WO2022019652A1 - ＩｇＥ Ｆｃ 수용체를 포함하는 융합단백질 및 이를 포함하는 개 알레르기성 질환 치료 용도 - Google Patents

ＩｇＥ Ｆｃ 수용체를 포함하는 융합단백질 및 이를 포함하는 개 알레르기성 질환 치료 용도 Download PDF

Info

Publication number
WO2022019652A1
WO2022019652A1 PCT/KR2021/009425 KR2021009425W WO2022019652A1 WO 2022019652 A1 WO2022019652 A1 WO 2022019652A1 KR 2021009425 W KR2021009425 W KR 2021009425W WO 2022019652 A1 WO2022019652 A1 WO 2022019652A1
Authority
WO
WIPO (PCT)
Prior art keywords
fusion protein
ige
allergic
dimer
ecd
Prior art date
Application number
PCT/KR2021/009425
Other languages
English (en)
French (fr)
Inventor
장명호
남수연
조영규
오영민
Original Assignee
(주)지아이이노베이션
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (주)지아이이노베이션 filed Critical (주)지아이이노베이션
Publication of WO2022019652A1 publication Critical patent/WO2022019652A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K10/00—Animal feeding-stuffs
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/08—Antiallergic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to a fusion protein comprising an IgE Fc receptor and a canine immunoglobulin Fc region and uses thereof.
  • Canine atopic dermatitis is an inflammatory and pruritic allergic skin disease caused by the interaction between genetic and environmental factors. It affects about 10% of all dogs and is the second most widely known allergic skin disease in canines, especially dogs, after flea allergy. Allergic symptoms are expressed as eczematous skin, and canines such as dogs with atopic dermatitis often exhibit symptoms such as pruritus, severe itching, hair loss, epidermal peeling, and frequent paw licking. In addition, several problems are common, including skin infections and excessive sebum secretion.
  • IgE immunoglobulin E
  • IgE immunoglobulin E
  • Fc ⁇ RI IgE Fc receptor
  • mast cells or basophilic granulocytes release chemical mediators such as histamine, leukotriene, prostaglandin, bradykinin, and platelet activating factor, thereby causing allergic symptoms.
  • allergic diseases may be exacerbated by the binding between IgE and Fc ⁇ RI.
  • the present inventors studied to develop a safe and effective treatment for allergic diseases in dogs.
  • a fusion protein dimer including two monomers (Fc ⁇ RI ⁇ -ECD) including the canine immunoglobulin Fc region and the extracellular domain of the alpha subunit of the IgE Fc receptor had excellent binding ability with dog IgE.
  • the present invention was completed by confirming that the fusion protein dimer effectively inhibits free IgE in the blood of dogs.
  • One aspect of the present invention is a fusion protein dimer comprising two monomers including the extracellular domain (Fc ⁇ RI ⁇ -ECD) of the alpha subunit of the IgE Fc receptor, wherein the monomer is a dog-derived immunoglobulin IgG4-derived Fc It provides a fusion protein dimer comprising a region, wherein the Fc region and Fc ⁇ RI ⁇ -ECD are coupled through a hinge.
  • Fc ⁇ RI ⁇ -ECD extracellular domain of the alpha subunit of the IgE Fc receptor
  • Another aspect of the present invention provides a pharmaceutical composition for the treatment or prevention of allergic diseases in dogs comprising the fusion protein dimer.
  • Another aspect of the present invention provides a method for treating or preventing dog allergic disease, comprising administering the fusion protein dimer to a dog.
  • the fusion protein dimer according to the present invention binds very strongly to dog IgE by targeting only IgE as a single target, and exhibits excellent anti-allergic effect by effectively inhibiting free IgE in dog blood. Therefore, the fusion protein dimer according to the present invention can be utilized as a new pharmaceutical composition that can replace a conventional therapeutic agent including an anti-IgE antibody.
  • GI-301cA1 is a schematic diagram of the structure of a fusion protein dimer (GI-301cA1) comprising human Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc.
  • Figure 2 is a picture confirming this by SDS-PAGE after the production of a fusion protein dimer (GI-301cA1) containing human Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc.
  • FIG. 3 is a diagram confirming the fusion protein dimer (GI-301cA1) containing human Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc by Western blot.
  • FIG. 4 is a diagram analyzed by SEC-HPLC after production of a fusion protein dimer (GI-301cA1) containing human Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc.
  • FIG. 5 is a schematic diagram of the structure of a fusion protein dimer (GI-301cB1) comprising Canine Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc.
  • FIG. 6 is a diagram confirming the production of a fusion protein dimer (GI-301cB1) containing Canine Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc by SDS-PAGE.
  • FIG. 7 is a view confirming the fusion protein dimer (GI-301cB1) containing Canine Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc by Western blot.
  • FIG. 8 is a diagram analyzed by SEC-HPLC after producing a fusion protein dimer (GI-301cB1) containing Canine Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc.
  • GI-301 fusion protein dimer
  • human Fc ⁇ RI ⁇ -ECD human Fc ⁇ RI ⁇ -ECD
  • human-derived modified Fc region disclosed in Korean Patent Application No. 10-2019-0002029 and Canine IgE.
  • FIG. 10 is a view illustrating the binding ability between a fusion protein dimer (GI-301cA1) containing human Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc and Canine IgE.
  • a fusion protein dimer GI-301cA1
  • 11 is a view confirming the binding ability between Canine Fc ⁇ RI ⁇ -ECD and Canine IgG4 Fc-containing fusion protein dimer (GI-301cB1) and Canine IgE.
  • One aspect of the present invention provides a fusion protein dimer comprising two monomers comprising the extracellular domain (Fc ⁇ RI ⁇ -ECD) of the alpha subunit of the IgE Fc receptor.
  • the monomer is characterized in that it comprises an Fc region derived from dog-derived immunoglobulin IgG4.
  • the Fc region and Fc ⁇ RI ⁇ -ECD are coupled through a linker including a hinge.
  • IgE refers to an antibody protein known as immunoglobulin E. IgE has affinity for mast cells and basophils in blood. In addition, when an IgE antibody and its corresponding antigen (allergen) react, an inflammatory reaction is caused. In addition, IgE is known as an antibody causing anaphylaxis (anaphylaxis) appearing when mast cells or basophils are suddenly secreted.
  • IgE Fc receptor is also called Fc ⁇ receptor, and binds to the Fc portion of IgE.
  • Fc ⁇ RI Fc ⁇ receptor I
  • Fc ⁇ RII Fc ⁇ receptor II
  • Fc ⁇ RI Fc ⁇ receptor I
  • Fc ⁇ RII Fc ⁇ receptor II
  • Fc ⁇ RI is expressed in mast cells and basophils.
  • Fc ⁇ RI-bound IgE antibody is cross-linked by a multivalent antigen, degranulation occurs in mast cells or basophils, releasing various chemical transmitters including histamine. This release results in an immediate allergic reaction.
  • the Fc ⁇ RI is a membrane protein composed of one ⁇ chain, one ⁇ chain, and two ⁇ chains bonded to disulfide.
  • the part to which IgE binds is the ⁇ chain (Fc ⁇ RI ⁇ )
  • Fc ⁇ RI ⁇ has a size of about 60 kDa, and is composed of a hydrophobic domain existing in the cell membrane and a hydrophilic domain existing outside the cell membrane.
  • IgE binds to the extracellular domain of the ⁇ chain.
  • the Fc ⁇ RI ⁇ may be used in combination as an alpha subunit of the IgE Fc receptor.
  • the alpha subunit of the IgE Fc receptor may be derived from a human or a dog. have.
  • the alpha subunit of the human-derived IgE Fc receptor may have the amino acid sequence of SEQ ID NO:2.
  • the alpha subunit of the dog-derived IgE Fc receptor may have the amino acid sequence of SEQ ID NO: 3.
  • the extracellular domain of the alpha subunit of the IgE Fc receptor can bind to canine IgE
  • a fragment or variant of the extracellular domain of the alpha subunit of the human or canine IgE Fc receptor may be used.
  • the mutant may be performed by substituting, deleting or adding one or more proteins in the wild-type Fc ⁇ RI ⁇ -ECD (extracellular domain) as long as the function of the ⁇ chain of Fc ⁇ RI is not altered.
  • These various proteins or peptides may be at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 3.
  • human Fc ⁇ RI ⁇ -ECD of SEQ ID NO: 2 may be encoded by a polynucleotide having the sequence of SEQ ID NO: 7.
  • the canine Fc ⁇ RI ⁇ -ECD of SEQ ID NO: 3 may be encoded by a polynucleotide having the sequence of SEQ ID NO: 8.
  • IgG4-derived Fc region refers to an Fc region of an IgG antibody.
  • Fc region includes the heavy chain constant region 2 (CH2) and heavy chain constant region 3 (CH3) of an immunoglobulin, and does not include the variable region and light chain constant region (CL) of the heavy and light chains of an immunoglobulin. say protein.
  • the canine IgG4 Fc region may have the amino acid sequence of SEQ ID NO: 5.
  • the Fc domain of the immunoglobulin may be a wild-type Fc domain as well as an Fc domain variant.
  • the term "Fc domain variant" as used herein is different from the glycosylation pattern of the wild-type Fc domain, increased sugar chains compared to the wild-type Fc domain, decreased sugar chains compared to the wild-type Fc domain, or sugar chains are removed (deglycosylated) may be in the form.
  • an aglycosylated Fc domain is also included.
  • the Fc domain or variant may have a number of sialic acid, fucosylation, and glycosylation adjusted through culture conditions or host genetic manipulation.
  • the sugar chain of the Fc domain of an immunoglobulin can be modified by a conventional method such as a chemical method, an enzymatic method, and a genetic engineering method using microorganisms.
  • the Fc domain variant may be a mixed form of the immunoglobulin Fc region of IgG, IgA, IgE, IgD or IgM.
  • the Fc domain variant may be a form in which some amino acids of the Fc domain are substituted with other amino acids.
  • modified Fc region may be a native sugar chain or an increased sugar chain compared to the native type.
  • Immunoglobulin Fc sugar chains can be modified by conventional methods such as chemical methods, enzymatic methods, and genetic engineering methods using microorganisms.
  • the fusion protein monomer may be of the following structural formula (I) or (II):
  • N'-X-Linker (1)-Fc region fragment or variant thereof-C' (I)
  • the N' is the N-terminus of the fusion protein
  • X is Fc ⁇ RI ⁇ -ECD or a fragment thereof
  • the linker (1) is a peptide linker.
  • the Fc ⁇ RI ⁇ -ECD or fragment thereof is as described above.
  • the peptide linker (1) is 5 to 80 consecutive amino acids, 10 to 70 consecutive amino acids, 15 to 60 consecutive amino acids, 20 to 50 consecutive amino acids, 25 to 40 consecutive amino acids, or It may consist of 25 to 35 amino acids. In one embodiment, the peptide linker (1) may consist of 30 amino acids. In addition, the peptide linker (1) may include at least one cysteine. Specifically, it may contain one, two or three cysteines. In addition, the peptide linker (1) may be derived from the hinge of an immunoglobulin. In one embodiment, the linker including a hinge connecting the Fc region and Fc ⁇ RI ⁇ -ECD may have the amino acid sequence of SEQ ID NO: 4.
  • Another aspect of the present invention provides a polynucleotide encoding a monomer comprising an extracellular domain (Fc ⁇ RI ⁇ -ECD) of an alpha subunit of an IgE Fc receptor and an Fc region derived from a dog-derived immunoglobulin IgG4.
  • Fc ⁇ RI ⁇ -ECD extracellular domain of an alpha subunit of an IgE Fc receptor
  • one or more bases may be mutated by substitution, deletion, insertion, or a combination thereof.
  • a synthesis method well known in the art for example, the method described in the literature (Engels and Uhlmann, Angew Chem Int Ed Engl., 37:73-127, 1988) can be used. and a triester, phosphite, phosphoramidite and H-phosphate method, PCR and other auto-primer methods, and an oligonucleotide synthesis method on a solid support.
  • the polynucleotide may additionally include a signal sequence or a leader sequence.
  • signal sequence refers to a nucleic acid encoding a signal peptide that directs secretion of a target protein.
  • the signal peptide is cleaved after translation in the host cell.
  • the signal sequence of the present invention is a nucleotide encoding an amino acid sequence that initiates the movement of a protein through the ER (endoplasmic reticulum) membrane.
  • the signal sequence is well-known in the art, and typically contains 16 to 30 amino acid residues, but may include more or fewer amino acid residues.
  • a typical signal peptide consists of three regions: a basic N-terminal region, a central hydrophobic region and a more polar C-terminal region.
  • the central hydrophobic region contains 4 to 12 hydrophobic residues that anchor the signal sequence through the membrane lipid bilayer during migration of the immature polypeptide.
  • the signal sequence is cleaved in the lumen of the ER by cellular enzymes commonly known as signal peptidases.
  • the signal sequence may be tissue Plasminogen Activation (tPa), a signal sequence of Herpes simplex virus glycoprotein D (HSV gDs), an IgG signal sequence, or a growth hormone secretion signal sequence.
  • tPa tissue Plasminogen Activation
  • HSV gDs Herpes simplex virus glycoprotein D
  • IgG signal sequence an IgG signal sequence
  • a secretion signal sequence used in higher eukaryotic cells, including mammals, may be used.
  • Signal sequences useful in the present invention include an antibody light chain signal sequence, eg, antibody 14.18 (Gillies et al., J. Immunol. Meth 1989. 125: 191-202), an antibody heavy chain signal sequence, eg, MOPC141 antibody heavy chain signal. sequence (Sakano et al., Nature, 1980. 286: 676-683) and other signal sequences known in the art (see, eg, Watson et al., Nucleic Acid Research, 1984. 12:5145-5164). .
  • a signal sequence consisting of amino acids of SEQ ID NO: 1 was used.
  • Another aspect of the present invention provides an expression vector loaded with a polynucleotide encoding the monomer.
  • the term “vector” may be introduced into a host cell, recombine and inserted into the host cell genome. or said vector is understood as a nucleic acid means comprising a nucleotide sequence capable of spontaneous replication as an episome.
  • the vectors include linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, viral vectors, mini-chromosomes and analogs thereof.
  • examples of viral vectors include, but are not limited to, retroviruses, adenoviruses, and adeno-associated viruses.
  • the vector may be plasmid DNA, phage DNA, etc., commercially developed plasmids (pUC18, pBAD, pIDTSAMRT-AMP, etc.), Escherichia coli-derived plasmids (pYG601BR322, pBR325, pUC118, pUC119, etc.), Bacillus subtilis plasmids (pUB110, pTP5, etc.), yeast-derived plasmids (YEp13, YEp24, YCp50, etc.), phage DNA (Charon4A, Charon21A, EMBL3, EMBL4, ⁇ gt10, ⁇ gt11, ⁇ ZAP, etc.), animal virus vectors (retroviruses) ), adenovirus, vaccinia virus, etc.), insect virus vectors (baculovirus, etc.). Since the vector exhibits different protein expression levels depending on host cells, it is preferable to select and use a host cell most suitable
  • the plasmid may contain a selectable marker such as an antibiotic resistance gene, and host cells maintaining the plasmid may be cultured under selective conditions.
  • the term "gene expression” or “expression” of a protein of interest is understood to mean transcription of a DNA sequence, translation of an mRNA transcript, and secretion of a fusion protein product or fragment thereof.
  • a useful expression vector may be RcCMV (Invitrogen, Carlsbad) or a variant thereof.
  • the expression vector contains a human cytomegalovirus (CMV) promoter to promote continuous transcription of the target gene in mammalian cells and a bovine growth hormone polyadenylation signal sequence to increase the stable state level of RNA after transcription.
  • CMV human cytomegalovirus
  • a transformed cell into which the expression vector is introduced.
  • the term “transformed cell” refers to prokaryotic and eukaryotic cells into which a recombinant expression vector can be introduced.
