WO2022009121A1 - Sars-cov-2 and influenza combination vaccine - Google Patents

Sars-cov-2 and influenza combination vaccine Download PDF

Info

Publication number
WO2022009121A1
WO2022009121A1 PCT/IB2021/056102 IB2021056102W WO2022009121A1 WO 2022009121 A1 WO2022009121 A1 WO 2022009121A1 IB 2021056102 W IB2021056102 W IB 2021056102W WO 2022009121 A1 WO2022009121 A1 WO 2022009121A1
Authority
WO
WIPO (PCT)
Prior art keywords
cov
influenza
sars
vaccine
covid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2021/056102
Other languages
English (en)
French (fr)
Inventor
Agata Fazio
Emanuele MONTOMOLI
Kaspar BANZIGER
Carlos QUINTO
Reinhard Gluck
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Spicona Inc
Original Assignee
Spicona Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MX2023000411A priority Critical patent/MX2023000411A/es
Priority to US18/015,025 priority patent/US20230256085A1/en
Priority to JP2023501632A priority patent/JP2023533772A/ja
Priority to KR1020237003756A priority patent/KR20230049084A/ko
Priority to BR112023000323A priority patent/BR112023000323A2/pt
Priority to EP21740222.1A priority patent/EP4178612A1/en
Priority to CA3184878A priority patent/CA3184878A1/en
Priority to AU2021303789A priority patent/AU2021303789A1/en
Application filed by Spicona Inc filed Critical Spicona Inc
Priority to CN202180054553.3A priority patent/CN117957016A/zh
Priority to IL299735A priority patent/IL299735A/en
Publication of WO2022009121A1 publication Critical patent/WO2022009121A1/en
Anticipated expiration legal-status Critical
Priority to CONC2023/0001072A priority patent/CO2023001072A2/es
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/145Orthomyxoviridae, e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/215Coronaviridae, e.g. avian infectious bronchitis virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/29Hepatitis virus
    • A61K39/292Serum hepatitis virus, hepatitis B virus, e.g. Australia antigen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/08RNA viruses
    • C07K14/165Coronaviridae, e.g. avian infectious bronchitis virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5252Virus inactivated (killed)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5256Virus expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55572Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16211Influenzavirus B, i.e. influenza B virus
    • C12N2760/16234Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/20011Coronaviridae
    • C12N2770/20034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to combination vaccines against both influenza and COVID-19.
  • the invention relates to combination vaccines comprising one or more influenza virus antigen and one or more SARS-CoV-2 antigen, preferably at least one SARS-CoV-2(Coronavirus 2019- nCoV) spike protein antigen, as well as vaccines comprising polynucleotides encoding said antigens, and such vaccines for the treatment or prevention of COVID-19 (SARS-CoV-2 infection) and influenza infection.
  • COVID-19 the disease caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2, or Coronavirus 2019-nCoV) worldwide.
  • SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
  • Coronavirus 2019-nCoV Coronavirus 2019-nCoV
  • SARS-CoV-2 The majority of patients infected with SARS-CoV-2 experience mild to moderate symptoms include a high temperature or fever, a cough, shortness of breath, fatigue, and a loss or change to an individual's sense of smell or taste. Some patients progress to severe disease, which may involve acute respiratory distress syndrome (ARDS), cytokine storm, multi-organ failure, septic shock, and blood clots. In addition, some patients who test positive for SARS-CoV-2 infection are asymptomatic, or experience minimal symptoms, making diagnosis difficult unless a test is carried out. The evidence to-date indicates that these asymptomatic patients shed SARS-CoV-2 viral particles (often for longer than patients with symptomatic infection), and so can still efficiently spread the SARS- CoV-2 virus.
  • ARDS acute respiratory distress syndrome
  • cytokine storm cytokine storm
  • multi-organ failure multi-organ failure
  • septic shock septic shock
  • These combined vaccines comprise one or more influenza virus antigen and one or more SARS-CoV-2 antigen, preferably at least one SARS-CoV-2(Coronavirus 2019- nCoV) spike protein antigen, or one or more polynucleotide encoding said antigens, allowing for annual boosting of immunity against SARS-CoV-2 using existing public health programs already in place for influenza virus.
  • SARS-CoV-2 antigen preferably at least one SARS-CoV-2(Coronavirus 2019- nCoV) spike protein antigen, or one or more polynucleotide encoding said antigens
  • the present inventors have previously developed polynucleotides encoding the SARS-CoV-2 spike protein, said polynucleotides providing increased level and duration of expression of the SARS- CoV-2 spike protein, whilst retaining the conformation of the native spike protein.
  • the present inventors have now demonstrated that vaccine compositions comprising their SARS-CoV-2 spike protein can be successfully combined with influenza virus vaccines, with none of the expected problems of vaccine component suppression which are common in the production of combination vaccine products.
  • the adjuvant Addavax® can be successfully incorporated into a SARS-CoV-2/influenza vaccine according to the present invention.
  • the present invention provides a combined influenza-COVID-19 vaccine comprising: (a) an influenza haemagglutinin (HA) or an immunogenic fragment thereof; and (b) one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof; wherein the antigens are capable of eliciting immune response and protection against both influenza and COVID- 19.
  • Said combined influenza-COVID-19 vaccine may further comprise an influenza neuraminidase (NA) or an immunogenic fragment thereof.
  • the influenza HA or immunogenic fragment thereof may be: (i) comprised in an inactivated influenza virion; (ii) a recombinant HA or immunogenic fragment thereof; (iii) a fusion protein comprising HA or an immunogenic fragment thereof; or (iv) encoded by an RNA or DNA vaccine.
  • the influenza NA or immunogenic fragment thereof may be: (i) comprised in an inactivated influenza virion; (ii) a recombinant NA or immunogenic fragment thereof; (iii) a fusion protein comprising NA or an immunogenic fragment thereof; or (iv) encoded by an RNA or DNA vaccine.
  • the one or more antigen derived from SARS- CoV-2 or an immunogenic fragment thereof may be: (i) at least one recombinant SARS-CoV-2 spike protein or immunogenic fragment thereof; (ii) at least one fusion protein comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; (iii) at least one virus-like particle (VLP) comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; (iv) at least one polynucleotide encoding a recombinant SARS-CoV-2 spike protein or immunogenic fragment thereof; or (v) encoded by at least one RNA or DNA vaccine.
  • VLP virus-like particle
  • influenza HA or immunogenic fragment thereof and the influenza NA or immunogenic fragment thereof may be comprised in an inactivated influenza virion; and (ii) the one or more antigen derived from SARS- CoV-2 or an immunogenic fragment thereof may be: (i) at least one fusion protein comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof or (ii) at least one virus-like particle (VLP) comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof.
  • VLP virus-like particle
  • influenza-COVID-19 vaccine of the invention (a) the influenza HA or immunogenic fragment thereof may be comprised in a live attenuated influenza virion; (b) the influenza NA or immunogenic fragment thereof may be comprised in a live attenuated influenza virion; and/or (c) the one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof may be comprised in a live viral vector.
  • Said live viral vector comprising the one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof may be: an adenoviral vector; a measles virus vector; a mumps virus vector; a rubella virus vector; a varicella virus vector; a polio virus vector; or a yellow fever virus vector.
  • a combined influenza-COVID-19 vaccine of the invention may, further comprising an adjuvant.
  • Said adjuvant is typically stimulator of cellular (Th1) and/or humoral (Th2) immune responses, preferably both.
  • Said adjuvant may comprise a squalene oil-in-water emulsion, an aluminium salt or a monophosphoryl Lipid A (MPL).
  • the one or more antigen derived from SARS-CoV-2 may be selected from: (a) a spike protein from SARS-CoV-2 having at least 90% identity with SEQ ID NO: 1, or a fragment thereof that has a common antigenic cross-reactivity with said spike protein; (b) a fusion protein comprising a spike protein from SARS-CoV-2 having at least 90% identity with SEQ ID NO: 1, or a fragment thereof that has a common antigenic cross-reactivity with said spike protein; (c) a VLP comprising a spike protein from SARS-CoV-2 having at least 90% identity with SEQ ID NO: 1, or a fragment thereof that has a common antigenic cross-reactivity with said spike protein; (d) a polynucleotide encoding a spike protein from SARS-CoV-2 having at least 90% identity with SEQ ID NO: 1, or a fragment thereof that has a common antigenic cross-reactivity with said spike protein; or (e) a viral vector, RNA vaccine or DNA plasmid that expresse
  • the one or more antigen derived from SARS-CoV-2 may be a fusion protein comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof and further comprising: (a) the Hepatitis B surface antigen, or a fragment thereof that has a common antigenic cross-reactivity with said Hepatitis B surface antigen; (b) the HPV 18 L1 protein, or a fragment thereof that has a common antigenic cross-reactivity with said HPV 18 L1 protein; (c) the Hepatitis E P239 protein, or a fragment thereof that has a common antigenic cross-reactivity with said Hepatitis E P239 protein; and/or (e) the HPV 16 L1 protein, or a fragment thereof that has a common antigenic cross-reactivity with said HPV 16 L1 protein.
  • Said fusion protein may: (a) be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 90% identity with any one of SEQ ID NO: 3, 5, 6 or 8, 26, 27, 29, 30 or 32; and/or (b) comprise or consists of an amino acid sequence having at least 90% identity with any one of SEQ ID NO: 9, 10, 11,12, 28, 31 or 33.
  • the one or more antigen derived from SARS-CoV-2 may be a VLP comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof, wherein said VLP comprises or consists of a fusion protein of the invention.
  • influenza HA or immunogenic fragment thereof and the influenza NA or immunogenic fragment thereof may be comprised in: (a) a seasonal influenza vaccine, in particular the seasonal 3- valent influenza vaccine or the seasonal 4-valent influenza vaccine; (b) a monovalent pandemic influenza vaccine; or (c) a universal influenza vaccine.
  • the invention also provides combined influenza-COVID-19 vaccine as described herein for use in a method of treatment and/or prevention of COVID-19 and influenza.
  • the invention further provides the use of an influenza HA or an immunogenic fragment thereof; and an antigen derived from SARS-CoV-2 or an immunogenic fragment thereof, and optionally an influenza NA or an immunogenic fragment thereof in the manufacture of a medicament for use in the treatment and/or prevention of COVID-19 and influenza, wherein said medicament is a combined influenza-COVID-19 vaccine as defined herein.
  • the invention further provides a method of immunising a subject against both influenza and COVID-19 comprising administering to said subject a therapeutically effective amount of a combined influenza-COVID-19 vaccine as defined herein.
  • the combined influenza-COVID-19 vaccine may be administered at intervals of 10 to 14 months, optionally wherein the combined influenza-COVID-19 vaccine is administered at intervals of about 12 months.
  • FIGURES Figure 1: Schematic of the coronavirus’s structure and the function of the structural proteins.
  • Figure 2 SDS Page (left) and Western Blot (centre and right) of HBSAg-(EAAAK) 3 -CoV-S using rabbit- anti CoV-S (1:250, centre) and mouse anti-HBSAg-(EAAAK) 3 -RBD (1:1000, right)
  • Figure 3 Graph showing anti-HBSAg-(EAAAK)3-CoV-S IgG titre quantified by ELISA assay on mice sera immunized with HBSAg-(EAAAK)3-CoV-S protein alone and in combination with influenza vaccine VAXIGRIP, formulated with two different adjuvants: Alu-280 and Addavax 14 days after immunization.
  • Figure 4 A Graph showing anti-HBSAg-(EAAAK) 3 -RBD IgG titre quantified by ELISA assay on mice sera immunized with HBSAg-(EAAAK) 3 -RBD, formulated with two different adjuvants: Alu-280 and Addavax 14 days after immunization.
  • Figure 5 Graph showing anti-HBSAg-(EAAAK)3-CoV-S IgG titre quantified by ELISA assay on mice sera immunized with HBSAg-(EAAAK) 3 -CoV-S protein alone and in combination with influenza vaccine VAXIGRIP, formulated with two different adjuvants: Alu-280 and Addavax 42 days after immunization.
  • Figure 6 A Graph showing anti-HBSAg-(EAAAK)3-RBD IgG titre quantified by ELISA assay on mice sera immunized with HBSAg-(EAAAK)3-RBD, formulated with two different adjuvants: Alu-280 and Addavax 42 days after immunization.
  • any nucleic acid sequences are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
  • the headings provided herein are not limitations of the various aspects or embodiments of this disclosure.
  • the term “capable of' when used with a verb encompasses or means the action of the corresponding verb.
  • “capable of interacting” also means interacting
  • “capable of cleaving” also means cleaves
  • “capable of binding” also means binds and "capable of specifically targeting" also means specifically targets.
  • Other definitions of terms may appear throughout the specification.
  • “About” may generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values. Preferably, the term “about” shall be understood herein as plus or minus ( ⁇ ) 5%, preferably ⁇ 4%, ⁇ 3%, ⁇ 2%, ⁇ 1%, ⁇ 0.5%, ⁇ 0.1%, of the numerical value of the number with which it is being used.
  • compositions, methods, and respective component(s) thereof that are essential to the method or composition, yet open to the inclusion of unspecified elements, whether essential or not.
  • consisting of'' refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the invention.
  • consisting essentially of'' refers to those elements required for a given invention. The term permits the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that invention.
  • Embodiments described herein as “comprising” one or more features may also be considered as disclosure of the corresponding embodiments “consisting of” and/or “consisting essentially of” such features.
  • pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government, or listed in the U.S. Pharmacopeia, European Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. Concentrations, amounts, volumes, percentages and other numerical values may be presented herein in a range format.
  • the further peptide sequence should preferably not interfere with the basic folding and thus conformational structure of the original protein.
  • Two or more peptides may be joined together to form a derivative.
  • a peptide may be joined to an unrelated molecule (e.g. a second, unrelated peptide).
