그러나 평균 체중은 11dpi에서 20.6g으로 반등하였다. 오셀타미비르 처리 그룹에서 평균 체중은 0dpi에서 21.8g, 7dpi에서 30% 감소하였고, 11dpi에서 반등하였다. PBS 후처리 그룹에서 평균 체중은 0dpi에서 20.8g이었으나 8dpi에서 생존한 마우스는 없었다. 3D8 scFv 후처리 그룹의 평균 체중은 0dpi에서 23g이었고, 10dpi에서 16g으로 약 30% 감소하였으나, 그 이후 평균 체중은 회복되었다(도 17).
이를 통해 3D8 scFv의 처리가 바이러스에 감염된 세포의 생존율을 높이고, 바이러스 공격으로 인한 초기 체중 감소를 빠르게 회복시키는 것을 확인할 수 있다.
(2) 인플루엔자 A 바이러스 감염 마우스의 폐의 형태학적 분석
위 (1)의 각 그룹 마우스(5dpi)의 폐 조직을 수집하여 육안적 폐 병변 점수의 형태학적 분석을 수행하였다.
각 폐의 엽(葉)에 전체 폐 부피의 대략적인 백분율을 반영하는 숫자를 할당하였다. 모든 엽에 대한 총점은 육안으로 보이는 폐렴이 있는 전체 폐의 백분율 추정치를 형성하였다. 현미경적 폐 병변 점수의 형태학적 분석을 위해, 폐 조직을 10% 중성 완충 포르말린에 고정시켰다. 고정 후 조직을 일련의 알코올 용액과 자일렌을 통해 탈수하였고 파라핀 왁스에 포매하였다. 각 조직에서 섹션(5μm)을 준비하고 헤마톡실린 및 에오신(HE) 염색을 수행하였다. 준비된 조직 슬라이드를 맹검 방식(blinded fashion)으로 검사하고 간질성 폐렴의 추정된 중증도에 대해 다음과 같이 점수를 부여하였다: 0, 병변 없음; 1, 경미한 간질성 폐렴; 2, 중간의 다초점 간질성 폐렴; 3, 중간의 미만성 간질성 폐렴; 및 4, 심각한 간질성 폐렴. IHC(Immunohistochemistry)의 형태학적 분석을 위해 단면을 NIH Image J 1.43m Program(https://imagej.nih.gov/ij)으로 분석하여 정량적 데이터를 얻었다. 10개의 필드를 무작위로 선택하고 단위 면적(0.25mm2)당 양성 세포의 수를 결정하였다. 그 후 평균 값을 계산하였다.
육안적 병변은 주로 중간엽, 꼬리엽 및 부속엽에 존재하였다. 병리학적으로, 3D8 scFv 전처리 그룹의 폐는 바이러스 감염되지 않은 WT 그룹과 크게 다르지 않았다. 한편 PBS 전처리 그룹과 oseltamivir 처리 그룹에서 현저한 폐 울혈 및 황갈색 강화가 관찰되었다(도 18의 위쪽). 3D8 scFv 전처리 및 후처리 그룹은 PBS 및 oseltamivir 처리 그룹에 비해 폐 병변 중증도 점수가 유의하게 낮았다(P<0.05). 3D8 scFv 처리 그룹 사이에서 총 폐 병변 점수는 3D8 scFv 후처리 그룹보다 3D8 scFv 전처리 그룹에서 유의하게 낮았다(P<0.05). oseltamivir 처리 그룹은 PBS 처리 그룹보다 총 폐 병변 점수가 유의하게 낮았다(P<0.05)(도 18의 아래쪽).
현미경적 병변은 PBS 및 oseltamivir 처리 그룹에서 증가된 수의 간질 대식세포 및 림프구와 함께 두꺼워진 폐포 중격을 특징으로 하였다. 3D8 scFv 전처리 및 WT 그룹의 폐는 정상이었다(도 19의 위쪽). 3D8 scFv 전처리 그룹은 다른 그룹에 비해 현미경 병변 점수가 유의하게 낮았고(P<0.01), 3D8 scFv 후처리 그룹은 PBS 및 oseltamivir 처리 그룹보다 현미경 병변 점수가 유의하게 낮았다(P<0.05). 현미경적 폐 병변 점수는 PBS 처리 그룹 및 oseltamivir 처리 그룹 간에 유의한 차이가 없었다(도 19의 아래쪽).
(3) 인플루엔자 A 바이러스 감염 마우스 폐에서 바이러스 RNA 및 인터페론 수준 측정
마우스의 폐에서 바이러스 RNA 및 인터페론 수준을 측정하였다. 제조업체의 지침에 따라 TRI 시약을 사용하여 용해된 마우스 폐 조직(5dpi) 샘플에서 total RNA를 추출하였다. RNA 농도는 분광 광도계를 사용하여 결정하였다. cDNA는 제조업체의 프로토콜에 따라 CellScript All-in-One 5x First Strand cDNA Synthesis Master Mix를 사용하여 합성하였다. 유전자(HA, NP 및 IFN-β)는 앞에서 설명한 대로 qRT-PCR을 사용하여 표 3의 프라이머로 증폭하였다. GAPDH는 내부 대조군으로 증폭하였다. PBS 전처리 그룹과 비교하여 3D8 scFv 전처리 그룹의 폐에서 HA(68%), NP(71%) 및 IFN-β(51%)의 감소된 발현에 의해 입증된 바와 같이, 3D8 scFv 전처리 그룹의 폐에서 바이러스 RNA 및 IFN-β의 발현이 다른 그룹에 비해 감소하였다. 3D8 scFv 후처리 그룹의 폐에서 바이러스 RNA의 발현은 35%(HA) 및 18%(NP)로 낮았다(도 20).