  • the fusion protein of the present invention can be produced by expressing the polynucleotide contained in the vector.
  • the terms "transfected”, “transformed” and “transfected” refer to the introduction of a nucleic acid (eg, a vector) into a cell using techniques known in the art.
  • the transformation can be performed by various methods. As long as it can produce the fusion protein of the present invention, it is not particularly limited thereto. Specifically, the transformation method is CaCl 2 precipitation method, CaCl 2 Hanahan increased efficiency by using a reducing material called DMSO (dimethyl sulfoxide) in the precipitation method Method, electroporation (electroporation), calcium phosphate precipitation method, protoplast fusion method, agitation method using silicon carbide fiber, agrobacterium mediated transformation method, transformation method using PEG, dextran sulfate, lipofectamine and drying /inhibition-mediated transformation methods and the like can be used.
  • the infection infection
  • a target object can be delivered into a cell using virus particles.
  • the vector can be introduced into the host cell by gene bombardment or the like.
  • the host cell used for the production of the transformed cell can also produce the fusion protein of the present invention, it is not particularly limited thereto.
  • the host cell may include, but is not limited to, a cell of prokaryotic, eukaryotic, mammalian, plant, insect, fungal or cellular origin.
  • E. coli may be used as an example of the prokaryotic cell.
  • yeast may be used as an example of eukaryotic cells.
  • the mammalian cells include CHO cells, F2N cells, COS cells, BHK cells, Bowes melanoma cells, HeLa cells, 911 cells, AT1080 cells, A549 cells, SP2/0 cells, and human lymphoblastoid cells.
  • NSO cells HT-1080 cells, PERC.6 cells, HEK 293 cells or HEK293T cells may be used, but is not limited thereto, and any cell usable as a mammalian host cell known to those skilled in the art may be used.
  • the glycosylation-related gene possessed by the host cell is manipulated through a method known to those skilled in the art to obtain a sugar chain pattern (e.g., sialic acid, fucosylation, glycosylation) can be adjusted.
  • a sugar chain pattern e.g., sialic acid, fucosylation, glycosylation
  • Another aspect of the present invention provides a method for producing the fusion protein dimer.
  • the production method of the fusion protein comprises the steps of culturing the transformed cell; and recovering the dimer of the fusion protein of the present invention.
  • culture refers to a method of growing microorganisms in an appropriately artificially controlled environmental condition.
  • the method of culturing the transformed cells can be performed using a method well known in the art.
  • the culture is not particularly limited as long as it can be produced by expressing the fusion protein of the present invention.
  • the culture may be continuously cultured in a batch process or in a fed batch or repeated fed batch process.
  • the step of recovering the fusion protein dimer from the culture may be performed by a method known in the art.
  • the recovery method is not particularly limited as long as it can recover the produced fusion protein of the present invention.
  • the recovery method is centrifugation, filtration, extraction, spraying, drying, evaporation, precipitation, crystallization, electrophoresis, fractional dissolution (eg ammonium sulfate precipitation), chromatography (eg ion exchange, affinity , hydrophobicity and size exclusion) and the like.
  • a pharmaceutical composition for the treatment or prevention of allergic diseases in dogs comprising the above-described fusion protein dimer.
  • allergic disease means a pathological symptom caused by an allergic reaction mediated by the activation of mast cells, such as degranulation of mast cells, and such allergic diseases include food allergy, atopic dermatitis , asthma, allergic rhinitis, allergic conjunctivitis, allergic dermatitis, allergic contact dermatitis, anaphylaxis, urticaria, pruritus, These include insect allergies, chronic idiopathic urticarial and drug allergies.
  • the allergic disease may be IgE mediated.
  • prevention refers to any action that suppresses the occurrence of allergic diseases or delays the onset of the allergic disease by administration of the pharmaceutical composition.
  • treatment refers to any action in which the symptoms of an allergic disease are improved or beneficially changed by administration of the pharmaceutical composition.
  • the fusion protein dimer may be included in any amount (effective amount) depending on the use, formulation, purpose of formulation, etc., as long as it can exhibit anti-allergic activity, A typical effective amount will be determined within the range of 0.001% to 20.0% by weight, based on the total weight of the composition.
  • effective amount refers to the amount of the dimer of the fusion protein capable of inducing an anti-allergic effect. Such an effective amount can be determined empirically within the ordinary ability of one of ordinary skill in the art.
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carrier may be any non-toxic material suitable for delivery to a patient. Distilled water, alcohol, fats, waxes and inert solids may be included as carriers. Pharmaceutically acceptable adjuvants (buffers, dispersants) may also be included in the pharmaceutical composition.
  • the pharmaceutical composition of the present invention may be prepared as an oral dosage form or parenteral dosage form according to the route of administration by a conventional method known in the art, including a pharmaceutically acceptable carrier in addition to the fusion protein dimer.
  • pharmaceutically acceptable means that it does not inhibit the activity of the fusion protein dimer and does not have toxicity beyond which the application (prescription) target is adaptable.
  • suitable pharmaceutically acceptable carriers include sugars such as lactose, glucose, sucrose, dextrose, sorbitol, mannitol, and xylitol, starches such as corn starch, potato starch, wheat starch, cellulose, methylcellulose, ethylcellulose, Cellulose such as sodium carboxymethylcellulose and hydroxypropylmethylcellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, magnesium stearate, mineral oil, malt, gelatin, talc, polyol, vegetable and oil.
  • the formulation may include a diluent and/or excipient such as a
  • the pharmaceutical composition of the present invention When the pharmaceutical composition of the present invention is prepared for parenteral use, it may be formulated in the form of injections, transdermal administrations, nasal inhalants and suppositories together with suitable carriers according to methods known in the art.
  • a suitable carrier may be sterile water, ethanol, polyol such as glycerol or propylene glycol, or a mixture thereof, preferably Ringer's solution, PBS (phosphate buffered saline) containing triethanolamine, or sterilized for injection. Water, an isotonic solution such as 5% dextrose, etc. may be used.
  • the pharmaceutical composition of the present invention is administered in a pharmaceutically effective amount.
  • administration means introducing a predetermined substance to an individual by an appropriate method, and the administration route of the composition may be administered through any general route as long as it can reach a target tissue.
  • Intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, topical administration, oral administration, intranasal administration may be administered intrarectally, but is not limited thereto.
  • pharmaceutically effective amount refers to an amount sufficient to treat a disease at a reasonable benefit/risk ratio applicable to medical treatment and not to cause side effects, and the effective dose level is determined by the sex, age, and weight of the individual. , health condition, disease type, severity, drug activity, drug sensitivity, administration method, administration time, administration route and excretion rate, treatment period, factors including drugs used in combination or concurrently, and other factors well known in the medical field It can be easily determined by a person skilled in the art depending on the factors.
  • a preferred dosage of the pharmaceutical composition of the present invention is in the range of 0.01 ⁇ g/kg to 10 g/kg per day, preferably 0.01 mg/kg to 1 g/kg, depending on the individual's condition, weight, sex, age, severity, and route of administration. kg range. Administration may be performed once or divided into several times a day. These dosages should not be construed as limiting the scope of the invention in any respect.
  • the term "individual” means a subject to which the composition of the present invention can be applied (prescribed), and may be a canine animal, particularly a dog, but is not limited thereto.
  • the anti-allergic composition of the present invention may further include any compound or natural extract known to have anti-allergic activity and safety has already been verified to increase and reinforce anti-allergic activity.
  • the fusion protein dimer and the compound or natural extract having anti-allergic activity may be administered simultaneously or sequentially.
  • a feed composition for improving or alleviating allergic symptoms comprising the fusion protein dimer.
  • the fusion protein dimer may be combined with an appropriate delivery means for efficient delivery into the intestine.
  • the feed composition of the present invention may be prepared in any form of feed.
  • ingredients that do not interfere with the improvement or alleviation effect of allergy symptoms may be added to the feed composition, and the type thereof is not particularly limited.
  • it may contain various herbal extracts, feed auxiliary additives or natural carbohydrates acceptable to the feed as an additional component like a conventional feed.
  • the feed auxiliary additive is added to prepare the feed composition of each formulation, and those skilled in the art can appropriately select and use it.
  • various nutrients, vitamins, minerals (electrolytes), synthetic flavors and flavoring agents such as natural flavoring agents, coloring agents and fillers, pectic acid and its salts, alginic acid and its salts, organic acids, protective colloidal thickeners, pH Control agents, stabilizers, preservatives, glycerin, alcohol, carbonation agents used in carbonated beverages, etc. are included, but the types are not limited by the above examples.
  • a method for treating or preventing an allergic disease in dogs comprising administering the fusion protein dimer to a dog.
  • the fusion protein dimer, administration, allergic disease, treatment and prevention are the same as described above.
  • Another aspect of the present invention provides the use of the fusion protein dimer for manufacturing a medicament for the treatment or prevention of allergic diseases in dogs.
  • the fusion protein dimer, allergic disease, treatment and prevention are the same as described above.
  • Another aspect of the present invention provides the use of the fusion protein dimer for treating or preventing an allergic disease in dogs.
  • the fusion protein dimer, allergic disease, treatment and prevention are the same as described above.
  • a fusion protein comprising human Fc ⁇ RI ⁇ -ECD (Fc ⁇ RI ⁇ ECD; Extracellular domain) and a modified canine Fc region
  • signal peptide SEQ ID NO: 1
  • the extracellular domain of human Fc ⁇ RI ⁇ chain SEQ ID NO: 2
  • hinge A polynucleotide containing a nucleotide sequence encoding a fusion protein comprising a linker (SEQ ID NO: 4) and a modified dog Fc region (SEQ ID NO: 5) in this order from the N-terminus was synthesized and loaded into pcDNA3.4 vector.
  • the expression vector was introduced into ExpiCHO-S (ThermoFisher) cells to express the fusion protein.
  • the culture medium was collected after culturing for 7 days in an environment of 37° C., 125 RPM, and 8% CO 2 .
  • After purifying the cultured medium using a Protein-A affinity column, SDS-PAGE, Western blot, and Size-Exclusion HPLC (SE-HPLC) were performed on the purified protein to confirm the purity of the protein. did As shown in Table 5, it was confirmed that the purity of the protein purified by the SE-HPLC method was 80% or more.
  • a fusion protein comprising canine Fc ⁇ RI ⁇ -ECD and a modified canine Fc region, a signal peptide (SEQ ID NO: 1), the extracellular domain of the ⁇ chain of canine Fc ⁇ RI (SEQ ID NO: 3), a hinge linker (SEQ ID NO: 4) and A polynucleotide containing a nucleotide sequence encoding a fusion protein containing the modified dog Fc region (SEQ ID NO: 5) in this order from the N-terminus was synthesized and loaded into pcDNA3.4 vector.
  • the expression vector was introduced into ExpiCHO-S (ThermoFisher) cells to express the fusion protein.
  • the culture medium was collected after culturing for 7 days in an environment of 37° C., 125 RPM, and 8% CO 2 .
  • After purifying the cultured medium using a Protein-A affinity column, SDS-PAGE, Western blot, and Size-Exclusion HPLC (SE-HPLC) were performed on the purified protein to confirm the purity of the protein. did As shown in Table 6, it was confirmed that the purity of the protein purified by the SE-HPLC method was 95% or more.
  • Dog IgE (Bethyl Laboratories) binding ability was measured for the protein purified by the method of Preparation Example 1 and Preparation Example 2. Dog IgE binding capacity was tested through Octet RED 384 (ForteBio, octet 384 Red). The AR2G (Amine Reactive 2 nd generation) biosensors 10 minutes and then used by immersion in 1X kinetic buffer.
  • hFc ⁇ RI ⁇ ECD-hFc, hFc ⁇ RI ⁇ ECD-cFc and cFc ⁇ RI ⁇ ECD-cFc proteins were prepared at 10 ⁇ g/ml using 10 mM acetate pH 5.0 buffer and coated on a biosensor, and dog IgE was diluted to 1.6 nM to 100 nM to each concentration. binding ability was confirmed.
  • the binding affinities of hFc ⁇ RI ⁇ ECD-hFc, hFc ⁇ RI ⁇ ECD-cFc, and cFc ⁇ RI ⁇ ECD-cFc to dog IgE are shown in FIGS. 9, 10, 11 and 7 .
  • dog serum containing 6.1 to 24.7 ⁇ g/ml free IgE was administered at various concentrations (0.001, 0.01, 0.1, 1 and 10 ⁇ g/ml). ml) of the test substance, and the amount of free IgE was measured through ELISA.
  • Samples for analysis were prepared by adding test substances of various concentrations to dog serum containing free IgE and reacting them at 37°C for 1 hour. After blocking the plate, 300 ⁇ l per well was washed 5 times using 1X PBST, and 100 ⁇ l of the prepared standard and analysis sample was added per well and reacted at room temperature for 1 hour. Thereafter, 300 ⁇ l of each well was washed 5 times using 1X PBST, 100 ⁇ l of goat anti-canine IgE secondary antibody-HRP diluted 1:10,000 was added to each well, and reacted at room temperature for 1 hour.
  • the plate was washed 5 times at 300 ⁇ l per well using 1X PBST, and 100 ⁇ l of TMB solution was added per well and reacted.
  • 100 ⁇ l of stop solution was added per well to terminate the reaction.
  • the absorbance was measured at 450 nm wavelength within 5 minutes and the values were analyzed.
  • FIG. 12 The experimental results are shown in FIG. 12 . As shown in FIG. 12 , it was found that hFc ⁇ RI ⁇ ECD-hFc and hFc ⁇ RI ⁇ ECD-cFc, which are fusion proteins containing human Fc ⁇ RI ⁇ ECD, have superior efficacy than cFc ⁇ RI ⁇ ECD-cFc in inhibiting free IgE.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Polymers & Plastics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Pulmonology (AREA)
  • Molecular Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Epidemiology (AREA)
  • Animal Husbandry (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 반려견의 알레르기성 질환을 치료하기 위한 신규한 융합단백질에 관한 것으로, 구체적으로 인간 또는 개의 IgE Fc 수용체의 알파 서브유닛의 세포외 도메인(FcεRIα-ECD)을 포함하며, 개의 면역글로불린 Fc 영역을 포함하는 융합단백질 이량체를 제공한다. 본 발명에 따른 융합단백질 이량체는 IgE 만을 단일표적으로 하여 개의 IgE에 매우 강하게 결합하며, 개의 혈액 내 free IgE를 효과적으로 억제시킴으로써 우수한 항알레르기 효과를 나타낸다. 따라서, 상기 융합단백질 이량체는 반려견의 알레르기성 질환에 대한 치료 또는 예방 용도의 의약품에 적용될 수 있다.