  • Derivatives may be chemically synthesized, but will be typically prepared by recombinant nucleic acid methods. Additional components such as lipid, and/or polysaccharide, and/or polypeptide components may be included.
  • protein and “polypeptide” are used interchangeably herein to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha-amino and carboxyl groups of adjacent residues.
  • protein and “polypeptide” refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogues, regardless of its size or function.
  • modified amino acids e.g., phosphorylated, glycated, glycosylated, etc.
  • amino acid analogues regardless of its size or function.
  • protein and “polypeptide” are used interchangeably herein when referring to a gene product and fragments thereof.
  • exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.
  • Proteins of the invention may include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or non-conserved positions.
  • Variants of protein molecules disclosed herein may be produced and used in the present invention.
  • proteins can be derived from empirical and theoretical models (for example, analysis of likely contact residues or calculated physicochemical property) of protein sequence, functional and three-dimensional structures and these properties can be considered individually and in combination.
  • Amino acids are referred to herein using the name of the amino acid, the three-letter abbreviation or the single letter abbreviation.
  • the term “protein”, as used herein, includes proteins, polypeptides, and peptides.
  • amino acid sequence is synonymous with the term “polypeptide” and/or the term “protein”.
  • amino acid sequence is synonymous with the term “peptide”.
  • the terms "protein” and "polypeptide” are used interchangeably herein.
  • the conventional one-letter and three- letter codes for amino acid residues may be used.
  • the 3-letter code for amino acids as defined in conformity with the IUPACIUB Joint Commission on Biochemical Nomenclature (JCBN). It is also understood that a polypeptide may be coded for by more than one nucleotide sequence due to the degeneracy of the genetic code. Amino acid residues at non-conserved positions may be substituted with conservative or non-conservative residues. In particular, conservative amino acid replacements are contemplated.
  • a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, or histidine), acidic side chains (e.g., aspartic acid or glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, or cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, or tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, or histidine).
  • basic side chains e.g., lysine, arginine, or histidine
  • acidic side chains e.g.
  • amino acid substitution is considered to be conservative.
  • the inclusion of conservatively modified variants in an antibody of the invention does not exclude other forms of variant, for example polymorphic variants, interspecies homologs, and alleles.
  • Non-conservative amino acid substitutions include those in which (i) a residue having an electropositive side chain (e.g., Arg, His or Lys) is substituted for, or by, an electronegative residue (e.g., Glu or Asp), (ii) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, Ile, Phe or Val), (iii) a cysteine or proline is substituted for, or by, any other residue, or (iv) a residue having a bulky hydrophobic or aromatic side chain (e.g., Val, His, Ile or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala or Ser) or no side chain (e.g., Gly).
  • an electropositive side chain e.g., Arg, His or Lys
  • an electronegative residue e.g., Glu or As
  • SARS-CoV-2 polynucleotides and/or proteins in the present specification embraces fragments and variants thereof.
  • fragment in the context of a SARS-CoV-2 spike protein refers to a part of the protein which may comprise one or more domain or part-domain of the full-length SARS- CoV-2 spike protein.
  • a SARS-CoV-2 spike protein fragment according to the invention may typically be an immunogenic fragment as described herein.
  • a fragment of a SARS-CoV-2 spike protein is typically greater than 200 amino acids in length.
  • SARS-CoV-2 spike protein fragments of the present invention may comprise or consist of at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or more amino acid residues in length.
  • the fragments of the invention typically have a common antigenic cross-reactivity with the SARS-CoV-2 spike protein (and so are referred to as immunogenic fragments).
  • a SARS-CoV-2 spike protein fragment may comprise or consist of (i) a receptor-binding domain (RBD) of a SARS-CoV-2 spike protein; (ii) an N-terminal domain (NTD) of a SARS-CoV-2 spike protein; (iii) a C-terminal domain (CTD) of a SARS-CoV-2 spike protein, such as CTD1 and/or CTD2, these CTD are also known as subdomains (SD), with CTD1 also being known as SD1 and CTD2 also being known as SD2; and/or (iv) a fusion peptide (FP); and/or (v) FPPR domain; or any combination thereof.
  • a fragment of a SARS-CoV-2 spike protein according to the invention may comprise or consist of an RBD domain.
  • a fragment of a SARS-CoV-2 spike protein according to the invention may consist of an RBD domain, or may comprise an RBD domain in combination with an NTD domain.
  • Variant SARS-CoV-2 spike proteins retain one or more conformational epitope of native spike protein and the ability to elicit the production of neutralising antibodies and/or an immunoprotective response.
  • Variant SARS-CoV-2 spike protein polynucleotides of the invention encode such spike proteins.
  • a variant may have at least 80%, preferably at least 90%, more preferably at least 95%, and most preferably at least 97% or at least 99% amino acid sequence homology with the reference sequence (e.g. a SARS-CoV-2 polynucleotide and/or protein of the invention, particularly any SEQ ID NO presented in the present specification which defines a SARS-CoV-2 polynucleotide and/or protein).
  • a variant may include one or more analogues of a polynucleotide (e.g. an unnatural nucleic acid), or a substituted linkage.
  • fragment when used in relation to a SARS-CoV-2 polynucleotide and/or protein, means a polynucleotide having at least ten, preferably at least fifteen, more preferably at least twenty nucleic acid residues of the reference SARS-CoV-2 polynucleotide and/or protein.
  • the term fragment also relates to the above-mentioned variants.
  • a fragment of a SARS-CoV-2 polynucleotide and/or protein of the present invention may comprise a nucleic acid sequence having at least 10, 20 or 30 nucleic acids, wherein the polynucleotide sequence has at least 80% sequence homology over a corresponding nucleic acid sequence (of contiguous) nucleic acids of the reference SARS-CoV-2 polynucleotide and/or protein sequence.
  • fragments and variants also apply to other polynucleotides of the invention.
  • fragment means a peptide having at least ten, preferably at least fifteen, more preferably at least twenty amino acid residues of the reference protein.
  • a fragment also relates to the above- mentioned variants.
  • a fragment may comprise an amino acid sequence having at least 10, 20 or 30 amino acids, wherein the amino acid sequence has at least 80% sequence homology over a corresponding amino acid sequence (of contiguous) amino acids of the reference sequence.
  • the variant is a conservative substitution variant.
  • a "variant,” as referred to herein, is a polypeptide substantially homologous to a native or reference polypeptide, but which has an amino acid sequence different from that of the native or reference polypeptide because of one or a plurality of deletions, insertions or substitutions.
  • Polypeptide-encoding DNA sequences encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to a native or reference DNA sequence, but that encode a variant protein or fragment thereof that retains the relevant biological activity relative to the reference protein, e.g., at least 50% of the wildtype reference protein.
  • amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage, (i.e.5% or fewer, e.g.4% or fewer, or 3% or fewer, or 1% or fewer) of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid.
  • a polypeptide as described herein may comprise at least one peptide bond replacement.
  • a single peptide bond or multiple peptide bonds e.g.2 bonds, 3 bonds, 4 bonds, 5 bonds, or 6 or more bonds, or all the peptide bonds can be replaced.
  • An isolated peptide as described herein can comprise one type of peptide bond replacement or multiple types of peptide bond replacements, e.g.2 types, 3 types, 4 types, 5 types, or more types of peptide bond replacements.
  • Non-limiting examples of peptide bond replacements include urea, thiourea, carbamate, sulfonyl urea, trifluoroethylamine, ortho-(aminoalkyl)-phenylacetic acid, para-(aminoalkyl)-phenylacetic acid, meta-(aminoalkyl)-phenylacetic acid, thioamide, tetrazole, boronic ester, olefinic group, and derivatives thereof.
  • a polypeptide as described herein may comprise naturally occurring amino acids commonly found in polypeptides and/or proteins produced by living organisms, e.g.
  • a polypeptide as described herein may comprise alternative amino acids.
  • Non-limiting examples of alternative amino acids include D amino acids, beta-amino acids, homocysteine, phosphoserine, phosphothreonine, phosphotyrosine, hydroxyproline, gamma- carboxyglutamate; hippuric acid, octahydroindole-2-carboxylic acid, statine, 1,2,3,4,- tetrahydroisoquinoline-3-carboxylic acid, penicillamine (3-mercapto-D-valine ), ornithine, citruline, alpha-methyl-alanine, para-benzoylphenylalanine, paraaminophenylalanine, p-fluorophenylalanine, phenylglycine, propargylglycine, sarcosine, and tert-butylglycine), diaminobutyric acid, 7-hydroxy- tetrahydroisoquinoline carboxylic acid, naphthylalanine, biphen
  • a polypeptide may be modified, e.g. by addition of a moiety to one or more of the amino acids comprising the peptide.
  • a polypeptide as described herein may comprise one or more moiety molecules, e.g.1 or more moiety molecules per peptide, 2 or more moiety molecules per peptide, 5 or more moiety molecules per peptide, 10 or more moiety molecules per peptide or more moiety molecules per peptide.
  • a polypeptide as described herein may comprise one more types of modifications and/or moieties, e.g. 1 type of modification, 2 types of modifications, 3 types of modifications or more types of modifications.
  • Non-limiting examples of modifications and/or moieties include PEGylation; glycosylation; HESylation; ELPylation; lipidation; acetylation; amidation; end-capping modifications; cyano groups; phosphorylation; albumin, and cyclization.
  • Alterations of the original amino acid sequence can be accomplished by any of a number of techniques known to one of skill in the art. Amino acid substitutions can be introduced, for example, at particular locations by synthesizing oligonucleotides containing a codon change in the nucleotide sequence encoding the amino acid to be changed, flanked by restriction sites permitting ligation to fragments of the original sequence.
  • the resulting reconstructed sequence encodes an analogue having the desired amino acid insertion, substitution, or deletion.
  • oligonucleotide-directed site-specific mutagenesis procedures can be employed to provide an altered nucleotide sequence having particular codons altered according to the substitution, deletion, or insertion required. Techniques for making such alterations include those disclosed by Walder et al. (Gene 42:133, 1986); Bauer et al. (Gene 37:73, 1985); Craik (BioTechniques, January 1985, 12-19); Smith et al. (Genetic Engineering: Principles and Methods, Plenum Press, 1981); and U.S. Pat.
  • nucleic acid refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analogue thereof.
  • the nucleic acid can be either single-stranded or double-stranded.
  • a single-stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA Alternatively, it can be a single-stranded nucleic acid not derived from any double-stranded DNA.
  • the nucleic acid can be DNA
  • the nucleic acid can be RNA Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA. Other suitable nucleic acid molecules are RNA, including mRNA.
  • a typical antibody comprises at least two “light chains” (LC) and two “heavy chains” (HC). The light chains and heavy chains of such antibodies are polypeptides consisting of several domains.
  • Each heavy chain comprises a heavy chain variable region (abbreviated herein as “VH”) and a heavy chain constant region (abbreviated herein as “CH”).
  • the heavy chain constant region comprises the heavy chain constant domains CH1, CH2 and CH3 (antibody classes IgA, IgD, and IgG) and optionally the heavy chain constant domain CH4 (antibody classes IgE and IgM).
  • Each light chain comprises a light chain variable domain (abbreviated herein as “VL”) and a light chain constant domain (abbreviated herein as “CL”).
  • the variable regions VH and VL can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the “constant domains” of the heavy chain and of the light chain are not involved directly in binding of an antibody to a target, but exhibit various effector functions. Binding between an antibody and its target antigen or epitope is mediated by the Complementarity Determining Regions (CDRs).
  • the CDRs are regions of high sequence variability, located within the variable region of the antibody heavy chain and light chain, where they form the antigen-binding site.
  • the CDRs are the main determinants of antigen specificity.
  • the antibody heavy chain and light chain each comprise three CDRs which are arranged non-consecutively.
  • the antibody heavy and light chain CDR3 regions play a particularly important role in the binding specificity/affinity of the antibodies according to the invention and therefore provide a further aspect of the invention.
  • the term “antigen binding fragment” as used herein incudes any naturally-occurring or artificially-constructed configuration of an antigen-binding polypeptide comprising one, two or three light chain CDRs, and/or one, two or three heavy chain CDRs, wherein the polypeptide is capable of binding to the antigen.
  • the sequence of a CDR may be identified by reference to any number system known in the art, for example, the Kabat system (Kabat, E.
  • EU index As set forth in Kabat”, “EU Index”. “EU index of Kabat” or “EU numbering” in the context of the heavy chain refers to the residue numbering system based on the human lgG1 EU antibody of Edelman et al. as set forth in Kabat et al. (1991).
  • the numbering system used for the light chain constant region amino acid sequence is similarly set forth in Kabat et al. (supra.).
  • “numbered according to Kabat” refers to the Kabat numbering system set forth in Kabat et al. (supra.).
  • the terms “decrease”, “reduced”, “reduction”, or “inhibit” are all used herein to mean a decrease by a statistically significant amount.
  • the terms “reduce,” “reduction” or “decrease” or “inhibit” typically means a decrease by at least 10% as compared to a reference level (e.g.
  • the absence of a given treatment can include, for example, a decrease by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99% , or more.
  • “reduction” or “inhibition” does not encompass a complete inhibition or reduction as compared to a reference level.
  • “Complete inhibition” is a 100% inhibition as compared to a reference level.
  • a decrease can be preferably down to a level accepted as within the range of normal for an individual without a given disorder.
  • the terms "increased”, “increase”, “enhance”, or “activate” are all used herein to mean an increase by a statically significant amount.
  • the terms “increased”, “increase”, “enhance”, or “activate” can mean an increase of at least 10% as compared to a reference level, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3-fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, or any increase between 2-fold and 10-fold or greater as compared to a reference level.
  • an "increase” is a statistically significant increase in such level.