(4) 인플루엔자 A 바이러스 감염 마우스 폐에서 바이러스 역가 확인
또한, 인플루엔자 A 바이러스 감염 마우스의 폐에서 바이러스 역가를 확인하였다. 마우스 폐 조직을 TissueRuptor(Qiagen, Chadstone, Victoria, Australia)를 사용하여 1ml의 MEM-프리 배지에서 균질화하였다. 4℃에서 5분 동안 6,000 x g에서 원심분리하여 균질액을 얻었다. Confluent MDCK 세포를 12-웰 플레이트에서 배양하였다. MEM-free 배지 내에서 조직 상층액(1:1000 희석액)을 37℃에서 1시간 동안 감염시킨 후 감염 배지를 제거하였다. 배지를 TPCK 처리된 트립신(1μg/ml) 및 1% 아가로스를 함유하는 1× Dulbecco’s modified eagle medium으로 교체하였다. 세포를 3일 동안 5% CO2, 37℃에서 추가 인큐베이션하였다. 세포 단층을 4% 포름알데히드로 고정하고 시각화를 위해 0.5% 크리스탈 바이올렛으로 염색하였다. 폐의 바이러스 역가는 PBS 전처리 그룹에 비해 3D8 scFv 전처리 그룹에서 약 70% 감소하였다(도 21). 폐의 바이러스 역가는 PBS 후처리 그룹에 비해 3D8 scFv 후처리 그룹에서 약 60% 감소하였다(도 21).
(5) 면역조직화학(Immunohistochemistry, IHC)을 이용한 바이러스 proetin의 발현 측정
조직 절편을 탈파라핀화하고 재수화한 후 citrate buffer를 사용하여 95℃에서 20분 동안 항원 복구를 수행하였다. 슬라이드를 TBST(TBS, 0.025% Triton X-100)로 세척하고 10% 소 태아 혈청 + 1% BSA 용액(in TBST)을 사용하여 2시간 동안 블로킹하였다. 조직 절편을 4℃에서 밤새 다클론 토끼 항-HA 항체(1:750 희석)와 함께 인큐베이션하였다. 그 후 조직 슬라이드를 각각 염소 항-토끼 IgG TRITC 2차 항체(1:1000 희석)와 함께 25℃에서 1시간 동안 인큐베이션하였다. 조직 섹션 슬라이드에 DAPI가 포함된 anti-fade Mounting Medium를 넣고 커버 글라스를 씌우고 LSM 700 Zeiss 공초점 현미경을 사용하여 세포를 시각화하였다. 바이러스 HA의 신호는 폐포 상피 세포 내층에서 감소되었고(도 22의 왼쪽), 뚜렷한 양성 신호의 수는 오셀타미비르 처리 그룹에 비해 3D8 scFv 전처리 그룹에서 유의하게 더 낮았다(P < 0.05)(도 22의 오른쪽).
9. 통계 분석
연속 데이터는 a one-way analysis of variance (ANOVA)으로 분석하였다. ANOVA 분석이 유의한 경우(P < 0.05), pairwise Tukey의 조정을 사후적으로 수행하였다. 이산 데이터는 Chi-square 및 Fisher’s exact test로 분석하였다. 필요한 경우 Pearson’s correlation coefficient 및/또는 Spearman’s rank correlation coefficient를 사용하여 데이터 간의 관계를 평가하였다. P < 0.05의 값은 유의미한 것으로 간주하였다. 모든 통계 분석은 GraphPad Prism software(GraphPad Software, San Diego, CA, USA)를 사용하여 수행하였다.
전술한 결과들을 통해 3D8 scFv가 바이러스 감염으로부터 숙주를 보호하는 예방적인 효과도 나타낼 뿐만 아니라, 바이러스 감염 후 과도한 염증 및 잠재적인 추가 병인을 완화함으로써 치료적인 효과도 나타낼 수 있음을 확인하였다.
본 발명의 설명은 예시를 위한 것이며, 본 발명이 속하는 기술분야의 통상의 지식을 가진 자는 본 발명의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 이에 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야만 한다.
본 발명의 범위는 후술하는 청구범위에 의하여 나타내어지며, 청구범위의 의미 및 범위 그리고 그 균등 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.