Description

ＩｇＥ Ｆｃ 수용체를 포함하는 융합단백질 및 이를 포함하는 개 알레르기성 질환 치료 용도
본 발명은 IgE Fc 수용체 및 개의 면역글로불린 Fc 영역을 포함한 융합단백질 및 이의 용도에 관한 것이다.
개 아토피성 피부염(CAD)은 유전 요인과 환경 요인 간 상호작용에 의해 유발되는 염증성 및 소양성 알레르기 피부 질환이다. 전체 개의 약 10%에서 발병하며 개과 동물, 특히 반려견에서 벼룩 알레르기 다음으로 가장 널리 알려진 알레르기성 피부 질환이다. 알레르기 증상은 습진성 피부로서 발현되고, 아토피성 피부염을 가지는 반려견과 같은 개과 동물은 종종 소양증, 중증 가려움증, 탈모, 표피 박리, 잦은 발 핥기 등의 증상을 나타낸다. 뿐만 아니라, 피부 감염 및 과도한 피지 분비를 비롯한 여러가지 문제가 흔히 발생한다.
한편, 대부분의 알레르기 질환은 면역글로불린 E(IgE)의 과잉 면역반응에 의해 유발된다. IgE는 정상 상태에서는 혈청 중에 아주 낮은 농도로 존재하는 항체이다. IgE는 일반적으로 무해한 항원에 의해서 생성되기도 하며, 특별한 자극 없이도 IgE가 증가되는 경우가 있는데 이러한 경우에 알레르기 질환이 야기될 수 있다. 비정상적으로 증가된 IgE가 비만세포(mast cell)와 호염기성 과립구(basophils) 등의 표면에 발현되는 고친화성 IgE Fc 수용체(FcεRI)에 결합할 수 있다. 이러한 결합에 의해 비만세포나 호염기성 과립구는 히스타민, 류코트리엔, 프로스타글란딘, 브라디키닌 및 혈소판 활성화 인자 등 화학 매개자를 방출하고, 그로 인해 알레르기 증상이 발생하게 된다. 특히, 알레르기 질환은 IgE 및 FcεRI 사이의 결합으로 증상이 악화될 수 있다.
현재 알레르기 질환을 치료하기 위하여 알레르겐 회피, 항알레르기 약물 투여, 체내 IgE 합성 조절, 항 IgE 항체 개발 등 여러가지 방법이 제안되었다. 그러나, 현재까지 알려진 치료 방법은 알레르기의 근본 원인을 해결할 수 없을 뿐 아니라 약제의 효능이 불충분하거나, 심각한 부작용이 발생하는 등 많은 단점을 가지고 있다. 따라서, 부작용 없이 반려견의 알레르기 질환을 효율적으로 치료할 수 있는 치료제 개발에 대한 필요성이 증가하고 있는 실정이다.
이에 본 발명자들은 안전하고 효과적인 반려견의 알레르기 질환 치료제를 개발하기 위해 연구하였다. 그 결과, 개의 면역글로불린 Fc 영역을 포함하고, IgE Fc 수용체의 알파 서브유닛의 세포외 도메인을 포함하는 단량체(FcεRIα-ECD) 두 개를 포함하는 융합단백질 이량체가 개의 IgE와의 결합능이 우수함을 발견하였다. 뿐만 아니라, 상기 융합단백질 이량체가 개의 혈액 내에서 free IgE를 효과적으로 억제함을 확인함으로써 본 발명을 완성하였다.
본 발명의 일 측면은, IgE Fc 수용체의 알파 서브유닛의 세포외 도메인(FcεRIα-ECD)을 포함하는 단량체 두 개를 포함하는 융합단백질 이량체로서, 상기 단량체는 개 유래의 면역글로불린 IgG4 유래의 Fc 영역을 포함하며 상기 Fc 영역과 FcεRIα-ECD는 힌지를 통해 결합된 것을 특징으로 하는 융합단백질 이량체를 제공한다.
본 발명의 다른 측면은, 상기 융합단백질 이량체를 포함하는 개 알레르기성 질환의 치료 또는 예방용 약학적 조성물을 제공한다.
본 발명의 또 다른 측면은, 상기 융합단백질 이량체를 개에 투여하는 단계를 포함하는 개 알레르기성 질환의 치료 또는 예방 방법을 제공한다.
본 발명에 따른 융합단백질 이량체는 IgE 만을 단일표적으로 하여 개의 IgE에 매우 강하게 결합하며, 개의 혈액 내 free IgE를 효과적으로 억제시킴으로써 우수한 항알레르기 효과를 나타낸다. 따라서, 본 발명에 따른 융합단백질 이량체는 종래의 항-IgE 항체를 포함하는 치료제를 대체할 수 있는 새로운 약학적 조성물로 활용될 수 있다.
도 1은 human FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cA1)의 구조를 도식화한 것이다.
도 2는 human FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cA1)를 생산한 후에 이를 SDS-PAGE로 확인한 그림이다.
도 3은 human FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cA1)를 생산한 후에 이를 웨스턴 블랏으로 확인한 그림이다.
도 4는 human FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cA1)를 생산한 후에 이를 SEC-HPLC로 분석한 그림이다.
도 5는 Canine FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cB1)의 구조를 도식화한 것이다.
도 6은 Canine FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cB1)를 생산한 후에 이를 SDS-PAGE로 확인한 그림이다.
도 7은 Canine FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cB1)를 생산한 후에 이를 웨스턴 블랏으로 확인한 그림이다.
도 8은 Canine FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cB1)를 생산한 후에 이를 SEC-HPLC로 분석한 그림이다.
도 9는 대한민국 특허출원 제10-2019-0002029호에서 개시한 human FcεRIα- ECD 및 인간 유래의 변형된 Fc 영역을 포함한 융합단백질 이량체(GI-301)와 Canine IgE와의 결합력을 확인한 것이다.
도 10은 human FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cA1)와 Canine IgE와의 결합력을 확인한 것이다.
도 11은 Canine FcεRIα-ECD 및 Canine IgG4 Fc를 포함하는 융합단백질 이량체(GI-301cB1)와 Canine IgE와의 결합력을 확인한 것이다.
도 12는 GI-301, GI-301cA1 및 GI-301cB1에 의한 개의 혈장 내 Free IgE 억제 정도를 확인한 결과이다.
본 발명의 일 측면은, IgE Fc 수용체의 알파 서브유닛의 세포외 도메인(FcεRIα-ECD)을 포함하는 단량체 두 개를 포함하는 융합단백질 이량체를 제공한다. 이때, 상기 단량체는 개 유래의 면역글로불린 IgG4 유래의 Fc 영역을 포함하는 것을 특징으로 한다. 이때, 상기 Fc 영역과 FcεRIα-ECD는 힌지를 포함한 링커를 통해 결합된다.
본 명세서에서 사용한 용어, "IgE"는 면역글로불린 E로 알려진 항체 단백질을 의미한다. IgE는 비만세포나 혈중의 호염기구 등에 친화성을 가진다. 또한, IgE 항체와 그것에 대응하는 항원(알레르겐)이 반응하면 염증반응을 일으킨다. 또한, IgE는 비만세포 또는 호염기구가 갑자기 분비되어 나타나는 아나필락시스(anaphylaxis)를 일으키는 항체로 알려져 있다.
본 명세서에서 사용한 용어, "IgE Fc 수용체"란 Fcε수용체라고도 불리며, IgE의 Fc 부분과 결합한다. 상기 수용체는 2 종류가 존재한다. IgE Fc에 대해 고친화성인 수용체는 Fcε수용체I(FcεRI)이라고 하고, IgE Fc에 대해 저친화성인 수용체는 Fcε수용체II(FcεRII)라고 한다. FcεRI은 비만세포, 호염기구에서 발현된다. FcεRI에 결합한 IgE 항체가 다가 항원에 의해 가교되면, 비만세포 또는 호염기구에서 탈과립이 생겨 히스타민을 비롯한 여러 가지 화학 전달 물질을 방출한다. 이러한 방출에 의해 즉시형 알레르기 반응이 나타난다.
상기 FcεRI는 하나의 α사슬과 한 개의 β 사슬 및 2황화 결합한 2개의 γ사슬로 구성된 막단백질이다. 이 중 IgE가 결합하는 부분은 α사슬(FcεRIα)로서, FcεRIα는 60 kDa 정도의 크기를 가지며, 세포막 안에 존재하는 소수성 도메인과 세포막 외부에 존재하는 친수성 도메인으로 구성된다. 특히, α사슬의 세포외 도메인에 IgE가 결합하게 된다. 상기 FcεRIα는 IgE Fc 수용체의 알파 서브유닛으로 혼용되어 사용될 수 있다.
본 발명의 IgE Fc 수용체의 알파 서브유닛의 세포외 도메인(FcεRIα-ECD)을 포함하는 단량체 두 개를 포함하는 융합단백질 이량체에서 상기 IgE Fc 수용체의 알파 서브유닛은 인간 또는 개에서 유래된 것일 수 있다. 인간 유래의 IgE Fc 수용체의 알파 서브유닛은 서열번호 2의 아미노산 서열을 가질 수 있다. 또한, 개 유래의 IgE Fc 수용체의 알파 서브유닛은 서열번호 3의 아미노산 서열을 가질 수 있다.
본 명세서에서 IgE Fc 수용체의 알파 서브유닛의 세포외 도메인은 개의 IgE와 결합을 할 수 있는 한, 인간 또는 개의 IgE Fc 수용체의 알파 서브유닛의 세포외 도메인의 단편 또는 변이체를 사용할 수 있다.
상기 변이체는 FcεRI의 α사슬의 기능을 변형시키지 않는 한, 야생형 FcεRIα-ECD(Extracellular domain)에서 하나 이상의 단백질을 치환, 결실 또는 추가하는 방법을 통하여 수행될 수 있다. 이러한 다양한 단백질 또는 펩타이드는 서열번호 2 또는 서열번호 3의 아미노산 서열과 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99% 이상 동일한 것일 수 있다. 또한, 서열번호 2의 human FcεRIα-ECD는 서열번호 7의 서열을 갖는 폴리뉴클레오티드에 의해 코딩될 수 있다. 서열번호 3의 canine FcεRIα-ECD는 서열번호 8의 서열을 갖는 폴리뉴클레오티드에 의해 코딩될 수 있다.
또한, 본 명세서에서 사용한 용어, "IgG4 유래의 Fc 영역"은 IgG 항체의 Fc 영역을 의미한다. 이때, 용어 "Fc 영역"은 면역글로불린의 중쇄 불변 영역 2(CH2) 및 중쇄 불변 영역 3(CH3)을 포함하며, 면역글로불린의 중쇄 및 경쇄의 가변 영역 및 경쇄 불변 영역(CL)은 포함하지 않는 단백질을 말한다. 구체적으로, 개의 IgG4 Fc 영역은 서열번호 5의 아미노산 서열을 가질 수 있다.
또한, 상기 면역글로불린의 Fc 도메인은 야생형 Fc 도메인뿐만 아니라, Fc 도메인 변이체일 수 있다. 또한, 본 명세서에서 사용하는 용어 "Fc 도메인 변이체"는 야생형 Fc 도메인의 당쇄 형태(glycosylation pattern)와 다르거나, 야생형 Fc 도메인에 비해 증가된 당쇄, 야생형 Fc 도메인에 비해 감소한 당쇄, 또는 당쇄가 제거된(deglycosylated) 형태일 수 있다. 또한, 무당쇄(aglycosylated) Fc 도메인도 포함된다. Fc 도메인 혹은 변이체는 배양조건 혹은 호스트의 유전자 조작을 통해 조정된 숫자의 시알산(sialic acid), 퓨코실화(fucosylation), 당화(glycosylation)를 갖도록 한 것일 수 있다.
또한, 화학적 방법, 효소적 방법 및 미생물을 사용한 유전공학적 엔지니어링 방법 등과 같이 통상적인 방법으로 면역글로불린의 Fc 도메인의 당쇄를 변형시킬 수 있다. 또한, 상기 Fc 도메인 변이체는 면역글로불린은 IgG, IgA, IgE, IgD 또는 IgM의 Fc 영역이 혼합된 형태일 수 있다. 또한, 상기 Fc 도메인 변이체는 상기 Fc 도메인의 일부 아미노산이 다른 아미노산으로 치환된 형태일 수 있다.
또한, 상기 변형된 Fc 영역은 천연형 당쇄 또는 천연형에 비해 증가된 당쇄 일 수 있다. 화학적 방법, 효소적 방법 및 미생물을 사용한 유전공학적 엔지니어링 방법 등과 같이 통상적인 방법으로 면역글로불린 Fc 당쇄를 변형시킬 수 있다.
구체적으로, 상기 융합단백질 단량체는 하기 구조식 (I) 또는 (II)로 이루어진 것일 수 있다:
N'-X-링커(1)-Fc 영역 단편 또는 이의 변이체-C' (I)
N'-Fc 영역 단편 또는 이의 변이체-링커(1)-X-C' (II)
이때, 상기 구조식 (I) 및 (II)에 있어서,
상기 N'은 융합단백질의 N-말단이고,
상기 C'는 융합단백질의 C-말단이며,
상기 X는 FcεRIα-ECD 또는 이의 단편이고,
상기 링커(1)는 펩타이드 링커이다.
이때, 상기 FcεRIα-ECD 또는 이의 단편은 전술한 바와 같다.
이때, 상기 펩타이드 링커(1)은 5 내지 80개의 연속된 아미노산, 10 내지 70개의 연속된 아미노산, 15 내지 60개의 연속된 아미노산, 20 내지 50개의 연속된 아미노산, 25 내지 40개의 연속된 아미노산, 또는 25 내지 35개의 아미노산으로 이루어질 수 있다. 일 구체예로 펩타이드 링커(1)은 30개의 아미노산으로 이루어질 수 있다. 또한, 펩타이드 링커(1)은 적어도 하나의 시스테인을 포함할 수 있다. 구체적으로, 한 개, 두 개 또는 세 개의 시스테인을 포함할 수 있다. 또한, 상기 펩타이드 링커(1)은 면역글로불린의 힌지에서 유래된 것일 수 있다. 일 구체예에서는, 상기 Fc 영역과 FcεRIα-ECD를 연결하는 힌지를 포함한 링커는 서열번호 4의 아미노산 서열을 가질 수 있다.
구체적인 단량체 서열은 다음 표 1 내지 표 4에 나타냈다.
구분 GI-301cA1 아미노산 서열 서열번호
mIgG signal MEWSWVFLFFLSVTTGVHS 1
hFcεRIα ECD VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ 2
NL028 hinge linker GS GGGGS GGGGS GGGG SA ESKYGPPCPPCP 4
Canine IgG4Fc(Caninized F01) APEAAGGPSVFIFPPKPKDQLLIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVLHEALHNHYTQESLSHSPGK 5
구분 GI-301cB1 아미노산 서열 서열번호
mIgG signal MEWSWVFLFFLSVTTGVHS 1
FcεRIα ECD(Canine) KPTVSMNPPWNTILKDDSVTLTCTGNNSLEVDSAVWLHNNTTLQETTSRLDINKAQIQDSGEYRCRENRSILSDPVYLTVFTEWLILQASANVVMEGESFLIRCHSWKNLRLTKVTYYKDGIPIRYWYENFNISISNVTTKNSGNYSCSGQIQQKGYTSKVLNIIVKKEPTKQNKYSGLQ 3
NL028 hinge linker GS GGGGS GGGGS GGGG SA ESKYGPPCPPCP 4
Canine IgG4Fc(Caninized F01) APEAAGGPSVFIFPPKPKDQLLIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFNGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVLHEALHNHYTQESLSHSPGK 5
구분 GI-301cA1 핵산 서열 서열번호
mIgG signal ATGGAATGGTCCTGGGTGTTCCTGTTCTTCCTGTCCGTGACCACCGGCGTGCACTCT 6
hFcεRIα ECD GTGCCTCAGAAACCCAAAGTGTCTCTGAACCCTCCTTGGAACCGGATCTTCAAGGGCGAGAACGTGACCCTGACCTGCAACGGCAACAACTTCTTCGAGGTGTCCTCCACCAAGTGGTTCCACAACGGCTCCCTGTCCGAGGAAACAAACTCCAGCCTGAACATCGTGAACGCCAAGTTCGAGGACTCCGGCGAGTACAAGTGCCAGCACCAGCAAGTGAACGAGTCCGAGCCTGTGTACCTGGAAGTGTTCTCCGACTGGCTGCTGCTCCAGGCTTCTGCCGAGGTTGTGATGGAAGGCCAGCCTCTGTTCCTGAGATGTCACGGCTGGCGGAACTGGGACGTGTACAAAGTGATCTACTACAAGGACGGCGAGGCCCTGAAGTATTGGTACGAGAACCACAACATCTCCATCACCAACGCCACCGTGGAAGATTCCGGCACCTACTACTGCACCGGCAAAGTGTGGCAGCTGGACTACGAGAGCGAGCCTCTGAACATCACCGTGATCAAGGCCCCTAGAGAGAAGTACTGGCTGCAA 7
NL028 hinge linker GGATCTGGCGGAGGTGGAAGCGGAGGCGGAGGTTCTGGTGGCGGAGGATCTGCTGAGTCTAAGTACGGCCCTCCTTGTCCTCCATGTCCT 9
Canine IgG4Fc(Caninized F01) GCTCCAGAAGCTGCTGGCGGCCCTTCCGTGTTCATCTTCCCACCTAAGCCTAAGGACCAGCTGCTGATCGCTCGGACCCCTGAAGTGACATGCGTGGTGGTGGATCTGGACCCTGAAGATCCCGAGGTGCAGATCAGTTGGTTCGTGGACGGCAAGCAGATGCAGACCGCTAAGACCCAGCCTAGAGAGGAACAGTTCAACGGCACCTACAGAGTGGTGTCCGTGCTGCCTATCGGCCACCAGGATTGGCTGAAGGGCAAGCAGTTCACCTGTAAAGTGAACAACAAGGCTCTGCCCTCTCCAATCGAGCGGACCATCTCTAAGGCTAGAGGCCAGGCTCACCAGCCTAGCGTGTACGTTTTGCCTCCTAGCCGCGAGGAACTGTCCAAGAACACCGTGTCTCTGACCTGCCTGATCAAGGACTTCTTCCCTCCTGACATCGACGTGGAATGGCAGTCCAACGGCCAGCAAGAGCCCGAGTCCAAGTACAGAACCACACCTCCACAGCTGGACGAGGACGGCTCCTACTTCCTGTACTCCAAGCTGTCCGTGGACAAGTCTCGGTGGCAGAGAGGCGACACCTTCATCTGTGCTGTGCTGCACGAGGCCCTGCACAACCACTACACCCAAGAGTCCCTGTCTCACTCCCCTGGCAAG 10
구분 GI-301cB1 핵산 서열 서열번호
mIgG signal ATGGAATGGTCCTGGGTGTTCCTGTTCTTCCTGTCCGTGACCACCGGCGTGCACTCT 6
FcεRIα ECD(Canine) AAGCCTACCGTGTCTATGAACCCTCCTTGGAACACCATCCTGAAGGACGACAGCGTGACCCTGACCTGCACCGGCAACAATTCCCTGGAAGTGGACTCTGCCGTGTGGCTGCACAACAACACCACACTGCAAGAGACAACCTCTCGGCTGGACATCAACAAGGCCCAGATCCAGGACTCTGGCGAGTACCGGTGCAGAGAGAACCGGTCCATCCTGAGCGATCCCGTGTACCTGACCGTGTTCACCGAGTGGCTGATCCTCCAGGCCTCTGCCAACGTTGTGATGGAAGGCGAGTCCTTCCTGATCCGGTGCCACTCCTGGAAGAACCTGCGGCTGACCAAAGTGACCTACTACAAGGACGGCATCCCCATCCGGTATTGGTACGAGAACTTCAACATCTCCATCTCCAACGTCACCACCAAGAACTCCGGCAACTACTCCTGCTCCGGACAGATCCAGCAGAAGGGCTACACCTCCAAGGTGCTGAACATCATCGTGAAGAAAGAGCCCACCAAGCAGAACAAGTACTCCGGCCTGCAA 8
NL028 hinge linker GGATCTGGCGGAGGTGGAAGCGGAGGCGGAGGTTCTGGTGGCGGAGGATCTGCTGAGTCTAAGTACGGCCCTCCTTGTCCTCCATGTCCT 9
Canine IgG4Fc(Caninized F01) GCTCCAGAAGCTGCTGGCGGCCCTTCCGTGTTCATCTTCCCACCTAAGCCTAAGGACCAGCTGCTGATCGCTCGGACCCCTGAAGTGACATGCGTGGTGGTGGATCTGGACCCTGAAGATCCCGAGGTGCAGATCAGTTGGTTCGTGGACGGCAAGCAGATGCAGACCGCTAAGACCCAGCCTAGAGAGGAACAGTTCAACGGCACCTACAGAGTGGTGTCCGTGCTGCCTATCGGCCACCAGGATTGGCTGAAGGGCAAGCAGTTCACCTGTAAAGTGAACAACAAGGCTCTGCCCTCTCCAATCGAGCGGACCATCTCTAAGGCTAGAGGCCAGGCTCACCAGCCTAGCGTGTACGTTTTGCCTCCTAGCCGCGAGGAACTGTCCAAGAACACCGTGTCTCTGACCTGCCTGATCAAGGACTTCTTCCCTCCTGACATCGACGTGGAATGGCAGTCCAACGGCCAGCAAGAGCCCGAGTCCAAGTACAGAACCACACCTCCACAGCTGGACGAGGACGGCTCCTACTTCCTGTACTCCAAGCTGTCCGTGGACAAGTCTCGGTGGCAGAGAGGCGACACCTTCATCTGTGCTGTGCTGCACGAGGCCCTGCACAACCACTACACCCAAGAGTCCCTGTCTCACTCCCCTGGCAAG 10
본 발명의 또 다른 측면은, IgE Fc 수용체의 알파 서브유닛의 세포외 도메인(FcεRIα-ECD) 및 개 유래의 면역글로불린 IgG4 유래의 Fc 영역을 포함하는 단량체를 코딩하는 폴리뉴클레오티드를 제공한다.
상기 폴리뉴클레오티드는 동일한 폴리펩타이드를 코딩한다면, 하나 이상의 염기가 치환, 결실, 삽입 또는 이들의 조합에 의해 변이될 수 있다. 폴리뉴클레오티드 서열을 화학적으로 합성하여 제조하는 경우, 당업계에 널리 공지된 합성법, 예를 들어 문헌(Engels and Uhlmann, Angew Chem IntEd Engl., 37:73-127, 1988)에 기술된 방법을 이용할 수 있으며, 트리에스테르, 포스파이트, 포스포르아미다이트 및 H-포스페이트 방법, PCR 및 기타 오토프라이머 방법, 고체 지지체상의 올리고뉴클레오티드 합성법 등을 들 수 있다.
한편, 상기 폴리뉴클레오티드는 신호서열(signal sequence) 또는 리더 서열(leader sequence)을 추가적으로 포함할 수 있다. 여기에서 사용된 용어 "신호서열"은 목적 단백질의 분비를 지시하는 신호펩타이드를 코딩하는 핵산을 의미한다. 상기 신호펩타이드는 숙주세포에서 번역된 후에 절단된다. 구체적으로, 본 발명의 신호서열은 ER(endoplasmic reticulum) 막을 관통하는 단백질의 이동을 개시하는 아미노산 서열을 코딩하는 뉴클레오티드이다.
신호서열은 당업계에 그 특징이 잘 알려져 있으며, 통상 16 내지 30개의 아미노산 잔기를 포함하나, 그보다 더 많거나 적은 아미노산 잔기를 포함할 수 있다. 통상적인 신호 펩타이드는 기본 N-말단 영역, 중심의 소수성 영역 및 보다 극성인(polar) C-말단 영역의 세 영역으로 구성된다. 중심 소수성 영역은 미성숙 폴리펩타이드가 이동하는 동안 막지질 이중층을 통하여 신호서열을 고정시키는 4 내지 12개의 소수성 잔기를 포함한다.
개시 이후에, 신호서열은 흔히 신호 펩티다아제(signal peptidases)로 알려진 세포 효소에 의하여 ER의 루멘(lumen) 내에서 절단된다. 이때, 상기 신호서열은 tPa(tissue Plasminogen Activation), HSV gDs(signal sequence of Herpes simplex virus glycoprotein D), IgG 신호서열 또는 성장 호르몬(growth hormone)의 분비신호서열일 수 있다. 바람직하게, 포유동물 등을 포함하는 고등 진핵 세포에서 사용되는 분비 신호서열을 사용할 수 있다.