  • a "subject” means a human or animal. Usually the animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include chimpanzees, cynomologous monkeys, spider monkeys, and macaques, e.g., Rhesus. Rodents include mice, rats, woodchucks, ferrets, rabbits and hamsters.
  • Domestic and game animals include cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, canine species, e.g., dog, fox, wolf, avian species, e.g., chicken, emu, ostrich, and fish, e.g., trout, catfish and salmon.
  • the subject is a mammal, e.g., a primate, e.g., a human.
  • the terms, "individual,” “patient” and “subject” are used interchangeably herein.
  • the subject is a mammal.
  • the mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, or cow, but is not limited to these examples.
  • a subject is human.
  • a subject can be male or female, adult or juvenile.
  • a subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment or one or more complications related to such a condition, and optionally, have already undergone treatment for a condition as defined herein or the one or more complications related to said condition.
  • a subject can also be one who has not been previously diagnosed as having a condition as defined herein or one or more complications related to said condition.
  • a subject can be one who exhibits one or more risk factors for a condition or one or more complications related to said condition or a subject who does not exhibit risk factors.
  • a "subject in need" of treatment for a particular condition can be a subject having that condition, diagnosed as having that condition, or at risk of developing that condition.
  • References herein to the level of a particular molecule encompass the actual amount of the molecule, such as the mass, molar amount, concentration or molarity of the molecule.
  • references to the level of a particular molecule may refer to the concentration of the molecule.
  • the level of a molecule may be determined in any appropriate physiological compartment. Preferred physiological compartments include plasma, blood and/or serum.
  • the level of a molecule may be determined from any appropriate sample from a patient, e.g. a plasma sample, a blood sample, a serum sample, a tissue sample, a bronchial-alveolar lavage (BAL) sample and/or a CSF sample.
  • samples which may be tested are tissue or fluid samples urine and biopsy samples.
  • the invention may reference the level (e.g. concentration) of a molecule in the plasma and/or BAL of a patient.
  • the level of a molecule/biomarker pre-treatment with a binding member of the invention may be interchangeably referred to as the “baseline”.
  • the level of a molecule after treatment with a vaccine of the invention may be compared with the level of the molecule in the patient pre-treatment with the vaccine.
  • the level of a molecule may be measured directly or indirectly, and may be determined using any appropriate technique. Suitable standard techniques are known in the art, for example Western blotting and enzyme-linked immunosorbent assays (ELISAs).
  • ELISAs enzyme-linked immunosorbent assays
  • SARS-CoV-2 and 2019-nCoV are used interchangeably to refer to the viral pathogen which cases the disease COVID-19.
  • Reference to a SARS-CoV-2 infection refers to the disease COVID-19.
  • COVID-19 vaccine or vaccine against COVID-19
  • SARS-CoV-2 vaccine or vaccine against SARS-CoV-2 vaccine (or vaccine against SARS-CoV-2).
  • the term “vaccine” is used to refer to a composition which induces an immune response.
  • the composition may induce an immune response in a patient to which it is administered.
  • a live attenuated vaccine comprises whole viral particles or virions which are capable of infecting and replicating in host cells, but have been modified in some way so that they do not cause disease.
  • a live vectored vaccine comprises a live viral vector, which is typically a non-pathogenic virus, that has been modified to express one or more antigen from the virus against which an immune response is to be raised.
  • the one or more antigen is a key antigen against which an immune response would be generated if a patient were exposed to the wild-type virus (i.e.
  • the antigen may be a protein antigen, or fragment thereof, or a polysaccharide antigen, or fragment thereof.
  • the antigen may be expressed recombinantly or as a conjugate or fusion protein.
  • An inactivated vaccine comprises whole viral particles or virions which have been killed or inactivated (e.g. by heat or chemical treatment). Inactivated virions are not capable of infecting or replicating in host cells and do not cause disease.
  • a subunit vaccine comprises one or more component of the virus against which an immune response is to be raised.
  • the one or more component is a key antigen against which an immune response would be generated if a patient were exposed to the wild-type virus (i.e. is infected with the disease) or vaccinated with a live attenuated or inactivated vaccine.
  • the component may be a protein antigen, or fragment thereof, or a polysaccharide antigen, or fragment thereof.
  • the component may be expressed recombinantly or as a conjugate or fusion protein.
  • Combination vaccines A common complication when attempting to generate combined vaccine compositions is the phenomenon known as component suppression (also known as antigen composition).
  • Component suppression describes the situation where two or more vaccines or vaccine antigens, typically from different pathogens, are administered at the same time and the immune response elicited by one or more of the vaccines or vaccine antigens is compromised compared with the immune response elicited when the vaccines or vaccine antigens are administered separately.
  • the immune response can be compromised in several ways. For example, the immune response elicited by one or more of the vaccines or vaccine antigens may be reduced compared with the immune response elicited when the vaccines or vaccine antigens are administered separately.
  • Seroconversion and/or seropositivity may also be reduced compared with seroconversion and/or seropositivity when the vaccines or vaccine antigens are administered separately.
  • the phenomenon of component suppression has been observed in relation to vaccines against bacterial pathogens (e.g. for pertussis-diphtheria- tetanus (DTaP) vaccine and Haemophilus influenza b (Hib) vaccine) and for vaccines against viral pathogens (e.g. yellow fever vaccine and measles-mumps-rubella (MMR) vaccine.
  • Component suppression has also been observed when vaccine antigens are administered in the same composition, and even when pre-existing effective vaccine compositions are administered at the same time.
  • the risk of component suppression means it is not possible to predict whether a combination vaccine will be clinically efficacious or not, or even whether two separate vaccine compositions maybe administered together.
  • the risk of component suppression is commonly understood in the field of immunology, and is factored into considerations of vaccine scheduling and assessment of component suppression is a requirement by medical regulatory authorities.
  • the present inventors have demonstrated for the first time that it is possible to administer a vaccine comprising both influenza antigens and an antigen derived from SARS-CoV-2 and achieve good immunogenicity against both influenza and SARS-CoV-2, i.e. that component suppression does not occur in the context of influenza and SARS-CoV-2.
  • the present invention provides a combined influenza-COVID-19 vaccine (also referred to interchangeably herein as a combination influenza-COVID-19 vaccine) comprising: (a) an influenza haemagglutinin (HA) or an immunogenic fragment thereof; and (b) one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof; wherein the antigens are capable of eliciting immune response and protection against both influenza and COVID-19 (as described herein).
  • said combined influenza-COVID-19 vaccine further comprises an influenza neuraminidase (NA) or an immunogenic fragment thereof.
  • NA influenza neuraminidase
  • a combined influenza-COVID-19 vaccine of the invention is not associated with component suppression, or has minimal component suppression for: (i) the influenza HA or an immunogenic fragment thereof; (ii) the one or more antigen derived from SARS- CoV-2 (e.g. a SARS-CoV-2 spike protein) or an immunogenic fragment thereof; (iii) the optional influenza NA or immunogenic fragment thereof; or any combination thereof.
  • a combined influenza-COVID-19 vaccine of the invention is not associated with component suppression, or has minimal component suppression for each of: (i) the influenza HA or an immunogenic fragment thereof; (ii) the one or more antigen derived from SARS-CoV-2 (e.g.
  • the term “not associated with component suppression” means that the immune response to (i) the influenza HA or an immunogenic fragment thereof; (ii) the one or more antigen derived from SARS-CoV-2 (e.g.
  • a SARS-CoV-2 spike protein or an immunogenic fragment thereof
  • the optional influenza NA or an immunogenic fragment thereof or any combination thereof administered as part of a combined influenza-COVID-19 vaccine of the invention elicits essentially the same immune response as is achieved when the (i) the influenza HA or an immunogenic fragment thereof; (ii) the antigen derived from SARS-CoV-2 (e.g. a SARS-CoV-2 spike protein) or an immunogenic fragment thereof; and/or (iii) the optional influenza NA or an immunogenic fragment thereof; is administered separately.
  • the term “has minimal component suppression” means that the immune response to (i) the influenza HA or an immunogenic fragment thereof; (ii) the one or more antigen derived from SARS-CoV-2 (e.g. a SARS-CoV-2 spike protein) or an immunogenic fragment thereof; (iii) the optional influenza NA or an immunogenic fragment thereof; or any combination thereof administered as part of a combined influenza-COVID-19 vaccine of the invention elicits at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more of the immune response as is achieved when the (i) the influenza HA or an immunogenic fragment thereof; (ii) the one or more antigen derived from SARS-CoV-2 (e.g.
  • a SARS-CoV-2 spike protein or an immunogenic fragment thereof; and/or (iii) the optional influenza NA or an immunogenic fragment thereof; is administered separately.
  • Another advantage of the combined influenza-COVID-19 vaccine of the invention is that patient compliance can be increased.
  • the combined influenza-COVID-19 vaccines of the invention allow a patient to receive a single vaccine administration which will provide immunity to both influenza and SARS-CoV-2 infection. Reducing the number of vaccinations required and the number of clinic visits requires will increase vaccine uptake and patient compliance. In addition, many countries have well-established public health procedures and schedules for annual influenza vaccination programs.
  • the combined influenza-COVID-19 vaccines of the invention allow for the coordinated wide-scale vaccination against SARS-CoV-2 infection making use of these existing programs and procedures, which will also facilitate wide-scale vaccination against SARS-CoV-2 infection without the need for new public health programs or infrastructure.
  • some evidence suggests a potential association of climate and seasonality with COVID-19 infection and spread.
  • the invention therefore has the potential to allow for regular (e.g. seasonal or annual) vaccination against COVID-19 as described herein, and hence to mitigate seasonal infection and spread.
  • this can potentially be achieved by facilitating COVID-19 vaccination using the existing public health programs and procedures, particularly those already in place for seasonal influenza vaccination.
  • influenza HA or immunogenic fragment thereof and the optional influenza NA or immunogenic fragment thereof may each be readily selected by a skilled person using routine skill.
  • influenza HA (or immunogenic fragments thereof) and influenza NA (or immunogenic fragments thereof) are described herein.
  • the one or more SARS-CoV-2 antigen or immunogenic fragment thereof may be readily selected by a skilled person using routine skill.
  • Non-limiting examples of SARS-CoV-2 antigens (or immunogenic fragments thereof) are described herein.
  • the one or more SARS-CoV-2 antigen comprises at least one SARS-CoV-2 antigen spike protein or immunogenic fragment thereof, as described herein.
  • influenza HA or immunogenic fragment thereof and/or the optional influenza NA or immunogenic fragment thereof may be comprised in an existing influenza vaccine composition.
  • Said influenza vaccine composition may be combined with one or more SARS-CoV-2 antigen (e.g. at least one SARS-CoV-2 spike protein) or an immunogenic fragment thereof, or an existing COVID-19 vaccine to produce a combined influenza-COVID-19 vaccine according to the invention.
  • the one or more antigen derived from SARS-CoV-2 e.g. at least one SARS-CoV-2 spike protein
  • an immunogenic fragment thereof may be comprised in an existing COVID-19 vaccine composition.
  • Said COVID-19 vaccine composition may be combined with an influenza HA or immunogenic fragment thereof and/or the optional influenza NA or immunogenic fragment thereof, or an existing influenza vaccine to produce a combined influenza-COVID-19 vaccine according to the invention.
  • a live (attenuated or vectored) COVID-19 vaccine is used, a live (attenuated or vectored) influenza vaccine is used.
  • an inactivated or subunit COVID- 19 vaccine is used.
  • a subunit (including fusion protein and VLPs as described herein) COVID-19 vaccine or component is used and an inactivated influenza vaccine is used.
  • influenza HA or immunogenic fragment thereof comprised in a combined influenza-COVID-19 vaccine of the invention may be: (i) comprised in an inactivated influenza virion; (ii) a recombinant HA or immunogenic fragment thereof; (iii) a fusion protein comprising HA or an immunogenic fragment thereof; or (iv) encoded by an RNA or DNA vaccine.
  • influenza HA, immunogenic fragments thereof, and influenza vaccines comprising HA are described herein.
  • influenza NA or immunogenic fragment thereof comprised in a combined influenza-COVID-19 vaccine of the invention may be: (i) comprised in an inactivated influenza virion; (ii) a recombinant NA or immunogenic fragment thereof; (iii) a fusion protein comprising NA or an immunogenic fragment thereof; or (iv) encoded by an RNA or DNA vaccine.
  • influenza NA, immunogenic fragments thereof, and influenza vaccines comprising NA are described herein.
  • the one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof comprised in a combined influenza-COVID-19 vaccine of the invention is preferably: (i) at least one recombinant SARS-CoV-2 spike protein or immunogenic fragment thereof; (ii) at least one fusion protein comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; (iii) at least one virus-like particle (VLP) comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; (iv) at least one polynucleotide encoding a recombinant SARS-CoV-2 spike protein or immunogenic fragment thereof; or (v) encoded by an RNA or DNA vaccine.
  • VLP virus-like particle
  • Non-limiting examples of such SARS- CoV-2 antigens, particularly SARS-CoV-2 spike proteins, and immunogenic fragments thereof, and COVID-19 vaccines are described herein. Any combination of (i) influenza HA, immunogenic fragments thereof, and influenza vaccines comprising HA; (ii) one or more SARS-CoV-2 antigens, particularly SARS-CoV-2 spike proteins, and immunogenic fragments thereof, and COVID-19 vaccines; and optionally (iii) influenza NA, immunogenic fragments thereof, and influenza vaccines comprising NA; may be used in a combined influenza-COVID-19 vaccine according to the present invention, provided that the HA, (optional) NA and SARS-CoV-2 antigens are capable of eliciting immune response and protection against both influenza and COVID-19.
  • the influenza component of a combined influenza-COVID-19 vaccine of the present invention may comprise a live (attenuated or vectored) influenza vaccine, an inactivated influenza vaccine or a subunit influenza vaccine.