Claims (12)

  1. 서열번호 1로 표시되는 중쇄 CDR1(VH CDR1), 서열번호 2로 표시되는 VH CDR2, 및 서열번호 3으로 표시되는 VH CDR3, 서열번호 4로 표시되는 경쇄 CDR1(VL CDR1), 서열번호 5로 표시되는 VL CDR2 및 서열번호 6으로 표시되는 VL CDR3을 포함하는 항체 또는 이의 단편을 포함하는 인플루엔자 A 바이러스에 대한 항바이러스용 조성물.
  2. 청구항 1에 있어서, 상기 항체 또는 이의 단편은 서열번호 7의 아미노산 서열을 포함하는 중쇄가변영역을 포함하는 항바이러스용 조성물.
  3. 청구항 1에 있어서, 상기 항체 또는 이의 단편은 서열번호 8의 아미노산 서열을 포함하는 경쇄가변영역을 포함하는 항바이러스용 조성물.
  4. 청구항 1에 있어서, 상기 단편은 서열번호 9의 아미노산 서열을 포함하는 scFv인 항바이러스용 조성물.
  5. 청구항 1에 있어서, 상기 인플루엔자 A 바이러스는 인플루엔자 A 바이러스 H1 서브타입, 인플루엔자 A 바이러스 H2 서브타입, 인플루엔자 A 바이러스 H5 서브타입 및 인플루엔자 A 바이러스 H6 서브타입, 인플루엔자 A 바이러스 H3 서브타입, 인플루엔자 A 바이러스 H4 서브타입, 인플루엔자 A 바이러스 H14 서브타입 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나인 항바이러스용 조성물.
  6. 청구항 1에 있어서, 상기 인플루엔자 A 바이러스는 인플루엔자 A 바이러스 N1 서브타입, 인플루엔자 A 바이러스 N2 서브타입 및 이들의 변이체로 이루어진 군에서 선택된 적어도 하나인 항바이러스용 조성물.
  7. 청구항 1에 있어서, 상기 인플루엔자 A 바이러스는 H1N1 서브타입, H3N2 서브타입 및 이들의 변이체 중 적어도 하나인 항바이러스용 조성물.
  8. 청구항 1에 있어서, 상기 인플루엔자 A 바이러스는 오셀타미비르 저항성 인플루엔자 A 바이러스인 항바이러스용 조성물.
  9. 청구항 1 내지 8 중 어느 한 항의 조성물을 포함하는 인플루엔자 A 바이러스 감염 질환의 예방 또는 치료용 약학 조성물.
  10. 청구항 9에 있어서, 인플루엔자 A 바이러스 감염 질환의 치료용 약학 조성물.
  11. 청구항 1 내지 8 중 어느 한 항의 조성물을 포함하는 인플루엔자 A 바이러스 감염 질환의 예방 또는 개선용 식품 조성물.
  12. 청구항 11에 있어서, 인플루엔자 A 바이러스 감염 질환의 개선용 식품 조성물.
PCT/KR2021/012191 2020-09-08 2021-09-08 인플루엔자 a 바이러스에 대한 항바이러스용 조성물 WO2022055243A1 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN202180052536.6A CN116367856A (zh) 2020-09-08 2021-09-08 针对甲型流感病毒的抗病毒组合物
EP21867109.7A EP4212548A4 (en) 2020-09-08 2021-09-08 ANTIVIRAL COMPOSITION AGAINST INFLUENZA A VIRUS
JP2023515629A JP2023540373A (ja) 2020-09-08 2021-09-08 インフルエンザａウイルスに対する抗ウイルス用組成物
US18/021,989 US20240018218A1 (en) 2020-09-08 2021-09-08 Antiviral composition against influenza a virus