본 발명에서 유용한 신호서열은 항체 경쇄 신호서열, 예를 들면 항체 14.18(Gillies et al., J. Immunol. Meth 1989. 125:191-202), 항체 중쇄 신호서열, 예를 들면, MOPC141 항체 중쇄 신호서열(Sakano et al., Nature, 1980. 286: 676-683) 및 당업계에 알려진 다른 신호서열(예, Watson et al., Nucleic Acid Research, 1984. 12:5145-5164를 참조)을 포함한다. 일 실시예로 서열번호 1의 아미노산으로 구성된 신호서열이 이용되었다.
본 발명의 또 다른 측면은, 상기 단량체를 코딩하는 폴리뉴클레오티드가 적재된 발현 벡터를 제공한다.
본 명세서에서 사용하는 용어, "벡터"는 숙주 세포에 도입되어 숙주 세포 유전체 내로 재조합 및 삽입될 수 있다. 또는 상기 벡터는 에피좀으로서 자발적으로 복제될 수 있는 뉴클레오티드 서열을 포함하는 핵산 수단으로 이해된다. 상기 벡터는 선형 핵산, 플라스미드, 파지미드, 코스미드, RNA 벡터, 바이러스 벡터, 미니 염색체 및 이의 유사체들을 포함한다. 바이러스 벡터의 예로는 레트로바이러스, 아데노바이러스 및 아데노 관련 바이러스를 포함하나 이에 제한되지 않는다.
구체적으로, 상기 벡터는 플라스미드 DNA, 파아지 DNA 등이 될 수 있고, 상업적으로 개발된 플라스미드(pUC18, pBAD, pIDTSAMRT-AMP 등), 대장균 유래 플라스미드(pYG601BR322, pBR325, pUC118, pUC119 등), 바실러스 서브틸리스 유래 플라스미드(pUB110, pTP5 등), 효모-유래 플라스미드(YEp13, YEp24, YCp50 등), 파아지 DNA(Charon4A, Charon21A, EMBL3, EMBL4, λgt10, λgt11, λZAP 등), 동물 바이러스 벡터(레트로바이러스(retrovirus), 아데노바이러스(adenovirus), 백시니아 바이러스(vaccinia virus) 등), 곤충 바이러스 벡터(배큘로바이러스(baculovirus) 등) 등이 될 수 있다. 상기 벡터는 숙주 세포에 따라서 단백질의 발현량 등이 다르게 나타나므로, 목적에 가장 적합한 숙주세포를 선택하여 사용함이 바람직하다.
또한, 상기 플라스미드는 항생제 내성 유전자와 같은 선별 마커를 포함할 수 있고, 플라스미드를 유지하는 숙주 세포는 선택적인 조건하에서 배양될 수 있다.
본 명세서에서 사용하는 용어, 목적 단백질의 "유전자 발현" 또는 "발현"은 DNA 서열의 전사, mRNA 전사체의 번역 및 융합 단백질 생산물 또는 이의 단편의 분비를 의미하는 것으로 이해된다. 유용한 발현 벡터는 RcCMV(Invitrogen, Carlsbad) 또는 이의 변이체일 수 있다. 상기 발현 벡터는 포유류 세포에서 목적 유전자의 연속적인 전사를 촉진하기 위한 인간 CMV(cytomegalovirus) 프로모터 및 전사 후 RNA의 안정상태 수준을 높이기 위한 우태 성장 인자(bovine growth hormone) 폴리아데닐레이션 신호서열을 포함할 수 있다.
본 발명의 또 다른 측면으로, 상기 발현 벡터가 도입된 형질전환 세포를 제공한다. 본 발명에서 사용된 용어 "형질전환 세포"는 재조합 발현 벡터가 도입될 수 있는 원핵세포 및 진핵세포를 나타낸다. 또한, 상기 벡터에 포함된 폴리뉴클레오티드를 발현시켜 본 발명의 융합단백질을 생산할 수 있다. 본 발명에서 사용된 용어, "형질주입된", "형질전환된" 및 "형질감염된"은 당업계에 공지된 기술을 사용하여 세포 내로 핵산(예를 들어, 벡터)을 도입하는 것을 의미한다.
상기 형질전환은 다양한 방법에 의하여 수행될 수 있다. 본 발명의 융합단백질을 생산할 수 있는 한, 특별히 이에 제한되지 않는다, 구체적으로, 상기 형질전환 방법은 CaCl2 침전법, CaCl2 침전법에 DMSO(dimethyl sulfoxide)라는 환원물질을 사용함으로써 효율을 높인 Hanahan 방법, 전기천공법(electroporation), 인산칼슘 침전법, 원형질 융합법, 실리콘 카바이드 섬유를 이용한 교반법, 아그로박테리아 매개된 형질전환법, PEG를 이용한 형질전환법, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등 이 사용될 수 있다. 또한, 감염(infection)을 수단으로 하여 바이러스 입자를 사용하여 목적물을 세포 내로 전달시킬 수 있다. 또한, 유전자 밤바드먼트 등에 의해 벡터를 숙주세포 내로 도입할 수 있다.
또한, 상기 형질전환 세포의 제작에 사용되는 숙주세포 역시 본 발명의 융합단백질을 생산할 수 있는 한, 특별히 이에 제한되지 않는다. 구체적으로 상기 숙주 세포는 원핵세포, 진핵세포, 포유동물, 식물, 곤충, 균류 또는 세포성 기원의 세포를 포함할 수 있지만 이에 한정되지 않는다. 상기 원핵세포의 일 예로는 대장균을 사용할 수 있다. 또한, 진핵세포의 일 예로는 효모를 사용할 수 있다. 또한, 상기 포유동물 세포로 CHO 세포, F2N 세포, COS 세포, BHK 세포, 바우스(Bowes) 흑색종 세포, HeLa 세포, 911 세포, AT1080 세포, A549 세포, SP2/0 세포, 인간 림프아구(human lymphoblastoid), NSO 세포, HT-1080 세포, PERC.6 세포, HEK 293 세포 또는 HEK293T 세포 등을 사용할 수 있으나, 이에 한정되지 않으며, 당업자에게 알려진 포유동물 숙주세포로 사용 가능한 세포는 모두 이용 가능하다.
전술한 바와 같이, 융합단백질의 치료제로서의 특성을 최적화하거나 기타 다른 목적을 위해, 호스트 세포가 갖고 있는 당화(glycosylation) 관련 유전자를 당업자에게 알려져 있는 방법을 통해 조작하여 융합단백질의 당쇄 패턴(예를 들어, 시알 산, 퓨코실화, 당화)을 조정할 수 있다.
본 발명의 또 다른 측면은, 상기 융합단백질 이량체의 생산방법을 제공한다.
상기 융합단백질의 생산방법은 상기 형질전환 세포를 배양하는 단계; 및 본 발명의 융합단백질 이량체를 회수하는 단계를 포함할 수 있다.
본 명세서에서 사용하는 용어, "배양"이란, 미생물을 적당히 인공적으로 조절한 환경조건에서 생육시키는 방법을 의미한다.
상기 형질전환 세포를 배양하는 방법은 당업계에 널리 알려져 있는 방법을 이용하여 수행할 수 있다. 구체적으로, 상기 배양은 본 발명의 융합단백질을 발현시켜서 생산할 수 있는 한 특별히 이에 제한되지 않는다. 구체적으로, 상기 배양은 배치 공정 또는 주입 배치 또는 반복 주입 배치 공정(fed batch or repeated fed batch process)에서 연속식으로 배양할 수 있다.
또한, 배양물로부터 상기 융합단백질 이량체를 회수하는 단계는 당업계에 공지된 방법에 의해 수행될 수 있다. 구체적으로, 상기 회수 방법은 생산된 본 발명의 융합단백질을 회수할 수 있는 한, 특별히 이에 제한되지 않는다. 바람직하게는, 상기 회수 방법은 원심분리, 여과, 추출, 분무, 건조, 증발, 침전, 결정화, 전기영동, 분별용해(예를 들면 암모늄설페이트 침전), 크로마토그래피(예를 들면 이온 교환, 친화성, 소수성 및 크기배제) 등의 방법일 수 있다.
본 발명의 또 다른 측면으로, 상술한 융합단백질 이량체를 포함하는 개 알레르기성 질환의 치료 또는 예방용 약학적 조성물을 제공한다.
또한, 본 명세서에서, "알레르기성 질환"은 비만세포의 탈과립 등 비만세포의 활성화가 매개된 알레르기 반응으로 인하여 초래되는 병리적 증상을 의미하며, 이러한 알레르기 질환에는 식품 알레르기, 아토피 피부염(atopic dermatitis), 천식(asthma), 알레르기성 비염(allergic rhinitis), 알레르기성 결막염(allergic conjunctivitis), 알레르기성 피부염(allergic dermatitis), 알레르기성 접촉성 피부염(allergic contact dermatitis), 과민성(anaphylaxis), 두드러기, 소양증, 곤충 알레르기, 만성 특발성 두드러기(chronic idiopathic urticarial) 및 약품 알레르기 등이 포함된다. 특히, 상기 알레르기 질환은 IgE 매개성일 수 있다.
상기 용어 "예방"은 상기 약학적 조성물의 투여에 의해 알레르기성 질환의 발생을 억제하거나 그의 발병을 지연시키는 모든 행위를 말한다. 상기 용어 "치료"는 상기 약학적 조성물의 투여에 의해 알레르기성 질환의 증세가 호전되거나 이롭게 변경하는 모든 행위를 말한다.
본 발명의 개 알레르기성 질환의 치료 또는 예방용 약학적 조성물에서 상기 융합단백질 이량체는 항알레르기 활성을 나타낼 수 있는 한, 용도, 제형, 배합 목적 등에 따라 임의의 양(유효량)으로 포함될 수 있는데, 통상적인 유효량은 조성물 전체 중량을 기준으로 할 때 0.001 중량% 내지 20.0 중량% 범위 내에서 결정될 것이다. 여기서 "유효량"이란 항알레르기 효과를 유도할 수 있는 상기 융합단백질 이량체의 양을 말한다. 이러한 유효량은 당업자의 통상의 능력 범위 내에서 실험적으로 결정될 수 있다.
이때, 상기 약학적 조성물은 약학적으로 허용 가능한 담체를 더 포함할 수 있다. 상기 약학적으로 허용 가능한 담체는 환자에게 전달하기에 적절한 비-독성 물질이면 어떠한 담체라도 가능하다. 증류수, 알코올, 지방, 왁스 및 비활성 고체가 담체로 포함될 수 있다. 약학적으로 허용되는 애쥬번트(완충제, 분산제) 또한 약학적 조성물에 포함될 수 있다.
구체적으로, 본 발명의 약학적 조성물은 상기 융합단백질 이량체 이외에 약학적으로 허용되는 담체를 포함하여 당업계에 공지된 통상의 방법으로 투여 경로에 따라 경구용 제형 또는 비경구용 제형으로 제조될 수 있다. 여기서 "약학적으로 허용되는" 의미는 상기 융합단백질 이량체의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 의미이다.
본 발명의 약학적 조성물이 경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 분말, 과립, 정제, 환제, 당의정제, 캡슐제, 액제, 겔제, 시럽제, 현탁액, 웨이퍼 등의 제형으로 제조될 수 있다. 이때 약학적으로 허용되는 적합한 담체의 예로서는 락토스, 글루코스, 슈크로스, 덱스트로스, 솔비톨, 만니톨, 자일리톨 등의 당류, 옥수수 전분, 감자 전분, 밀 전분 등의 전분류, 셀룰로오스, 메틸셀룰로오스, 에틸셀룰로오스, 나트륨 카르복시메틸셀룰로오스, 하이드록시프로필메틸셀룰로오스 등의 셀룰로오스류, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 마그네슘 스테아레이트, 광물유, 맥아, 젤라틴, 탈크, 폴리올, 식물성유 등을 들 수 있다. 제제화할 경우 필요에 따라 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 및/또는 부형제를 포함하여 제제화할 수 있다.
본 발명의 약학적 조성물이 비경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 주사제, 경피 투여제, 비강 흡입제 및 좌제의 형태로 제제화될 수 있다. 주사제로 제제화할 경우 적합한 담체로서는 멸균수, 에탄올, 글리세롤이나 프로필렌 글리콜 등의 폴리올 또는 이들의 혼합물을 사용할 수 있으며, 바람직하게는 링거 용액, 트리에탄올 아민이 함유된 PBS(phosphate buffered saline)나 주사용 멸균수, 5% 덱스트로스 같은 등장 용액 등을 사용할 수 있다.
한편, 본 발명의 약학적 조성물은 약학적으로 유효한 양으로 투여한다. 본 명세서에서 사용하는 용어 "투여"란, 적절한 방법으로 개체에게 소정의 물질을 도입하는 것을 의미하며, 상기 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다. 복강내 투여, 정맥내 투여, 근육내 투여, 피하 투여, 피내 투여, 국소 투여, 경구투여, 비내 투여, 직장내 투여될 수 있으나, 이에 한정되지는 않는다.