  • live attenuated influenza vaccines include: seasonal influenza vaccines, such as seasonal quadrivalent (4-valent) influenza vaccine.
  • a seasonal quadrivalent influenza vaccine e.g. the 2019-2020 season
  • Non-limiting examples of inactivated influenza vaccines include: seasonal influenza vaccines, such as seasonal trivalent (3-valent) influenza vaccine and seasonal quadrivalent (4-valent) influenza vaccine.
  • seasonal trivalent influenza vaccine e.g. the 2019-2020 season
  • a seasonal quadrivalent influenza vaccine e.g.
  • influenza vaccines may be used in the combined influenza-COVID-19 vaccines of the invention include monovalent pandemic influenza vaccines (current pandemic influenza vaccines preapproved by the EMA include live attenuated or inactivated vaccines) and universal influenza vaccine (examples under development include subunit vaccines and two-stage vaccines comprising a priming DNA vaccine and a live vectored vaccine).
  • influenza component of a combined influenza-COVID-19 vaccine of the present invention is a live attenuated or inactivated influenza vaccine.
  • the SARS-CoV-2 component of a combined influenza-COVID-19 vaccine of the present invention may comprise a live (attenuated or vectored) SARS-CoV-2/COVID-19 vaccine, an inactivated SARS-CoV-2/COVID-19 vaccine or a subunit SARS-CoV-2/COVID-19 vaccine.
  • the SARS-CoV-2 component of a combined influenza-COVID-19 vaccine of the present invention is a subunit vaccine comprising a SARS-CoV-2 spike protein or fragment thereof, or a fusion protein or VLP comprising said SARS-CoV-2 spike protein or fragment thereof.
  • a subunit vaccine comprising a SARS-CoV-2 spike protein or fragment thereof, or a fusion protein or VLP comprising said SARS-CoV-2 spike protein or fragment thereof.
  • the SARS-CoV-2 component comprises a live (attenuated or vectored) SARS-CoV-2/COVID-19 vaccine.
  • the SARS-CoV-2 component comprises an inactivated SARS-CoV-2/COVID-19 vaccine.
  • the influenza component of a combined influenza-COVID-19 vaccine of the present invention comprises an inactivated influenza vaccine
  • the SARS-CoV-2 component comprises a subunit SARS-CoV-2/COVID-19 vaccine, or vice versa.
  • the SARS-CoV-2 component comprises a subunit SARS-CoV-2/COVID-19 vaccine.
  • the influenza component of a combined influenza-COVID-19 vaccine of the present invention comprises a subunit influenza vaccine
  • the SARS-CoV-2 component comprises an inactivated SARS-CoV-2/COVID-19 vaccine, or vice versa.
  • influenza component of a combined influenza-COVID-19 vaccine of the present invention comprises a nucleic acid (DNA or RNA, preferably DNA) influenza vaccine
  • the SARS-CoV-2 component comprises a nucleic acid (DNA or RNA, preferably DNA) SARS-CoV-2/COVID- 19 vaccine.
  • the invention provides a combined influenza-COVID-19 vaccine wherein the influenza HA or immunogenic fragment thereof and the influenza NA or immunogenic fragment thereof are comprised in an inactivated influenza virion, and the one or more antigen derived from SARS-CoV-2 (e.g.
  • At least one SARS-CoV-2 spike protein) or an immunogenic fragment thereof is: (i) at least one fusion protein comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; (ii) at least one virus-like particle (VLP) comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; or an inactivated SARS-CoV-2 virion.
  • the invention provides a combined influenza-COVID-19 vaccine wherein the influenza HA or immunogenic fragment thereof and optionally the influenza NA or immunogenic fragment thereof are comprised in a subunit vaccine, and the one or more antigen derived from SARS-CoV-2 (e.g.
  • At least one SARS-CoV-2 spike protein) or an immunogenic fragment thereof is: (i) at least one fusion protein comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; (ii) at least one virus-like particle (VLP) comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; or an inactivated SARS-CoV-2 virion.
  • VLP virus-like particle
  • the invention provides a combined influenza-COVID-19 vaccine, wherein: the influenza HA or immunogenic fragment thereof is comprised in a live attenuated influenza virion; the influenza NA or immunogenic fragment thereof is comprised in a live attenuated influenza virion; and/or the one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof is comprised in a live viral vector (i.e. in a live vectored vaccine).
  • the live viral vector comprising the one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof may be any viral vector used clinically for vaccines.
  • Non-limiting examples include adenoviral vectors, measles virus vectors, mumps virus vectors, rubella virus vectors, varicella virus vectors, polio virus vectors and yellow fever virus vectors.
  • Coronavirus antigens Coronaviruses have the largest genome among all RNA viruses, typically ranging from 27 to 32 kb. The CoV genome codes for at least four main structural proteins: spike (S), membrane (M), envelope (E), nucleocapsid (N) proteins and other accessory proteins which aid the replicative processes and facilitate entry into cells.
  • Figure 1 summarises the coronavirus’s structure and the function of the structural proteins.
  • the CoV genome is packed inside a helical capsid formed by the nucleocapsid and further surrounded by an envelope.
  • the membrane and envelope proteins which are involved in virus assembly
  • the spike protein which mediates virus entry into host cells.
  • Some coronaviruses also encode an envelope-associated hemagglutinin-esterase protein (HE).
  • HE hemagglutinin-esterase protein
  • the spike protein forms large protrusions from the virus surface, giving coronaviruses the appearance of having crowns, from which the name “Coronavirus” is derived.
  • the spike protein is a critical determinant of viral host range and tissue tropism and a major inducer of host immune responses.
  • 2019-nCoV (officially named severe acute respiratory syndrome coronavirus 2, SARS-CoV-2) is the causative agent of coronavirus disease 2019 (COVID-19) and is contagious among humans. It is believed that SARS-CoV-2 originated in animals, with bats being a likely source given the genetic similarities of SARS-CoV-2 to SARS-CoV (79.5%) and bat coronaviruses (96%). Any disclosure herein in relation to CoVs also applies directly and without restriction to SARS-CoV-2.
  • the one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof in a combined influenza-COVID-19 vaccine of the invention maybe any SARS-CoV-2 antigen(s) which is capable of eliciting immune response and/or protection against SARS-CoV-2 infection.
  • said one more antigen is: (i) at least one recombinant SARS-CoV-2 spike protein or immunogenic fragment thereof; (ii) at least one fusion protein comprising a SARS-CoV-2 spike protein or immunogenic fragment thereof; (iii) at least one virus-like particle (VLP) comprising a SARS-CoV- 2 spike protein or immunogenic fragment thereof; (iv) at least one polynucleotide encoding a recombinant SARS-CoV-2 spike protein or immunogenic fragment thereof; or (v) encoded by at least one RNA or DNA vaccine.
  • VLP virus-like particle
  • the SARS-CoV-2 component of the combined influenza-COVID-19 vaccine of the invention may comprise at least one, at least two, at least three, at least four, or more SARS-CoV-2 antigens.
  • each SARS-CoV-2 antigen may be a different spike protein antigen, such as the wild-types spike protein antigen and/or one of the variant spike proteins described herein.
  • Other non-limiting examples of SARS-CoV-2 antigens that may be included in a combined influenza-COVID-19 vaccine of the present invention include such antigens from the 2019-CoV capsid, membrane protein or envelope protein.
  • Each of the one or more SARS-CoV-2 antigens may be independently provided in the form of (i) a recombinant antigen or immunogenic fragment thereof; (ii) a fusion protein or immunogenic fragment thereof; (iii) a virus-like particle (VLP) comprising said antigen or immunogenic fragment thereof; or (iv) a polynucleotide encoding said antigen or immunogenic fragment thereof.
  • VLP virus-like particle
  • the disclosure herein in relation to recombinant, fusion protein, VLP, polynucleotide and vectors comprising SARS-CoV-2 spike protein antigens is equally applicable to other SARS-CoV-2 antigens that may be comprised in a combined influenza-COVID-19 vaccine of the invention.
  • the CoV spike protein comprises three domains: (i) a large ectodomain; (ii) a transmembrane domain (which passes through the viral envelope in a single pass); and (iii) a short intracellular tail.
  • the ectodomain consists of three receptor-binding subunits (3 x S1) and a trimeric stalk made of three membrane-fusion subunits (3 x S2).
  • the SARS-CoV-2 spike protein is a homotrimer.
  • S1 binds to a receptor on the host cell surface for viral attachment, and S2 fuses the host and viral membranes, allowing viral genomes to enter host cells. Receptor binding and membrane fusion are the initial and critical steps in the coronavirus infection cycle.
  • SARS-CoV-2 spike protein There is significant divergence in the receptors targeted by different CoVs.
  • the structure of the SARS-CoV-2 spike protein is described, for example, in Cai et al. (Science (2020) 369:1586-1592)), which is herein incorporated by reference in its entirety.
  • Each S1 subunit of a SARS-CoV-2 spike protein comprises an N-terminal domain (NTD), receptor binding domain (RBD), two C-terminal domains (CTDs).
  • NTD N-terminal domain
  • RBD receptor binding domain
  • CTDs C-terminal domains
  • the SARS-CoV-2 spike protein On binding to ACE2, the SARS-CoV-2 spike protein refolds in a “jack-knife” manner, forming a long-central coiled coil and ultimately leading to membrane fusion and viral entry to a host cell.
  • the present inventors have previously shown that the SARS-CoV-2 spike protein and immunogenic fragments thereof have therapeutic potential (including prophylactic potential) as antigens for vaccines against SARS-CoV-2/COVID-19 infection.
  • the one or more antigen derives from SARS-CoV-2 contained in a combined influenza-COVID-19 vaccine of the invention is preferably one or more SARS-CoV-2 spike protein or immunogenic fragment thereof.
  • said one or more SARS-CoV-2 spike protein has at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • the one or more spike protein from SARS-CoV-2 has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • the one or more spike protein from SARS- CoV-2 has at least 98%, at least 99% or more with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • the one or more spike protein from SARS-CoV-2 may comprise or consist of SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein (also referred to herein as an immunogenic fragment).
  • a SARS-CoV-2 spike protein or immunogenic fragment thereof according to the invention typically retain the same binding affinity for its receptor as the native SARS-CoV-2 spike protein.
  • this may mean having a binding affinity for the SARS-CoV-2 spike protein receptor of at least 80%, at least 85%, at least 90%, at least 95%, at least 99% or more of that of the native SARS-CoV-2 spike protein.
  • the SARS-CoV-2 spike protein or immunogenic fragment thereof of the invention have a binding affinity for the SARS-CoV-2 spike protein of at least 90%, at least 95%, at least 99% or more of that of the native SARS-CoV-2 spike protein.
  • the SARS-CoV-2spike protein or immunogenic fragment thereof of the invention have a binding affinity for the 2019-nCoV spike protein receptor greater than that of the full-length protein.
  • the SARS-CoV-2 spike protein or immunogenic fragment thereof of the invention of the invention may have a binding affinity of at least 100%, at least 110%, at least 120%, or at least 150% or more of that of the native SARS-CoV-2 spike protein.
  • the SARS-CoV-2 spike protein or immunogenic fragment thereof of the invention may have a binding affinity for the SARS-CoV-2 spike protein receptor less than that of the native SARS-CoV-2 spike protein.
  • the SARS-CoV-2 spike protein or immunogenic fragment thereof of the invention may have a binding affinity of less than 80%, less than 70%, less than 60%, less than 50% or less of that of the native SARS-CoV-2 spike protein.
  • the binding affinity of a SARS-CoV-2 spike protein or immunogenic fragment thereof expressed by a polynucleotide of the invention for its receptor may be quantified in terms of dissociation constant (K d ).
  • K d may be determined using any appropriate technique, but surface plasmon resonance (SPR) is generally preferred in the context of the present invention.
  • An immunogenic fragment of the one or more SARS-CoV-2 spike protein is typically greater than 200 amino acids in length.
  • SARS-CoV-2 spike protein fragments of the present invention may comprise or consist of at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or more amino acid residues in length.
  • the fragments of the invention have a common antigenic cross-reactivity with the SARS-CoV-2 spike protein (and so are referred to as immunogenic fragments).
  • the one or more SARS-CoV-2 spike protein or fragment thereof maintains one or more conformational epitope present in native (wild-type) SARS-CoV-2 spike protein.
  • the one or more SARS-CoV-2 spike protein or fragment thereof is capable of giving rise to an immunoprotective effect.
  • said immunoprotective effect comprises the production of neutralising antibodies (nAb) which specifically bind to the one or more conformational epitope of the SARS-CoV-2 spike protein or fragment thereof.
  • a conformational epitope of a CoV spike protein has a specific three-dimensional structure that is found in the tertiary structure of the CoV spike protein.
  • Said one or more conformational epitope is typically within the ectodomain of the spike protein.
  • the one or more SARS-CoV-2 spike protein or fragment thereof retains all of the conformational epitopes present in native SARS-CoV-2 spike protein.
  • An immunogenic fragment of a SARS-CoV-2 protein may comprise or consist of the RBD, NTD, CTD1, CDT2, FP, and/or FPPR, or any combination thereof.
  • the immunogenic fragment of SARS-CoV-2 spike protein comprises or consists of the receptor-binding domain (RBD) of the SARS-CoV-2 spike protein.
  • RBD receptor-binding domain
  • This RBD is responsible for SARS-CoV-2 binding to a host cell and thus facilitates entry of SARS-CoV-2 particles into the host cell.
  • the RBD corresponds to amino acid residues 319 to 529 of SEQ ID NO: 1, as described herein is referred to as SEQ ID NO: 15.
  • the RBD is encoded by bases corresponding to positions 955 to 1597 in the genome of the SARS-CoV-2 virus (Genbank Accession No. MN908947, version 3 of which (MN908947.3) was deposited 17 January 2020).
  • the invention relates to an RBD of the SARS-CoV-2 spike protein has at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 15.