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202063075456P 2020-09-08 2020-09-08
US63/075,456 2020-09-08
KR1020210119473A KR20220033038A (ko) 2020-09-08 2021-09-08 인플루엔자 a 바이러스에 대한 항바이러스용 조성물
KR10-2021-0119473 2021-09-08

Publications (1)

Publication Number Publication Date
WO2022055243A1 true WO2022055243A1 (ko) 2022-03-17

Family

ID=80629726

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/012191 WO2022055243A1 (ko) 2020-09-08 2021-09-08 인플루엔자 a 바이러스에 대한 항바이러스용 조성물

Country Status (3)

Country Link
US (1) US20240018218A1 (ko)
JP (1) JP2023540373A (ko)
WO (1) WO2022055243A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR100E (fr) 1901-10-14 1902-10-24 Legrand Sa Un appareil dénommé "marquette manille"
KR20130140050A (ko) * 2010-11-02 2013-12-23 헥토 마뉴엘 제페다 로페즈 Ａ/ｈ1ｎ1 범유행 인플루엔자 바이러스에 대한 신규한 백신
KR20140012098A (ko) * 2011-02-14 2014-01-29 테라클론 사이언시스, 아이엔씨. 인플루엔자의 치료 및 진단을 위한 조성물 및 방법
US20150010566A1 (en) * 2011-12-02 2015-01-08 Hergen Spits Influenza a virus specific antibodies

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR100E (fr) 1901-10-14 1902-10-24 Legrand Sa Un appareil dénommé "marquette manille"
KR20130140050A (ko) * 2010-11-02 2013-12-23 헥토 마뉴엘 제페다 로페즈 Ａ/ｈ1ｎ1 범유행 인플루엔자 바이러스에 대한 신규한 백신
KR20140012098A (ko) * 2011-02-14 2014-01-29 테라클론 사이언시스, 아이엔씨. 인플루엔자의 치료 및 진단을 위한 조성물 및 방법
US20150010566A1 (en) * 2011-12-02 2015-01-08 Hergen Spits Influenza a virus specific antibodies

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
CHO SEUNGCHAN, YOUN HA-NA, HOANG PHUONG, CHO SUNGRAE, KIM KEE-EUN, KIL EUI-JOON, LEE GUNSUP, CHO MUN-JU, HONG JUHYUN, BYUN SUNG-JU: "Preventive Activity against Influenza (H1N1) Virus by Intranasally Delivered RNA-Hydrolyzing Antibody in Respiratory Epithelial Cells of Mice", VIRUSES, vol. 7, no. 9, 21 September 2015 (2015-09-21), pages 5133 - 5144, XP055910655, DOI: 10.3390/v7092863 *
DATABASE PROTEIN 12 March 2015 (2015-03-12), ANONYMOUS : "3D8 single-chain variable fragment, partial [synthetic construct]", XP055910657, retrieved from NCBI Database accession no. AIN44217 *
LEE YONGJUN, KIM DONGJUN, KIM TAEHYUN, OH YEONSU, KIM WON-KEUN, LEE SUKCHAN: "Antiviral effect of a nucleic acid hydrolyzing scFv against oseltamivir resistant influenza A virus", BIORXIV, 22 February 2021 (2021-02-22), XP055910652, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2021.02.19.432068v1.full.pdf> DOI: 10.1101/2021.02.19.432068 *