상기 용어 "약학적으로 유효한 양"이란 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미하며, 유효 용량 수준은 개체의 성별, 연령, 체중, 건강상태, 질병의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 배합 또는 동시에 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 약학 조성물의 바람직한 투여량은 개체의 상태, 체중, 성별, 연령, 중증도, 투여 경로에 따라 1일 0.01 ㎍/㎏ 내지 10 g/㎏ 범위, 바람직하게는 0.01 ㎎/㎏ 내지 1 g/㎏ 범위일 수 있다. 투여는 1일 1회 또는 수회로 나누어 이루어질 수 있다. 이러한 투여량은 어떠한 측면으로든 본 발명의 범위를 제한하는 것으로 해석되어서는 아니 된다.
상기 용어 "개체"란 본 발명의 조성물이 적용(처방)될 수 있는 대상을 의미하며, 개과 동물, 특히 개 일 수 있으나 이에 제한되지 않는다. 본 발명의 항알레르기용 조성물은 상기 융합단백질 이량체 이외에, 항알레르기 활성의 상승, 보강을 위하여 이미 안전성이 검증되고 항알레르기 활성을 갖는 것으로 공지된 임의의 화합물이나 천연 추출물을 추가로 포함할 수 있다. 이때, 상기 융합단백질 이량체 및 항알레르기 활성을 갖는 화합물 또는 천연 추출물은 동시 또는 순차적으로 투여할 수 있다.
본 발명의 또 다른 측면으로, 상기 융합단백질 이량체를 포함하는 알레르기성 증상의 개선 또는 완화용 사료 조성물을 제공한다.
이때, 상기 융합단백질 이량체는 장내로 효율적인 전달을 위해 적절한 전달 수단과 결합될 수 있다. 또한, 본 발명의 사료 조성물은 어떠한 형태의 사료로도 제조될 수 있다.
상기 사료 조성물에는 알레르기 증상의 개선 또는 완화 효과에 방해가 되지 않는 다른 성분을 추가할 수 있으며, 그 종류는 특별히 제한되지 않는다. 예를 들어, 통상의 사료와 같이 여러 가지 생약 추출물, 사료에 허용가능한 사료보조첨가제 또는 천연 탄수화물 등을 추가 성분으로서 함유할 수 있다.
상기 사료보조첨가제는 각 제형의 사료 조성물을 제조하는데 첨가되는 것으로서 당업자가 적절히 선택하여 사용할 수 있다. 예를 들어, 여러 가지 영양제, 비타민, 광물(전해질), 합성 풍미제 및 천연 풍미제 등의 풍미제, 착색제 및 충진제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알코올, 탄산음료에 사용되는 탄산화제 등이 포함되지만, 상기 예들에 의해 그 종류가 제한되는 것은 아니다.
본 발명의 또 다른 측면으로, 상기 융합단백질 이량체를 개에 투여하는 단계를 포함하는 개 알레르기성 질환의 치료 또는 예방 방법을 제공한다. 여기서 융합단백질 이량체, 투여, 알레르기성 질환, 치료 및 예방은 상술한 바와 동일하다.
본 발명의 또 다른 측면은, 개의 알레르기성 질환의 치료 또는 예방용 약제를 제조하기 위한 상기 융합단백질 이량체의 용도를 제공한다. 여기서 융합단백질 이량체, 알레르기성 질환, 치료 및 예방은 상술한 바와 동일하다.
본 발명의 또 다른 측면은, 개의 알레르기성 질환을 치료하거나 예방하기 위한 상기 융합단백질 이량체의 용도를 제공한다. 여기서 융합단백질 이량체, 알레르기성 질환, 치료 및 예방은 상술한 바와 동일하다.
이하, 본 발명을 하기 실시예에 의하여 더욱 상세하게 설명한다. 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐, 본 발명의 범위가 이들만으로 한정되는 것은 아니다.
제조예 1. 인간 FcεRIα-ECD와 변형된 개 Fc 영역을 포함하는 융합단백질의 제조: hFcεRIα ECD-cFc(GI-301cA1)
인간 FcεRIα-ECD(FcεRIα ECD; Extracellular domain) 및 변형된 개 Fc 영역을 포함하는 융합단백질을 생산하기 위하여, 시그널 펩타이드(서열번호 1) 인간 FcεRI의 α사슬의 세포외 도메인(서열번호 2), 힌지 링커(서열번호 4) 및 변형된 개 Fc 영역(서열번호 5)을 N-말단으로부터 이 순서대로 포함하는 융합단백질을 코딩하는 염기서열을 포함하는 폴리뉴클레오티드를 합성하여 pcDNA3.4 벡터에 적재하였다.
그 후, 상기 발현 벡터를 ExpiCHO-S(ThermoFisher) 세포에 도입하여 융합단백질을 발현시켰다. 벡터를 도입한 후 37℃, 125 RPM, CO2 8%의 농도인 환경에서 7일 배양 후 배양액을 수거하였다. 상기 배양된 배양액을 Protein-A affinity column을 이용하여 정제한 후, 정제된 단백질을 SDS-PAGE, Western blot 및 크기-배제(Size-Exclusion) HPLC(SE-HPLC)를 수행하여 단백질의 순도를 확인하였다. 표 5에 나타난 바와 같이, SE-HPLC 방법으로 정제된 단백질의 순도는 80% 이상인 것을 확인하였다.
hFcεRIα ECD-cFc 융합단백질의 100 ㎖ 단기생산성은 BSA를 기준으로 Bradford assay를 통하여 확인한 결과, 5.67 mg으로 나타났다.
Expression
Vector		 Media Culture Scale Productivity
(Bradford with BSA)		 Purity
(SEC-HPLC)
pcDNA3.4 ExpiCHOTM
Expression Medium		 100 ㎖ 5.67 mg 84.78%
또한, SDS-PAGE 및 Western blot 분석결과, 환원 조건 및 비환원 조건에서 각각 약 66 kDa, 116 kDa 근처 크기의 단백질이 검출되는 것으로 확인되었으며(도 2, Lane 1 내지 2), 이를 통해 cFc와 결합된 hFcεRIα ECD가 이량체를 형성하고 있음을 알 수 있었다.
제조예 2. 개 FcεRIα-ECD와 변형된 개 Fc 영역을 포함하는 융합단백질의 제조: cFcεRIα ECD-cFc(GI-301cB1)
개 FcεRIα-ECD 및 변형된 개 Fc 영역을 포함하는 융합단백질을 생산하기 위하여 시그널 펩타이드(서열번호 1), 개 FcεRI의 α사슬의 세포외 도메인(서열번호 3), 힌지 링커(서열번호 4) 및 변형된 개 Fc 영역(서열번호 5)을 N-말단으로부터 이 순서대로 포함하는 융합단백질을 코딩하는 염기서열을 포함하는 폴리뉴클레오티드를 합성하여 pcDNA3.4 벡터에 적재하였다.
그 후, 상기 발현 벡터를 ExpiCHO-S(ThermoFisher) 세포에 도입하여 융합단백질을 발현시켰다. 벡터를 도입한 후 37℃, 125 RPM, CO2 8%의 농도인 환경에서 7일 배양 후 배양액을 수거하였다. 상기 배양된 배양액을 Protein-A affinity column을 이용하여 정제한 후, 정제된 단백질을 SDS-PAGE, Western blot 및 크기-배제(Size-Exclusion) HPLC(SE-HPLC)를 수행하여 단백질의 순도를 확인하였다. 표 6에 나타난 바와 같이, SE-HPLC 방법으로 정제된 단백질의 순도는 95% 이상인 것을 확인하였다.
cFcεRIα ECD-cFc 융합단백질의 100 ㎖ 단기생산성은 BSA를 기준으로 Bradford assay를 통하여 확인한 결과, 10.35 mg으로 나타났다.
Expression
Vector		 Media Culture Scale Productivity
(Bradford with BSA)		 Purity
(SEC-HPLC)
pcDNA3.4 ExpiCHOTM
Expression Medium		 100 ㎖ 10.35 mg 95.09%
또한, SDS-PAGE 및 Western blot 분석결과, 환원 조건 및 비환원 조건에서 각각 약 66 kDa, 116 kDa 근처 크기의 단백질이 검출되는 것으로 확인되었으며(도 6, Lane 1 내지 2), 이를 통해 cFc와 결합된 cFcεRIα ECD가 이량체를 형성하고 있음을 알 수 있었다.
실험예 1. hFcεRIα ECD-cFc 및 cFcεRIα ECD-cFc의 개 IgE 결합능 확인
제조예 1 및 제조예 2의 방법을 통해 정제된 단백질에 대하여 개 IgE(Bethyl Laboratories) 결합능을 측정하였다. 개 IgE 결합능은 Octet RED 384(ForteBio, octet 384 Red)을 통하여 실험을 진행하였다. AR2G(Amine Reactive 2nd generation) biosensors를 10분간 1X kinetic buffer에 침지시켜 사용하였다. hFcεRIα ECD-hFc, hFcεRIα ECD-cFc 및 cFcεRIα ECD-cFc 단백질을 10 mM acetate pH 5.0 buffer를 이용하여 10 ㎍/㎖로 만들어 biosensor에 코팅하고, 개 IgE를 1.6 nM 내지 100 nM로 희석시켜 각각의 농도에서 결합능을 확인하였다. hFcεRIα ECD-hFc, hFcεRIα ECD-cFc 및 cFcεRIα ECD-cFc와 개 IgE의 결합력은 도 9, 도 10, 도 11 및 표 7에 나타냈다.
구분 Kon(1/Ms) Kdis(1/S) Binding affinity
hFcεRIα ECD-hFc(GI-301) 2.10E+05 1.49E-04 0.7 nM
hFcεRIα ECD-cFc(GI-301cA1) 2.29E+05 1.65E-04 0.7 nM
cFcεRIα ECD-cFc(GI-301cB1) 6.82E+04 7.12E-04 10.5 nM
실험예 2. Caninized GI-301 free IgE 억제능 확인
hFcεRIα ECD-hFc, hFcεRIα ECD-cFc 및 cFcεRIα ECD-cFc의 free IgE 억제능을 측정하기 위하여 6.1~24.7 ㎍/㎖ free IgE가 포함된 개 혈청을 다양한 농도(0.001, 0.01, 0.1, 1 및 10 ㎍/㎖)의 시험물질과 반응시키고 ELISA를 통해 free IgE의 양을 측정하였다.
1X PBS에 GI-301을 1 ㎍/㎖의 농도로 immunoplate(Nunc)에 웰(well)당 100 ㎕ 첨가하고 4℃조건에서 16시간 동안 반응시켰다. 반응이 끝난 immunoplate는 1X PBST를 이용하여 웰(well)당 300 ㎕씩 5번 세척하고 Blocking solution인 I-Block를 웰당 200 ㎕ 첨가하여 1시간 동안 반응시켰다. Blocking 도중 standard와 분석용 샘플을 준비하였다. Standard는 개 IgE 단백질을 3.13~200 ng/㎖의 농도로 1% BSA/PBS에 희석하였다.
분석용 샘플은 free IgE를 포함하고 있는 개 혈청에 다양한 농도의 시험물질을 첨가하여 37℃조건에서 1시간 동안 반응시켜 준비하였다. Blocking이 끝난 plate를 1X PBST를 이용하여 웰당 300 ㎕씩 5번 세척하고 준비된 standard와 분석용 샘플을 웰당 100 ㎕ 첨가 후 상온에서 1시간 반응시켰다. 이후 1X PBST를 이용하여 웰당 300 ㎕씩 5번 세척하고 1:10,000으로 희석된 goat anti-canine IgE secondary antibody-HRP를 웰당 100 ㎕씩 첨가하고 상온에서 1시간 반응시켰다.
반응이 끝난 plate는 1X PBST를 이용하여 웰당 300 ㎕씩 5번 세척하고 TMB solution을 well당 100 ㎕씩 넣고 반응시켰다. Microplate reader를 이용하여 650 nm 파장에서 흡광도값이 0.8 내지 1.0 범위에서 측정되면 stop solution을 웰당 100 ㎕씩 첨가하여 반응을 종결시켰다. 반응이 종결된 plate는 5분 이내에 450 nm 파장에서 흡광도를 측정하고 수치를 분석하였다.
실험 결과는 도 12에 나타냈다. 도 12에 표시한 바와 같이, 인간 FcεRIα ECD를 포함하는 융합단백질인 hFcεRIα ECD-hFc 및 hFcεRIα ECD-cFc가 free IgE 억제에 있어서 cFcεRIα ECD-cFc 보다 우수한 효능을 갖는 것으로 나타났다.