  • the immunogenic fragment of SARS-CoV-2 spike protein comprises or consists of an RBD of the SARS-CoV-2 spike protein that has at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 15.
  • the immunogenic fragment of SARS-CoV-2 spike protein comprises or consists of an RBD of the SARS-CoV-2 spike protein having least 98%, at least 99% or more with SEQ ID NO: 15.
  • the RBD of the SARS-CoV-2 spike protein may comprise or consist of SEQ ID NO: 15.
  • Any and all disclosure herein relating to the SARS-CoV-2 spike protein e.g. in relation to polynucleotides, viral vectors, DNA plasmids, RNA vaccines, virus-like particles (VLPs), fusion proteins, antibodies, compositions and pharmaceutical compositions, formulations and therapeutic indications
  • CoVs are large enveloped single positive-sense RNA viruses.
  • RNA viruses Mutation rates of RNA viruses are greater than DNA viruses, suggesting a more efficient adaptation process for survival.
  • antigenic drift similar to that observed for influenza virus, will also become a feature of the SARS-CoV-2, or is SARS-CoV-2 becomes endemic in the population once the pandemic has subsided.
  • SARS-CoV-2 spike protein includes S943 (particularly S943P), L5 (particularly L5F), L8 (particularly L8F), V367 (particularly V367F), H49 (particularly H49Y), Y145 (particularly Y145H/del), Q239 (particularly Q239K), A831 (particularly A831V), D839 (particularly D839Y/N/E), and P1263 (particularly P1263L), or any combination thereof (Korber et al., BioRxiv TM https://doi.org/10.1101/2020.04.29.069054).
  • any SARS-CoV-2 spike protein or fragment thereof according to the invention may be modified (particularly by substitution) at position (i) D614, (ii) V483, (iii) G476, (iv) K417, (v), E484, (vi) N501, (vii) A570, and (viii) P681, or any combination of (including any two, any three, any four, any five, any six, any seven or all eight) of (i) to (viii).
  • the SARS-CoV-2 spike proteins or fragments thereof may comprise deletion mutations, including deletions at one or more of amino acid residues 69, 70 and/or 144.
  • the positions of the mutations/modifications typically corresponds to the numbering of amino acids in SEQ ID NO: 1 of the present invention. Modification at position D614, particularly the D614G substitution, is preferred.
  • any SARS-CoV-2 spike protein or fragment thereof according to the invention may comprise the following substitutions (i) G476S, (ii) V483A/G, (iii) D614G, (iv) K417N/T, (v), E484K, (vi) N501Y, (vii) A570D, and (viii) P681H, or any combination of (including any two, any three, any four, any five, any six, any seven or all eight) of (i) to (viii).
  • the invention also relates to SARS-CoV-2 spike proteins or fragments thereof from a variant SARS-CoV-2.
  • the invention may relate to SARS-CoV-2 spike proteins or fragments thereof from the B.1.1.7 strain (also known as 201/501Y.V1, which was first detected in the UK, now known as the Alpha variant); the B.1.351 strain (also known as 20H/501.V2, which was first detected in South Africa, now known as the Beta variant), the P1 strain (also known as 20J/501Y.V3, which was first detected in Japan and Brazil, now known as the Gamma variant), the B1.427 and B1.429 strains (first detected in California, now known as the Epsilon variant), and/or the B.1.617.2 strain (which was first detected in India, now known as the Delta variant).
  • the B.1.1.7 strain also known as 201/501Y.V1, which was first detected in the UK, now known as the Alpha variant
  • the B.1.351 strain also known as 20H/501.V2, which was first detected in South Africa, now known as the Beta variant
  • the P1 strain also known as 20J/501Y.V3, which was first detected in Japan
  • the Alpha variant has been found to comprise the following mutations: 69deletion, 70deletion, 144deletion, (E484K*), (S494P*), N501Y, A570D, D614G, P681H, T716I, S982A, D1118H, and (K1191N*)
  • the key mutations of the Alpha variant comprise deletion of residues 69/70 and 144Y, as well as N501Y, A570D, D614G and P681H substitutions.
  • the Beta variant has been found to comprise the following mutations: D80A, D215G, 241deletion, 242deletion, 243deletion, K417N, E484K, N501Y, D614G, and A701V.
  • the key mutations of the Beta variant comprise K417N, E484K, N501Y and D614G substitutions.
  • the Gamma variant has been found to comprise the following mutations: L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y, T1027I.
  • the key mutations of the Gamma variant comprise E484K, K417N/T, N501Y and D614G.
  • the Delta variant has been found to comprise the following mutations: T19R, (G142D*), 156deletion, 157deletion, R158G, L452R, T478K, D614G, P681R, and D950N.
  • the key mutations of the Delta variant comprise L452R, E484Q and T478K.
  • the Epsilon variant has been found to comprise the following mutations: S13I, W152C, L452R, D614G.
  • Epsilon variant is L452R. All the disclosure herein in relation to combination vaccines, polynucleotides, spike proteins and fragments thereof, VLPs, fusion proteins and DNA/RNA vaccine applies equally to different variants and strains of SARS-CoV-2 unless explicitly stated. Development of a vaccine composition which can be safely administered repeatedly would therefore not only enable boosting of the immune response to address issues of protective immunity being lost over time (as described herein and as observed in the clinic), but would also advantageously allow SARS-CoV-2 vaccine antigens to be modified if required to provide enhanced immunity against strains with mutated spike proteins as they arise.
  • any SARS-CoV-2 spike protein or fragment thereof used as one or more SARS-CoV-2 antigen according to the invention may be modified (particularly by substitution) at position: (i) 417; (ii) 452; (iii) 478; (iv) 484; (v) 201; (vi) 570; (vii) 614; and/or (viii) 681; or any combination thereof.
  • any SARS-CoV-2 spike protein or fragment thereof used as one or more SARS-CoV-2 antigen according to the invention may be modified (particularly by substitution) at position (i) D614, (ii) V483, (iii) G476, (iv) G476 and V483, (v) G476 and D614, (vi) V483 and D614 , or (vii) G476, V483 and D614.
  • Modification at position D614, particularly the D614G substitution may be preferred.
  • Modification at position L452, particularly the L452R substitution may be preferred.
  • any SARS-CoV-2 spike protein or fragment thereof used as the one or more SARS-CoV-2 antigen according to the invention may comprise the following substitutions (i) G476S, (ii) V483A/G, (iii) D614G, (iv) G476S and V483A/G, (v) G476S and D614G, (vi) V483A/G and D614G, (vii) G476S, V483A/G and D614G, (viii) L452R and E484Q, and optionally T478K; or (ix) L452R.
  • SARS-CoV-2 spike proteins in any of the forms described herein, particularly as fusion proteins or VLPs
  • polynucleotides The one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof may be encoded or expressed by one or more polynucleotide vaccine (the terms “encode” and “express” are used interchangeably herein) to produce the antigen(s) or immunogenic fragment(s) thereof.
  • polynucleotide encompasses both DNA and RNA sequences.
  • the terms “nucleic acid”, “nucleic acid molecule” and “polynucleotide” are used interchangeably.
  • the antigen derived from SARS-CoV-2 (e.g. SARS-CoV-2 spike protein) or an immunogenic fragment thereof may be encoded or expressed by a DNA or RNA vaccine.
  • the one or more polynucleotide expressing the one or more SARS-CoV-2 spike protein or immunogenic fragment thereof in a combined influenza-COVID-19 vaccine of the invention may express a spike protein from SARS-CoV-2 having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • said one or more polynucleotide expresses one or more spike protein from SARS-CoV-2 having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein. More preferably, said one or more polynucleotide expresses one or more spike protein from SARS-CoV-2 having least 98%, at least 99% or more with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • Said one or more polynucleotide may express a spike protein from SARS-CoV-2 comprising or consisting of SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • Multiple SARS-CoV-2 antigens may be expressed by a polynucleotide or by multiple polynucleotides or a combination thereof.
  • said one or more SARS-CoV-2 antigens may be expressed by a single polynucleotide, or each of said SARS-CoV-2 antigens (particularly one or more SARS-CoV-2 spike proteins) may be expressed by separate polynucleotides.
  • said polynucleotide comprises an isolated polynucleotide encoding a spike protein from SARS-CoV-2 having at least 90% identity with SEQ ID NO: 1, or a fragment thereof that has a common antigenic cross-reactivity with said spike protein, or any variant thereof as described herein.
  • the polynucleotide may encode an RBD of the SARS-CoV-2 spike protein, preferably wherein said RBD has at least 90% identity with SEQ ID NO: 15.
  • RBD has at least 90% identity with SEQ ID NO: 15.
  • Exemplary polynucleotides encoding the RBD are shown in SEQ ID NO: 13, and the codon-optimised sequence of SEQ ID NO: 14.
  • a polynucleotide of the invention may comprise or consist of a nucleic acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to SEQ ID NO: 13.
  • a polynucleotide of the invention may comprise or consist of a nucleic acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to SEQ ID NO: 13. More preferably, a polynucleotide of the invention may comprise or consist of a nucleic acid sequence having at least 98%, at least 99% or more identity to SEQ ID NO: 13. A polynucleotide of the invention may comprise or consist of the nucleic acid sequence of SEQ ID NO: 13.
  • the invention also encompasses polynucleotides encoding a variant spike protein from SARS-CoV-2, as described above, or fragments thereof that have common antigenic cross-reactivity with said variant spike protein.
  • Said variant spike proteins typically have at least 90% identity with SEQ ID NO: 1, or a fragment thereof, such as the RBD of SEQ ID NO: 15.
  • the one or more polynucleotide e.g. a DNA or RNA vaccine
  • encoding the one or more SARS-CoV-2 spike protein or immunogenic fragments thereof may be optimised for expression in a patient.
  • optimised as used herein relates to optimisation for expression of the one or more SARS-CoV-2 spike protein or immunogenic fragment thereof, and includes both codon optimisation and/or other modifications to the polynucleotide (both in terms of the nucleic acid sequence and other modifications) which increase the level and/or duration of expression of the one or more SARS-CoV-2 spike protein from the polynucleotide within the patient, or which otherwise provide an advantage when expressing the one or more SARS-CoV-2 spike protein, or fragment thereof, from a DNA or RNA vaccine.
  • the inventors have previously described optimised polynucleotides encoding SARS-CoV-2 spike proteins and fragments in UK Patent Application No.
  • one or more antigen derived from SARS-CoV-2 or an immunogenic fragment thereof may be encoded by one or more polynucleotide (e.g. a DNA or RNA vaccine) comprising a nucleic acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 2, 3, 4, 5, 6, 7, 8, 13, 14, 26, 27, 29, 30 or 32.
  • polynucleotide e.g. a DNA or RNA vaccine
  • said one or more polynucleotide comprises a nucleic acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 2, 3, 4, 5, 6, 7, 8, 13, 14, 26, 27, 29, 30 or 32. More preferably, said one or more polynucleotide comprises a nucleic acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 2, 3, 4, 5, 6, 7, 8, 13, 14, 26, 27, 29, 30 or 32. Said one or more polynucleotide may comprise the nucleic acid sequence of any one of SEQ ID NOs: 2, 3, 4, 5, 6, 7, 8, 13, 14, 26, 27, 29, 30 or 32.
  • the 5’ cloning site, the 3’ cloning site, or the 5’ and 3’ cloning sites identified in any of SEQ ID NOs; 2, 3, 4, 5, 6, 7, 8, 13, 14, 26, 27, 29, 30 or 32, or any variant thereof as described herein, may be deleted in a polynucleotide (e.g. a DNA or RNA vaccine).
  • a polynucleotide e.g. a DNA or RNA vaccine.
  • the one or more polynucleotide e.g.
  • DNA or RNA vaccine may comprise any one of SEQ ID NOs: 2, 3, 4, 5, 6, 7, 8, 13, 14, 26, 27, 29, 30 or 32, but lacking the 5’ cloning site, the 3’ cloning site, or the 5’ and 3’ cloning sites identified in any of SEQ ID NOs; 2, 3, 4, 5, 6, 7, 8, 13, 14, 26, 27, 29, 30 or 32.
  • the 5’ cloning site, the 3’ cloning site, or the 5’ and 3’ cloning sites identified in any of SEQ ID NOs; 2, 3, 4, 5, 6, 7, 8, 13, 14, 26, 27, 29, 30, or 32, or any variant thereof as described herein may be independently replaced with another appropriate cloning site. Suitable alternative cloning sites are well known in the art.
  • a polynucleotide of the invention may comprise or consist of a nucleic acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to SEQ ID NO: 13, or to the codon-optimised sequence of SEQ ID NO: 14.
  • a polynucleotide of the invention may comprise or consist of a nucleic acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to SEQ ID NO: 13, or to the codon-optimised sequence of SEQ ID NO: 14. More preferably, a polynucleotide of the invention may comprise or consist of a nucleic acid sequence having at least 98%, at least 99% or more identity to SEQ ID NO: 13, or to the codon-optimised sequence of SEQ ID NO: 14.
  • a polynucleotide of the invention may comprise or consist of the nucleic acid sequence of SEQ ID NO: 13, or the codon-optimised sequence of SEQ ID NO: 14.
  • the one or more polynucleotide e.g. a DNA or RNA vaccine
  • the one or more polynucleotide typically encodes at least one SARS-CoV-2 spike protein, or an immunogenic fragment thereof which: (a) retains the conformational epitopes present in the native SARS-CoV-2 spike protein; and/or (b) results in the production of neutralising antibodies specific for the spike protein or fragment thereof when said nucleic acid is administered to a patient.
  • the one or more polynucleotide e.g.
  • DNA or RNA vaccine typically expresses at least one spike protein from SARS-CoV-2 or immunogenic fragment thereof, particularly at least one spike protein from SARS-CoV-2 or immunogenic fragment thereof as described herein (including in the form of a VLP or fusion protein).