Also Published As

Publication number Publication date
US20240018218A1 (en) 2024-01-18
JP2023540373A (ja) 2023-09-22

Similar Documents

Publication Publication Date Title
WO2018034522A1 (ko) 코어와 그의 표면에 결합된 시알산, 시알릴락토스 또는 이들의 유도체를 포함하는 결합체 및 그의 용도
WO2021235616A1 (ko) 제2형 중증급성호흡기증후군 코로나바이러스 감염 질환의 예방 또는 치료용 조성물
WO2022050516A1 (ko) 담팔수 추출물을 유효성분으로 포함하는 코로나 바이러스 치료제
WO2017039365A1 (ko) Ｄ-싸이코스를 이용한 지질 흡수 억제 및/또는 배출 촉진 방법
WO2012023660A1 (ko) 크레이스토카릭스 오페르쿠라투스로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제
WO2022055243A1 (ko) 인플루엔자 a 바이러스에 대한 항바이러스용 조성물
WO2020032365A1 (ko) 진세노사이드 화합물을 함유하는 인플라마좀 매개 염증성 질환의 예방 또는 치료용 조성물
WO2011099812A2 (ko) 감초 추출물을 포함하는 로타바이러스 감염의 예방 또는 치료용 조성물
WO2022124800A1 (ko) 푸코실락토스를 유효성분으로 함유하는 항바이러스 조성물
WO2022225330A1 (ko) 염증성 질환 치료를 위한 nlrp3 인플라마좀 억제 펩타이드
WO2022031151A1 (ko) 고사리 추출물 또는 이의 분획물을 포함하는 항바이러스용 조성물
EP4212548A1 (en) Antiviral composition against influenza a virus
EP4194466A1 (en) Antiviral composition against coronavirus
WO2022071576A1 (ja) 新型コロナウイルス感染症の予防又は治療のための抗ウイルス剤
WO2021172755A1 (ko) 매실 추출물을 유효성분으로 포함하는 인플루엔자 바이러스 감염 예방 또는 치료용 약학적 조성물
WO2014051359A1 (ko) 네퍼린을 유효성분으로 포함하는 간암 예방 또는 치료용 약제학적 조성물
WO2019022357A1 (ko) 중동호흡기 증후군의 예방 또는 치료용 약학조성물
WO2022031137A1 (ko) 코로나바이러스에 대한 항바이러스용 조성물
WO2015108372A1 (ko) 오스모틴을 포함하는 흥분독성 또는 시냅스 기능 장애에 의한 신경 질환의 예방 또는 치료용 조성물, 및 이를 이용한 신경 질환의 예방 또는 치료 방법
WO2016013793A1 (ko) 감마 허피스바이러스 감염의 개선 및 치료에 사용하기 위한 아까시나무 추출물, 아카세틴 및 아피제닌의 용도
WO2021225344A1 (ko) 코로나 바이러스 억제용 펩타이드 및 그 용도
WO2023171998A1 (ko) 동맥경화를 포함하는 노화성 혈관질환 치료 또는 예방용 조성물로서의 사이코사포닌 c
WO2023172034A1 (ko) 더덕속, 참취속 및/또는 원지속 식물 추출물을 포함하는 외막형 바이러스의 예방 및 치료용 약학 조성물
WO2022215827A1 (ko) Sars-cov-2 3cl 프로테아제와 rdrp활성을 억제하는 지유 추출 조성물
WO2022270760A1 (ko) 커큐민 유도체와 tgf-β 수용체 억제제의 병용투여를 통한 비알코올성 지방간염 치료 방법

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21867109

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 18021989

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2023515629

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021867109

Country of ref document: EP

Effective date: 20230411