Claims (15)

  1. IgE Fc 수용체의 알파 서브유닛의 세포외 도메인(FcεRIα-ECD)을 포함하는 단량체 두 개를 포함하는 융합단백질 이량체로서,
    상기 단량체는 개 유래의 면역글로불린 IgG4 유래의 Fc 영역을 포함하며,
    상기 Fc 영역과 FcεRIα-ECD는 힌지를 통해 결합된 것인, 융합단백질 이량체.
  2. 제1항에 있어서,
    상기 IgE Fc 수용체의 알파 서브유닛은 인간 또는 개에서 유래된 것인, 융합단백질 이량체.
  3. 제2항에 있어서,
    상기 인간 유래의 IgE Fc 수용체의 알파 서브유닛은 서열번호 2의 아미노산 서열을 가지는 것인, 융합단백질 이량체.
  4. 제2항에 있어서,
    상기 개 유래의 IgE Fc 수용체의 알파 서브유닛은 서열번호 3의 아미노산 서열을 가지는 것인, 융합단백질 이량체.
  5. 제1항에 있어서,
    상기 개 유래의 면역글로불린 IgG4 유래의 Fc 영역은 서열번호 5의 아미노산 서열을 가지는 것인, 융합단백질 이량체.
  6. 제1항에 있어서,
    상기 힌지는 서열번호 4의 아미노산 서열을 가지는 것인, 융합단백질 이량체.
  7. IgE Fc 수용체의 알파 서브유닛의 세포외 도메인(FcεRIα-ECD) 및 개 유래의 면역글로불린 IgG4 유래의 Fc 영역을 포함하는 단량체를 코딩하는 폴리뉴클레오티드.
  8. 제7항의 폴리뉴클레오티드가 적재된 발현 벡터.
  9. 제8항의 발현 벡터가 도입된 형질전환 세포.
  10. 제9항의 형질전환 세포를 배양하는 단계; 및
    융합단백질 이량체를 회수하는 단계;를 포함하는 융합단백질 이량체의 생산방법.
  11. 제1항 내지 제6항 중 어느 한 항에 따른 융합단백질 이량체를 포함하는 개 알레르기성 질환의 치료 또는 예방용 약학적 조성물.
  12. 제11항에 있어서,
    상기 알레르기성 질환은 식품 알레르기, 아토피 피부염(atopic dermatitis), 천식(asthma), 알레르기성 비염(allergic rhinitis), 알레르기성 결막염(allergic conjunctivitis), 알레르기성 피부염(allergic dermatitis), 만성 특발성 두드러기(Chronic idiopathic urticarial) 및 알레르기성 접촉성 피부염(allergic contact dermatitis)으로 구성된 군에서 선택된 하나인 것인, 약학적 조성물.
  13. 제1항 내지 제6항 중 어느 한 항에 따른 융합단백질 이량체를 포함하는 알레르기성 증상의 개선 또는 완화용 사료조성물.
  14. 제1항 내지 제6항 중 어느 한 항에 따른 융합단백질 이량체를 개에 투여하는 단계를 포함하는 개 알레르기성 질환의 치료 또는 예방 방법.
  15. 개 알레르기성 질환의 치료 또는 예방을 위한 제1항 내지 제6항 중 어느 한 항에 따른 융합단백질 이량체의 용도.
PCT/KR2021/009425 2020-07-22 2021-07-21 ＩｇＥ Ｆｃ 수용체를 포함하는 융합단백질 및 이를 포함하는 개 알레르기성 질환 치료 용도 WO2022019652A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020200090789A KR20220011931A (ko) 2020-07-22 2020-07-22 IgE Fc 수용체를 포함하는 융합단백질 및 이를 포함하는 개 알레르기성 질환 치료 용도
KR10-2020-0090789 2020-07-22