  • the one or more polynucleotide e.g. a DNA or RNA vaccine
  • the one or more polynucleotide may be comprised in an expression construct to facilitate expression of the one or more SARS-CoV-2 spike protein or fragment thereof.
  • said one or more polynucleotide is operably linked to a suitable promoter(s).
  • the one or more polynucleotide may be linked to a suitable terminator sequence(s).
  • the one or more polynucleotide may be linked to both a promoter(s) and terminator(s). Suitable promoter and terminator sequences are well known in the art.
  • the one or more polynucleotide e.g. DNA or RNA vaccine
  • Any suitable leader sequence may be used, including conventional leader sequences known in the art. Suitable leader sequences include human tissue plasminogen activator leader sequence (tPA), which is routinely used in viral and DNA based vaccines and for protein vaccines to aid secretion from mammalian cells.
  • tPA human tissue plasminogen activator leader sequence
  • the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof may additionally comprise an N- or C-terminal tag, for example to assist in the recombinant production and/or purification of the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof.
  • N- or C-terminal tag may be used, including conventional tags known in the art. Suitable tags sequences include C-terminal hexa-histidine tags and the “C-tag” (the four amino acids EPEA at the C-terminus), which are commonly used in the art to aid purification from heterologous expression systems, e.g. insect cells, mammalian cells, bacteria, or yeast.
  • the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof of the invention are purified from heterologous expression systems without the need to use a purification tag.
  • the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof of the invention may comprise a leader sequence and/or a tag as defined herein.
  • Viral Vectors, DNA Plasmids and RNA Vaccines In a combined influenza-COVID-19 vaccine of the invention, the one or more antigen derived from SARS-CoV-2 (e.g. SARS-CoV-2 spike protein) or an immunogenic fragment thereof may be encoded or expressed by one or more viral vector, DNA vector (or DNA plasmid) or RNA vaccine.
  • vector refers to a viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine.
  • Said one or more viral vector, DNA vector (or DNA plasmid) or RNA vaccine may comprise one or more polynucleotide encoding at least one antigen derived from SARS-CoV-2 as described herein.
  • said one or more viral vector, DNA vector (or DNA plasmid) or RNA vaccine encodes at least one SARS-CoV-2 spike protein or immunogenic fragment thereof as described herein.
  • SARS-CoV-2 antigens may be expressed by a single viral vector, DNA vector (or DNA plasmid) or RNA vaccine or by multiple viral vectors, DNA vectors (or DNA plasmids) or RNA vaccines or a combination thereof.
  • said one or more SARS-CoV-2 antigens may be expressed by a single viral vector, DNA vector (or DNA plasmid) or RNA vaccine, or each of said SARS-CoV-2 antigens (particularly one or more SARS-CoV-2 spike proteins) may be expressed by a separate viral vector, DNA vector (or DNA plasmid) or RNA vaccine.
  • the one or more viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine expressing the one or more SARS-CoV-2 spike protein or immunogenic fragment thereof in a combined influenza-COVID-19 vaccine of the invention may express at least one spike protein from SARS-CoV-2 having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • said one or more viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine expresses at least one spike protein from SARS- CoV-2 having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein. More preferably, said one or more viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine expresses at least one spike protein from SARS-CoV-2 having least 98%, at least 99% or more with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • Said one or more viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine may express at least one spike protein from SARS-CoV-2 comprising or consisting of SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • the at least one spike protein from SARS-CoV-2 or immunogenic fragment thereof expressed by a vector of the invention is an RBD of the SARS-CoV-2 spike protein as defined herein, preferably wherein said RBD has at least 90% identity with SEQ ID NO: 15.
  • a DNA vector (or DNA plasmid) or an RNA vaccine expresses at least one spike protein from SARS-CoV-2 having at least 90% identity with SEQ ID NO: 1, or a fragment thereof that has a common antigenic cross-reactivity with said spike protein, or any variant thereof as described herein.
  • a preferred fragment is an RBD with at least 90% identity to SEQ ID NO: 15.
  • the one or more viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine expressing the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof in a combined influenza-COVID-19 vaccine of the invention may express at least one spike protein or immunogenic fragment thereof as defined herein which further comprises a signal peptide(s).
  • said signal peptide directs secretion of the at least one SARS-CoV-2 spike protein or fragment thereof from a host cell of interest, such as cells in the patient to be treated.
  • the one or more viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine expressing the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof in a combined influenza-COVID-19 vaccine of the invention may further expresses one or more additional antigen or a fragment thereof.
  • the spike protein or fragment thereof and the one or more additional antigen or fragment thereof may expressed as a fusion protein.
  • separate vectors expressing the SARS-CoV-2 spike protein or fragment thereof and the one or more additional antigen or fragment thereof may be used.
  • the one or more additional antigen may be the same antigen or a different antigen from SARS-CoV-2, or a fragment thereof. More preferably, said one or more additional antigen is a different antigen from SARS-CoV-2, such as an antigen from the 2019- CoV capsid, membrane protein or envelope protein.
  • the one or more viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine expressing the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof in a combined influenza-COVID-19 vaccine of the invention may comprise any one or more polynucleotide or expression construct as defined herein, or any combination thereof.
  • the one or more vector(s) may be a viral vector.
  • a viral vector may be an adenovirus (of a human serotype such as AdHu5, a simian serotype such as ChAd63, ChAdOX1 or ChAdOX2, or another form), an adeno-associated virus (AAV), or a poxvirus vector (such as a modified vaccinia Ankara (MVA)), or an adeno associated virus (AAV).
  • adenovirus of a human serotype such as AdHu5, a simian serotype such as ChAd63, ChAdOX1 or ChAdOX2, or another form
  • AAV adeno-associated virus
  • poxvirus vector such as a modified vaccinia Ankara (MVA)
  • AAV adeno associated virus
  • ChAdOX1 and ChAdOX2 are disclosed in WO2012/172277 (herein incorporated by reference in its entirety).
  • said one or more viral vector is an AAV vector adenovirus.
  • viral vectors include measles viral vectors, mumps viral vectors, rubella viral vectors, varicella viral vectors, polio viral vectors and yellow fever viral vectors.
  • Viral vectors are usually non-replicating or replication impaired vectors, which means that the viral vector cannot replicate to any significant extent in normal cells (e.g. normal human cells), as measured by conventional means – e.g. via measuring DNA synthesis and/or viral titre.
  • Non- replicating or replication impaired vectors may have become so naturally (i.e. they have been isolated as such from nature) or artificially (e.g. by breeding in vitro or by genetic manipulation).
  • the vector may be selected from a human or simian adenovirus or a poxvirus vector.
  • the one or more viral vector is incapable of causing a significant infection in an animal subject, typically in a mammalian subject such as a human or other primate.
  • the one or more vector(s) may be a DNA vector, such as a DNA plasmid.
  • the one or more vector(s) may be an RNA vector, such as a mRNA vector or a self-amplifying RNA vector.
  • the one ormore DNA and/or RNA vector(s) of the invention is typically capable of expression in eukaryotic cells, particularly any host cell type described herein, or in a patient to be treated.
  • the DNA and/or RNA vector(s) are capable of expression in a human, E. coli or yeast cell.
  • the one or more vector may be a phage vector, such as an AAV/phage hybrid vector as described in Hajitou et al., Cell 2006; 125(2) pp.385-398; herein incorporated by reference.
  • the nucleic acid molecules and vectors of the invention may be made using any suitable process known in the art. Thus, the nucleic acid molecules may be made using chemical synthesis techniques.
  • the nucleic acid molecules and vectors of the invention may be made using molecular biology techniques.
  • Vector(s) of the present invention may be designed in silico, and then synthesised by conventional polynucleotide synthesis techniques.
  • Virus-Like Particles In a combined influenza-COVID-19 vaccine of the invention, the one or more antigen derived from SARS-CoV-2 (e.g. at least one SARS-CoV-2 spike protein) or an immunogenic fragment thereof may be comprised in a virus-like particle (VLP).
  • VLPs are particles which resemble viruses but do not contain viral nucleic acid and are therefore non-infectious.
  • VLPs have been produced from components of a wide variety of virus families (Noad and Roy (2003), Trends in Microbiology, 11:438-444; Grgacic et al., (2006), Methods, 40:60-65). Some VLPs have been approved as therapeutic vaccines, for example Engerix-B (for hepatitis B), Cervarix and Gardasil (for human papilloma viruses). Multiple SARS-CoV-2 antigens (particularly one or more SARS-CoV-2 spike proteins) may be comprised in a VLP or a combination thereof.
  • said one or more SARS-CoV-2 antigens may be comprised in a single VLP, or each of said SARS-CoV-2 antigens (particularly one or more SARS-CoV-2 spike proteins) may be comprised in separate VLPs.
  • the one or more antigen derived from SARS-CoV-2 e.g. at least one SARS-CoV-2 spike protein
  • an immunogenic fragment thereof may be comprised in one or more VLP.
  • the one or more VLP comprising the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof in a combined influenza-COVID-19 vaccine of the invention may comprise one or more spike protein from SARS-CoV-2 having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • said one or more VLP comprises one or more spike protein from SARS-CoV-2 having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein. More preferably, said one or more VLP comprises one or more spike protein from SARS- CoV-2 having least 98%, at least 99% or more with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • Said one or more VLP may comprise at least one spike protein from SARS-CoV-2 comprising or consisting of SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • the immunogenic fragment of the SARS-CoV-2 spike protein comprised in a VLP of the invention is an RBD of the SARS-CoV-2 spike protein as defined herein, preferably wherein said RBD has at least 90% identity with SEQ ID NO: 15.
  • said one or more VLP comprises at least one spike protein from SARS-CoV-2 having at least 90% identity with SEQ ID NO: 1, or a fragment thereof that has a common antigenic cross- reactivity with said spike protein, or any variant thereof as described herein.
  • a preferred fragment is an RBD with at least 90% identity to SEQ ID NO: 15.
  • VLPs can be synthesized through the individual expression of viral structural proteins, which can then self-assemble into the virus-like structure. Combinations of structural capsid proteins from different viruses can be used to create recombinant VLPs.
  • antigens or immunogenic fragments thereof can be fused to the surface of VLPs.
  • antigens or immunogenic fragments thereof of the invention may be coupled to a VLP using the SpyCatcher-SpyTag system (as described by Brune, Biswas, Howarth). Said one or more VLP may comprise one or more additional protein antigen.
  • the one or more additional antigen may be the same antigen or a different antigen from SARS-CoV-2, or a fragment thereof. More preferably, said one or more additional antigen is a different antigen from SARS-CoV-2, such as an antigen from the SARS-CoV-2 capsid, membrane protein or envelope protein.
  • Said one or more VLP may comprise at least one fusion protein as described herein.
  • Said one or more VLP may comprise a fusion protein of the SARS-CoV-2 spike protein or immunogenic fragment thereof with Hepatitis B surface antigen (HBSAg), human papillomavirus (HPV) 18 L1 protein, HPV 16 L1 protein and/or Hepatitis E P239, preferably Hepatitis B surface antigen.
  • HBSAg Hepatitis B surface antigen
  • HPV human papillomavirus
  • said one or more VLP may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NO: 3, 5, 6 or 8.
  • said one or more VLP may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 3, 5, 6 or 8.
  • said one or more VLP may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 3, 5, 6 or 8.
  • Said one or more VLP may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence of any one of SEQ ID NOs: 3, 5, 6 or 8.
  • a VLP of the invention may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 26, 27, 29, 30 or 32.
  • a VLP of the invention may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 26, 27, 29, 30 or 32.
  • a VLP of the invention may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 26, 27, 29, 30 or 32.
  • a VLP of the invention may be encoded by a polynucleotide which comprises or consists of the nucleic acid sequence of any one of SEQ ID NOs: 26, 27, 29, 30 or 32.
  • Said one or more VLP may comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NO: 9, 10, 11 or 12.
  • said VLP may comprise or consist of an amino acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 9, 10, 11 or 12.
  • said one or more VLP comprises or consists of an amino acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 9, 10, 11 or 12.
  • Said VLP may comprise or consist of an amino acid sequence of any one of SEQ ID NOs: 9, 10, 11 or 12.
  • a VLP of the invention may comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 28, 31 or 33.
  • Preferably a VLP of the invention may comprise or consist of an amino acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 28, 31 or 33.
  • a VLP of the invention may comprises or consists of an amino acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 28, 31 or 33.
  • a VLP of the invention may comprise or consist of an amino acid sequence of any one of SEQ ID NOs: 28, 31 or 33.
  • the use of one or more VLP may increase the efficacy of the immunoprotective response induced by the SARS-CoV-2 spike protein or immunogenic fragment and/or may increase the duration of the immunoprotective response as defined herein. Fusion Proteins In a combined influenza-COVID-19 vaccine of the invention, the one or more antigen derived from SARS-CoV-2 (e.g.
  • one or more SARS-CoV-2 spike protein) or an immunogenic fragment thereof may be comprised in a fusion protein.
  • the one or more antigen derived from SARS-CoV-2 e.g. one or more SARS-CoV- 2 spike protein
  • an immunogenic fragment thereof may be comprised in one or more fusion protein.
  • Multiple SARS-CoV-2 antigens may be comprised in a fusion protein or a combination thereof.
  • said one or more SARS-CoV-2 antigens may be comprised in a single fusion protein, or each of said SARS-CoV-2 antigens (particularly one or more SARS-CoV-2 spike proteins) may be comprised in separate fusion proteins.
  • the one or more fusion protein comprising the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof in a combined influenza-COVID-19 vaccine of the invention may comprise one or more spike protein from SARS-CoV-2 having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • said one or more fusion protein comprises one or more spike protein from SARS- CoV-2 having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein. More preferably, said one or more fusion protein comprises one or more spike protein from SARS-CoV-2 having least 98%, at least 99% or more with SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • Said one or more fusion protein may comprise at least one spike protein from SARS-CoV-2 comprising or consisting of SEQ ID NO: 1, or a fragment thereof, that has a common antigenic cross-reactivity with said spike protein.
  • said one or more fusion protein comprises at least one spike protein from SARS- CoV-2 having at least 90% identity with SEQ ID NO: 1, or a fragment thereof that has a common antigenic cross-reactivity with said spike protein, or any variant thereof as described herein.
  • the immunogenic fragment of the SARS-CoV-2 spike protein comprised in a fusion protein of the invention is an RBD of the SARS-CoV-2 spike protein as defined herein, preferably wherein said RBD has at least 90% identity with SEQ ID NO: 15.
  • a fusion protein of the invention typically also comprises a non-SARS-CoV-2 domain or element, typically a non- SARS-CoV-2 protein, polypeptide or peptide domain or element.
  • Said one or more fusion protein may comprise the at least one SARS-CoV-2 spike protein or immunogenic fragment thereof and one or more of: Hepatitis B surface antigen (HBSAg); human papillomavirus (HPV) 18 L1 protein; HPV 16 L1 protein; and/or Hepatitis E P239, preferably Hepatitis B surface antigen.
  • HBSAg Hepatitis B surface antigen
  • HPV human papillomavirus
  • HPV Hepatitis E P239
  • Said one or more fusion protein may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NO: 3, 5, 6 or 8.
  • Preferably said one or more fusion protein may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 3, 5, 6 or 8.
  • said one or more fusion protein may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 3, 5, 6 or 8.
  • Said one or more fusion protein may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence of any one of SEQ ID NOs: 3, 5, 6 or 8.
  • a fusion protein of the invention may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 26, 27, 29, 30 or 32.
  • a fusion protein of the invention may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 26, 27, 29, 30 or 32.
  • a fusion protein of the invention may be encoded by a polynucleotide which comprises or consists of a nucleic acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 26, 27, 29, 30 or 32.
  • a fusion protein of the invention may be encoded by a polynucleotide which comprises or consists of the nucleic acid sequence of any one of SEQ ID NOs: 26, 27, 29, 30 or 32.
  • Said one or more fusion protein may comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NO: 9, 10, 11 or 12.
  • said one or more fusion protein may comprise or consist of an amino acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 9, 10, 11 or 12. More preferably, said one or more fusion protein may comprise or consist of an amino acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 9, 10, 11 or 12.
  • Said one or more fusion protein may comprise or consist of an amino acid sequence of any one of SEQ ID NOs: 9, 10, 11 or 12.
  • a fusion protein of the invention may comprise or consist of an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 28, 31 or 33.
  • a fusion protein of the invention may comprise or consist of an amino acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 28, 31 or 33.
  • a fusion protein of the invention may comprise or consist of an amino acid sequence having at least 98%, at least 99% or more identity to any one of SEQ ID NOs: 28, 31 or 33.
  • a fusion protein of the invention may comprise or consist of an amino acid sequence of any one of SEQ ID NOs: 28, 31 or 33.
  • Said one or more fusion protein may preferably take the form of a VLP.
  • a fusion protein of the invention may comprise a linker (also referred to interchangeably herein as a linker peptide, a spacer or a spacer peptide).
  • a linker may be used to join two or more functional domains of a fusion protein of the invention.
  • linker is used to join the SARS-CoV-2 spike protein or immunogenic fragment thereof domain of the fusion protein to the non- SARS-CoV-2 spike protein domain of the fusion protein.
  • linkers in fusion proteins are routine in the art, and any conventional linker protein may be used in fusion proteins of the invention, provided that the resulting fusion protein retains the desired functional properties of the SARS-CoV-2 spike protein or immunogenic fragment thereof and the desired function properties of the non-2 SARS-CoV-2 spike protein domain.
  • a linker may be a short peptide of up to about 30 amino acids, such as about 5-30 amino acids, about 5-25 amino acids, about 5-20 amino acids, about 10-20 amino acids, about 5-15 amino acids or about 10-15 amino acids in length.
  • the linker is about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19 or about 20 amnio acids in length.
  • a rigid linker may be used in fusion proteins of the invention. Rigid linkers are conventionally used when it is necessary to keep a fixed distance between the different domains/portions of a fusion protein and to maintain their independent functions. Rigid linkers may also be used when the spatial separation of the fusion protein domains is critical to preserve the stability or bioactivity of the fusion proteins.
  • An empirical rigid linker with the sequence of A(EAAAK) n A (n 2-5) (SEQ ID NO: 16) displayed ⁇ -helical conformation, which is stabilized by Glu ⁇ - Lys + salt bridges.
  • a non-limiting example of a rigid linker is EAAAKEAAAKEAAAK (also referred to as (EAAAK) 3 , SEQ ID NO: 18), which may be encoded by the nucleic acid sequence (SEQ ID NO: 17).
  • Rigid linkers may be preferably used for expression of fusion proteins of the invention in mammalian cells, such as HEK 293 cells. In some embodiments, flexible linkers may be used in fusion proteins of the invention.
  • Flexible linkers are conventionally used when the joined domains require a certain degree of movement or interaction.
  • Flexible linkers usually comprise or consist of small amino acid residues, such as glycine, threonine, arginine, serine, asparagine, glutamine, alanine, aspartic acid, proline, glutamic acid, lysine, leucine and/or valine, particularly glycine, serine, alanine, leucine and/or valine.
  • Flexible linkers comprising or consisting of glycine, serine and/or alanine are preferred, with glycine and serine being particularly preferred.
  • GS linker stretches of Gly and Ser residues
  • Non-limiting examples of GS linkers include GS5 or (GGGGS) 1 (SEQ ID NO: 20); GS10 or (GGGGS) 2 (SEQ ID NO: 21); GS15 or (GGGGS) 3 (SEQ ID NO: 23); GS20 or (GGGGS) 4 (SEQ ID NO: 24); and GS25 or(GGGGS) 5 (SEQ ID NO: 25).
  • GS15 may be used, which may be encoded by (SEQ ID NO: 22).
  • Flexible linkers may be preferably used for expression of fusion proteins of the invention in bacterial cells, such as E. coli cells.
  • Any appropriate linker such as the exemplary linkers described herein may be used with any fusion protein of the invention (comprising any SARS-CoV-2 spike protein or immunogenic fragment domain and any non- SARS-CoV-2 spike protein domain).
  • a fusion protein of the invention may comprise or consist of HBSAg-(EAAAK) 3 -RBD (SEQ ID NO: 28), or a variant with at least 90% sequence identity thereto, which may be encoded by (SEQ ID NO: 26 or 27), or a variant with at least 90% sequence identity thereto.
  • a fusion protein of the invention may comprise or consist of HBSAg-(EAAAK)3-full-length 2019-nCoV spike protein (SEQ ID NO: 33), or a variant with at least 90% sequence identity thereto, which may be encoded by SEQ ID NO: 32, or a variant with at least 90% sequence identity thereto.
  • a fusion protein of the invention may comprise or consist of HEV- GS15-RBD (SEQ ID NO: 31), or a variant with at least 90% sequence identity thereto, which may be encoded by (SEQ ID NO: 29 or 30), or a variant with at least 90% sequence identity thereto.
  • a fusion protein may preferably take the form of a VLP.
  • HBSAg, HPV 18 L1 protein, HPB 16 L1 protein and Hepatitis E P239 protein are known to spontaneously form VLPs when expressed recombinantly, and this structure is retained when HBSAg, HPV 18 L1 protein, HPB 16 L1 protein and/or Hepatitis E P239 protein are present in fusion protein form combined with a SARS-CoV-2 spike protein of the invention (or immunogenic fragment thereof).
  • Influenza haemagglutinin (HA) and neuraminidase (NA) antigens The combined influenza-COVID-19 vaccines of the invention comprise an influenza haemagglutinin (HA) or an immunogenic fragment thereof.
  • the combined influenza- COVID-19 vaccines of the invention may further comprise an influenza neuraminidase (NA) or an immunogenic fragment thereof.
  • NA influenza neuraminidase
  • An immunogenic fragment of HA has a common antigenic cross-reactivity with the HA from which it is derived.
  • an immunogenic fragment of NA has a common antigenic cross- reactivity with the NA from which it is derived.
  • the influenza HA or immunogenic fragment thereof (and optionally the influenza NA or immunogenic fragment thereof) may present in a combined influenza-COVID-19 vaccine in any appropriate form.
  • influenza HA or immunogenic fragment thereof and/or the influenza NA or immunogenic fragment thereof will typically be prepared from influenza virions but, as an alternative, these antigens may be provided in other forms, such as polynucleotides, viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine, VLPs and fusion proteins.
  • polynucleotides, viral vector, a DNA vector (or DNA plasmid) or an RNA vaccine, VLPs and fusion proteins is also applicable to the influenza HA or immunogenic fragment thereof and the influenza NA or immunogenic fragment thereof as described herein.
  • influenza HA or immunogenic fragment thereof may be (i) comprised in an inactivated influenza virion; (ii) a recombinant HA or immunogenic fragment thereof; (iii) a fusion protein comprising HA or an immunogenic fragment thereof; or (iv) encoded by an RNA or DNA vaccine.
  • influenza NA or immunogenic fragment thereof may be (i) comprised in an inactivated influenza virion; (ii) a recombinant NA or immunogenic fragment thereof; (iii) a fusion protein comprising NA or an immunogenic fragment thereof; or (iv) encoded by an RNA or DNA vaccine.
  • the influenza HA or immunogenic fragment thereof and/or the influenza NA or immunogenic fragment thereof may take the form of an existing influenza vaccine.
  • the influenza HA or immunogenic fragment thereof and/or the influenza NA or immunogenic fragment thereof may take the form of a live (attenuated or vectored) vaccine, an inactivated vaccine or a subunit vaccine.
  • Inactivated influenza vaccines include both inactivated whole virion vaccines and inactivated split virion vaccines, whole virion inactivated vaccines are preferred.
  • Split virions are obtained by treating virions with detergents (e.g. ethyl ether, polysorbate 80, deoxycholate, tri-N-butyl phosphate, Triton X-100, Triton N101, cetyltrimethylammonium bromide, Tergitol NP9, etc.) to produce subvirion preparations.
  • detergents e.g. ethyl ether, polysorbate 80, deoxycholate, tri-N-butyl phosphate, Triton X-100, Triton N101, cetyltrimethylammonium bromide, Tergitol NP9, etc.
  • Conventional means for inactivating influenza virions include treatment with an effective amount of one or more of the following agents: detergents, formaldehyde, formalin, ⁇ -propiolactone, or UV light. Additional chemical means for inactivation include treatment with methylene blue, psoralen, carboxyfullerene (C60) or a combination of any thereof. Other methods of viral inactivation are known in the art, such as for example binary ethylamine, acetyl ethyleneimine, or gamma irradiation.
  • the combined influenza-COVID-19 vaccines of the invention may comprise or be produced using any influenza vaccine, including any commercially available influenza vaccine, a universal influenza vaccine and/or a pandemic influenza vaccine.
  • influenza virus strains for use in vaccines change from season to season.
  • vaccines typically include two influenza A strains (H1N1 and H3N2) and one influenza B strain (B/Colorado/06/2017-like (Victoria lineage) virus), and trivalent vaccines against seasonal influenza (seasonal trivalent influenza vaccines) are typical.
  • Quadrivalent vaccines against seasonal influenza seasonal quadrivalent influenza vaccines
  • the seasonal quadrivalent influenza vaccines include the same strains as the seasonal trivalent influenza vaccines, with the inclusion of an additional influenza B strain (B/Phuket/3073/2013–like virus (Yamagata lineage)).
  • Any seasonal influenza vaccine including seasonal trivalent and quadrivalent influenza vaccines may be comprised in or used to produce the combined influenza-COVID-19 vaccines of the invention.
  • Regulatory approved seasonal influenza vaccines are identified on the websites Centers for Disease Control and Prevention (CDC) (the CDC 2019-2020 list is provided here: https://www.cdc.gov/flu/professionals/acip/summary/summary- recommendations.htm#composition) and the European Medicines Agency (EMA).
  • a pandemic influenza vaccine may be comprised in or used to produce the combined influenza-COVID-19 vaccines of the invention.
  • Pandemic influenza vaccines are raised against pandemic influenza strains, which are strains to which the vaccine recipient and the general human population are immunologically na ⁇ ve, such as H2, H5, H7 or H9 subtype strains (in particular of influenza A virus). Pandemic influenza virus strains often arise in non-human species which then jump the species barrier to humans.
  • a recent example of a potential pandemic influenza strain is the genotype 4 (G4) Eurasian avian-like (EA) H1N1 swine influenza strain.
  • the combined influenza- COVID-19 vaccines of the invention may comprise an influenza component which is directed to such species-jumping pandemic strains, such as G4 EA H1N1.
  • Pandemic influenza vaccines may be monovalent or may be based on a trivalent vaccine, supplemented by a pandemic strain. Monovalent pandemic influenza vaccines may be preferred.
  • a universal influenza vaccine may be comprised in or used to produce the combined influenza-COVID-19 vaccines of the invention. Examples of universal influenza vaccines under development include subunit vaccines and two-stage vaccines comprising a priming DNA vaccine and a live vectored vaccine.
  • influenza component of the combined influenza-COVID-19 vaccines of the invention may protect against one or more of influenza A virus hemagglutinin subtypes H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15 or H16.
  • the invention may protect against one or more of influenza A virus NA subtypes N1, N2, N3, N4, N5, N6, N7, N8 or N9.
  • the influenza component of the combined influenza-COVID-19 vaccines of the invention may include HA and/or NA (or immunogenic fragments thereof) from one or more (e.g.1, 2, 3, 4 or more) influenza strains, including influenza A virus and/or influenza B virus.