Publications (1)

Publication Number Publication Date
WO2022019652A1 true WO2022019652A1 (ko) 2022-01-27

Family

ID=79729906

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/009425 WO2022019652A1 (ko) 2020-07-22 2021-07-21 ＩｇＥ Ｆｃ 수용체를 포함하는 융합단백질 및 이를 포함하는 개 알레르기성 질환 치료 용도

Country Status (2)

Country Link
KR (1) KR20220011931A (ko)
WO (1) WO2022019652A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3333188A1 (en) * 2010-08-19 2018-06-13 Zoetis Belgium S.A. Anti-ngf antibodies and their use
KR20190084885A (ko) * 2018-01-08 2019-07-17 주식회사 프로젠 IgE Fc 수용체의 알파 서브유닛의 세포외 도메인, 이를 포함하는 약학적 조성물 및 이의 제조방법
KR102038679B1 (ko) * 2018-01-12 2019-10-30 (주)지아이이노베이션 프로바이오틱스 및 IgE에 결합능이 있는 폴리펩티드를 포함하는 조성물 및 이의 용도

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3333188A1 (en) * 2010-08-19 2018-06-13 Zoetis Belgium S.A. Anti-ngf antibodies and their use
KR20190084885A (ko) * 2018-01-08 2019-07-17 주식회사 프로젠 IgE Fc 수용체의 알파 서브유닛의 세포외 도메인, 이를 포함하는 약학적 조성물 및 이의 제조방법
KR102038679B1 (ko) * 2018-01-12 2019-10-30 (주)지아이이노베이션 프로바이오틱스 및 IgE에 결합능이 있는 폴리펩티드를 포함하는 조성물 및 이의 용도

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
COLOPY LYDIA J., KAI-BIU SHIU, LAURA A SNYDER, ANNE C AVERY, EMILY D ROUT, A R MOORE : "Immunoglobulin G4-related disease in a dog", JOURNAL OF VETERINARY INTERNAL MEDICINE, vol. 33, no. 6, 26 October 2019 (2019-10-26), pages 2732 - 2738, XP055889057, DOI: 10.1111/jvim.15624 *
DATABASE PROTEIN 23 March 2015 (2015-03-23), ANONYMOUS : "Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [Homo sapiens]", XP055889047, retrieved from NCBI Database accession no. EAW52789 *
LAUBER BEATRICE, VIVIANNE MOLITOR, SABRINA MEURY, MARCUS G DOHERR, CLAUDE FAVROT, KATARINA TENGVALL, KERSTIN BERGVALL, TOSSO LEEB,: "Total IgE and allergen-specific IgE and IgG antibody levels in sera of atopic dermatitis affected and non-affected Labrador- and Golden retrievers", VETERINARY IMMUNOLOGY AND IMMUNOPATHOLOGY, vol. 149, 15 September 2012 (2012-09-15), pages 112 - 118, XP055889052, DOI: 10.1016/j.vetimm.2012.05.018 *
VAN DE VEEN WILLEM; AKDIS MüBECCEL: "Role of IgG4in IgE-mediated allergic responses", JOURNAL OF ALLERGY AND CLINICAL IMMUNOLOGY, ELSEVIER, AMSTERDAM, NL, vol. 138, no. 5, 24 August 2016 (2016-08-24), AMSTERDAM, NL , pages 1434 - 1435, XP029802703, ISSN: 0091-6749, DOI: 10.1016/j.jaci.2016.07.022 *

Also Published As

Publication number Publication date
KR20220011931A (ko) 2022-02-03

Similar Documents

Publication Publication Date Title
KR100453877B1 (ko) 연쇄체화에 의한 면역 글로블린 융합 단백질의 제조 방법 및 이 방법에 의해 제조된 ＴＮＦＲ/Ｆｃ 융합 단백질, 상기 단백질을 코딩하는 ＤＮＡ, 상기 ＤＮＡ를 포함하는벡터, 및 상기 벡터에 의한 형질전환체
JP7488303B2 (ja) ＩｇＥ Ｆｃ受容体のアルファサブユニットの細胞外ドメイン、その物を含む医薬組成物、およびその物を製造する方法
MX2007000155A (es) Inmunoglobulina glucosilada e inmunoadhesina que comprende la misma.
EP0409091A1 (en) Antagonists of GM-CSF derived from the carboxyl terminus
TW202003586A (zh) 生長分化因子15融合蛋白
WO2019225962A1 (ko) 바리셀라 조스터 바이러스의 항원 변이체 및 이의 용도
JP3223260B2 (ja) Ｔ細胞増殖促進因子
WO2022005174A1 (ko) 항-lag-3 항체 및 il-2를 포함하는 융합단백질 및 이의 용도
WO2021154046A1 (ko) pH-감응성 FC 변이체
WO2022019652A1 (ko) ＩｇＥ Ｆｃ 수용체를 포함하는 융합단백질 및 이를 포함하는 개 알레르기성 질환 치료 용도
KR20160113268A (ko) 이기능 융합단백질,이의 제조방법 및 용도
US6800290B2 (en) Variants of allergenic proteins of the group 2 of dermatophagoides
WO2022015049A1 (ko) ＩｇＥ Ｆｃ 수용체 알파서브유닛의 세포외 도메인 및 항-IL-4R 항체를 포함하는 융합단백질 및 이의 용도
JPH02291269A (ja) インターフエロン―ガンマ結合蛋白
WO2022010319A1 (ko) 글루카곤-유사 펩타이드-1 및 인터루킨-1 수용체 길항제를 포함하는 융합단백질 및 이의 용도
WO2021006603A1 (ko) 신규 알러지 질환 치료용 약학적 조성물
KR100688051B1 (ko) 각질세포-유래된 인터페론
HUE035554T2 (en) VEGF antagonist compositions and their uses
AU645054B2 (en) T cell growth factor
CA3169095A1 (en) Designed il-2 variants
WO2023234743A1 (ko) 항-tigit 항체를 포함하는 이중 특이적 항체 및 이의 용도
WO2021006375A1 (ko) Ige fc 수용체의 알파 서브유닛의 세포외 도메인을 포함하는 시알산 함량이 높은 폴리펩티드 이량체 및 이를 포함하는 약학적 조성물
EP4122953A1 (en) Fusion protein comprising il-2 protein and cd80 protein fragment or variant thereof, and uses thereof
WO2021034098A1 (ko) 사람 표피성장인자수용체 2 양성 암을 치료하기 위한 인터페론-베타 또는 이의 변이체를 포함하는 면역사이토카인의 용도
IL281843B1 (en) Transformed human erythropoietin

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21846961

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21846961

Country of ref document: EP

Kind code of ref document: A1