  • the viruses used as the source of the influenza HA and/or NA or the influenza vaccines which form the influenza component of the combined influenza-COVID-19 vaccines can be grown either on eggs or on cell culture.
  • the current standard method for influenza virus growth uses specific pathogen-free (SPF) embryonated hen eggs, with virus being purified from the egg contents (allantoic fluid). More recently, however, viruses have been grown in animal cell culture and, for reasons of speed and patient allergies, this growth method is preferred.
  • SPPF pathogen-free
  • the viral growth substrate will typically be a cell line of mammalian origin. Suitable mammalian cells of origin include, but are not limited to, hamster, cattle, primate (including humans and monkeys) and dog cells. Various cell types may be used, such as kidney cells, fibroblasts, retinal cells, lung cells, etc. Suitable cell lines include, but are not limited to: MDCK; CHO; 293T; BHK; Vero; MRC-5; PER.C6; WI-38; etc..
  • Preferred mammalian cell lines for growing influenza viruses include: MDCK cells derived from Madin Darby canine kidney which are available e.g. from the American Type Cell Culture (ATCC) collection as CCL-34. Derivatives of the MDCK cell line may also be used. Where virus has been grown on a mammalian cell line then the composition will advantageously be free from egg proteins (e.g. ovalbumin and ovomucoid) and from chicken DNA, thereby reducing allergenicity.
  • MDCK cells derived from Madin Darby canine kidney which are available e.g. from the American Type Cell Culture (ATCC) collection as CCL-34. Derivatives of the MDCK cell line may also be used. Where virus has been grown on a mammalian cell line then the composition will advantageously be free from egg proteins (e.g. ovalbumin and ovomucoid) and from chicken DNA, thereby reducing allergenicity.
  • egg proteins e.g. ovalbumin and ovomucoi
  • compositions and Therapeutic Indications As described herein, the present inventors have demonstrated that vaccine compositions comprising SARS-CoV-2 antigens, particularly SARS-CoV-2 spike protein can be successfully combined with influenza virus vaccines, to generate robust antibody responses to both SARS-CoV-2 and influenza.
  • the present inventions have surprisingly demonstrated that it is possible to produce combined influenza-COVID-19 vaccines with none of the expected problems of vaccine component suppression which are common in the production of combination vaccine products. Accordingly, the present invention provides a combined influenza-COVID-19 vaccine as described herein.
  • the invention provides a composition comprising (i) an influenza HA antigen or immunogenic fragment thereof; (ii) one or more antigen derived from SARS-CoV-2 (particularly at least one SARS-CoV-2 spike protein) or an immunogenic fragment thereof; and optionally (iii) an influenza NA antigen or immunogenic fragment thereof; wherein said composition is capable of inducing an immune response against SARS-CoV-2 (particularly against SARS-CoV-2 spike protein) and influenza (particularly influenza HA and optionally NA).
  • the invention also provides the use of such a composition as a vaccine.
  • the invention also provides a vaccine composition
  • a vaccine composition comprising (i) an influenza HA antigen or immunogenic fragment thereof; (iii) one or more antigen derived from SARS-CoV-2 (particularly at least one SARS-CoV-2 spike protein) or an immunogenic fragment thereof; and optionally (iii) an influenza NA antigen or immunogenic fragment thereof.
  • the vaccine composition may optionally comprise a pharmaceutically acceptable excipient, diluent, carrier, propellant, salt and/or additive.
  • the vaccine composition may comprise at least two different antigens derived from SARS- CoV-2 or immunogenic fragments thereof according to the invention, and/or at least two different polynucleotide molecules encoding at least two different antigens derived from SARS-CoV-2 or immunogenic fragments, as described herein.
  • the vaccine composition may comprise a polynucleotide encoding a SARS-CoV-2 spike protein and a polynucleotide encoding a SARS-CoV-2 membrane protein.
  • the vaccine composition may comprise at least two different antigens derived from influenza or immunogenic fragments thereof according to the invention, and/or at least two different polynucleotide molecules encoding at least two different antigens derived from influenza or immunogenic fragments, as described herein.
  • the vaccine composition comprises an influenza HA antigen or immunogenic fragment thereof and optionally an influenza NA antigen or immunogenic fragment thereof.
  • influenza component of the combined influenza-COVID-19 vaccines of the invention is typically provided by a live (attenuated or vectored) or inactivated influenza vaccine comprising whole or split influenza virions, other influenza antigens may also be included.
  • the present invention also provides a method of stimulating or inducing an immune response in a patient using a combined influenza-COVID-19 vaccine or composition of the invention (as described above).
  • the vaccines and compositions of the present invention typically stimulate or induce an immune response and/or protection against both influenza and COVID-19.
  • Said method of stimulating or inducing an immune response in a subject may comprise administering a combined influenza-COVID-19 vaccine or composition of the invention (as described above) to a subject.
  • a “subject” is any animal subject that would benefit from stimulation or induction of an immunoprotective response against SARS-CoV-2 and influenza. Typical animal subjects are mammals, such as primates, for example, humans.
  • the present invention provides a method for treating or preventing SARS-CoV-2 infection (COVID-19) and influenza infection.
  • Said method typically comprises the administration of a combined influenza-COVID-19 vaccine or composition of the invention to a subject in need thereof.
  • the present invention also provides a combined influenza-COVID-19 vaccine or composition of the invention for use in prevention or treatment of SARS-CoV-2 infection.
  • the present invention also provides the use of (i) one or more polynucleotide, expression construct, viral vector, DNA plasmid or RNA vaccine which expresses one or more SARS-CoV-2 spike protein or immunogenic fragment thereof, or one or more SARS-CoV-2 spike protein or immunogenic fragment thereof, one or more SARS-CoV-2 vaccine composition of the invention; and (ii) an influenza HA or immunogenic fragment thereof (and optionally an influenza NA or immunogenic fragment thereof), preferably comprised in an influenza vaccine as described herein, for the manufacture of a medicament for the prevention or treatment of SARS-CoV-2 infection and influenza infection.
  • the term “treatment” or “treating” embraces therapeutic or preventative/prophylactic measures, and includes post-infection therapy and amelioration of a SARS-CoV-2 infection and influenza infection.
  • the terms “therapy” and “therapeutic” embrace prophylactic therapy.
  • the term “preventing” includes preventing the initiation of infection by SARS-CoV-2 and influenza and/or reducing the severity or intensity of an infection by SARS-CoV-2 and influenza.
  • the term “preventing” includes inducing or providing protective immunity against infection by SARS-CoV-2 and influenza infection. Immunity to infection by a SARS-CoV-2 and influenza infection may be quantified using any appropriate technique, examples of which are known in the art.
  • compositions of the invention satisfy 1, 2 or 3 of the CPMP criteria for efficacy.
  • these criteria are: (1) ⁇ 70% seroprotection; (2) ⁇ 40% seroconversion; and/or (3) a GMT increase of ⁇ 2.5-fold.
  • these criteria are: (1) ⁇ 60% seroprotection; (2) ⁇ 30% seroconversion; and/or (3) a GMT increase of ⁇ 2-fold.
  • a combined influenza-COVID-19 vaccine or composition of the invention as defined herein may be administered to a subject (typically a mammalian subject such as a human or other primate) already having a SARS-CoV-2 infection and/or an influenza infection, a condition or symptoms associated with infection by SARS-CoV-2 and/or influenza infection, to treat or prevent infection by SARS-CoV-2 and or influenza.
  • a subject typically a mammalian subject such as a human or other primate
  • the subject may be suspected of having come in contact with SARS-CoV-2 or influenza, or has had known contact with SARS-CoV-2 or influenza, but is not yet showing symptoms of exposure.
  • the combined influenza-COVID-19 vaccine or composition of the invention as defined herein can cure, delay, reduce the severity of, or ameliorate one or more symptoms, and/or prolong the survival of a subject beyond that expected in the absence of such treatment.
  • a combined influenza-COVID-19 vaccine or composition of the invention as defined herein may be administered to a subject (e.g.
  • a mammal such as a human or other primate
  • who ultimately may be infected with SARS-CoV-2 and/or influenza in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of said SARS-CoV-2 infection and/or influenza, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment, or to help prevent that subject from transmitting a SARS-CoV-2 infection and/or influenza infection.
  • the treatments and preventative therapies of the present invention are applicable to a variety of different subjects of different ages. In the context of humans, the therapies are applicable to children (e.g. infants, children under 5 years old, older children or teenagers) and adults. In the context of other animal subjects (e.g.
  • the therapies are applicable to immature subjects and mature/adult subjects.
  • the term “preventing” includes preventing the initiation of SARS-CoV-2 infection and/or influenza infection; and/or reducing the severity or intensity of a SARS-CoV-2 infection and/or influenza infection.
  • the term “preventing” includes inducing or providing protective immunity against SARS-CoV-2 infection and/or influenza infection. Immunity to SARS-CoV-2 infection and/or influenza infection may be quantified using any appropriate technique, examples of which are known in the art.
  • a “vaccine” is a formulation that, when administered to an animal subject such as a mammal (e.g.
  • a human or other primate stimulates a protective immune response against SARS-CoV-2 infection and/or influenza infection.
  • the immune response may be a humoral and/or cell-mediated immune response.
  • a vaccine of the invention can be used, for example, to protect a subject from the effects of SARS-CoV-2 infection and/or influenza infection.
  • the evidence available to-date indicates that immunity following SARS- CoV-2 infection may be relatively short-lived. Therefore, the invention provides the means of boosting immunity to SARS-CoV-2 infection by regular repeated administration of COVID-19/SARS- CoV-2 vaccine, in particular a combined influenza-COVID-19 vaccine of the invention. This repeated administration may use or be integrated into existing public health programs/schedules for seasonal influenza vaccination.
  • the invention provides a combined influenza-COVID-19 vaccine of the invention for use in the treatment and/or prevention of COVID-19 and influenza, wherein the combined vaccine is for administration at intervals of about six months, about seven months, about eight months, about nine months, about ten months, about 11 months, about 12 months, about 13 months, about 14 months or about 15 months.
  • the combined vaccine is for administration at intervals of about 11 months, about 12 months, about 13 months, most preferable about 12 months.
  • the invention also provides a method of immunising a subject against both influenza and COVID-19 comprising administering to said subject a therapeutically effective amount of a combined influenza-COVID-19 vaccine of the invention at these same intervals.
  • the invention also provides the use of an influenza HA or an immunogenic fragment thereof; an antigen derived from SARS-CoV-2 or an immunogenic fragment thereof, and optionally an influenza NA or an immunogenic fragment thereof in the manufacture of a medicament for use in the treatment and/or prevention of COVID-19 and influenza, wherein said medicament is for administration at these same intervals.
  • the combined vaccine may be administered at an interval as described herein at least twice, at least five times, at least ten times, at least 15 times, at least 20 times or more.
  • the combined vaccine may be administered at an interval as described herein for a duration of at least two years, at least five years, at least ten years or more, up to the lifetime of a patient.
  • compositions and Formulations The term “vaccine” is herein used interchangeably with the terms “therapeutic/prophylactic composition”, “formulation” or “medicament”.
  • the vaccine of the invention (as defined above) can be combined or administered in addition to a pharmaceutically acceptable carrier. Alternatively or in addition the vaccine of the invention can further be combined with one or more of a salt, excipient, diluent, adjuvant, immunoregulatory agent and/or antimicrobial compound.
  • Pharmaceutically acceptable salts include acid addition salts formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or with organic acids such as acetic, oxalic, tartaric, maleic, and the like.
  • Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
  • Administration of immunogenic compositions, therapeutic formulations, medicaments and prophylactic formulations is generally by conventional routes e.g. intravenous, subcutaneous, intraperitoneal, or mucosal (particularly nasal) routes.
  • the administration may be by parenteral injection, for example, a subcutaneous, intradermal or intramuscular injection.
  • immunogenic compositions, therapeutic formulations, medicaments and prophylactic formulations (e.g. vaccines) of the invention are typically prepared as injectables, either as liquid solutions or suspensions.
  • Solid forms suitable for solution in, or suspension in, liquid prior to injection may alternatively be prepared.
  • the preparation may also be emulsified, or the peptide encapsulated in liposomes or microcapsules.
  • the active immunogenic ingredients (such as the SARS-CoV-2 spike proteins, fragments thereof, nucleic acids encoding said spike proteins, expression vectors, virial vectors, DNA plasmids, RNA vaccines, fusion proteins and vaccine compositions and the influenza HA and/or NA antigens or influenza vaccines as described herein) are often mixed with carriers, diluents, excipients or similar which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol, or the like and combinations thereof.
  • the vaccine may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and/or adjuvants which enhance the effectiveness of the vaccine.
  • the carrier, diluent, excipient or similar is a pharmaceutically-acceptable carrier.
  • pharmaceutically acceptable carriers include water, saline, and phosphate- buffered saline.
  • the composition is in lyophilized form, in which case it may include a stabilizer, such as BSA.
  • buffering agents include, but are not limited to, sodium succinate (pH 6.5), and phosphate buffered saline (PBS; pH 6.5 and 7.5).
  • Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations or formulations suitable for distribution as aerosols.
  • suppositories traditional binders and carriers may include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1%-2%.
  • Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders.
  • Adjuvants Whilst conventional influenza vaccines do not comprise an adjuvant, the combined influenza-COVID-19 vaccine of the invention may further comprise an adjuvant. Said adjuvant may be a stimulator of cellular (Th1) and/or humoral (Th2) immune responses.
  • additional adjuvants which may be effective include but are not limited to: complete Freunds adjuvant (CFA), Incomplete Freunds adjuvant (IFA), Saponin, a purified extract fraction of Saponin such as Quil A, a derivative of Saponin such as QS-21, lipid particles based on Saponin such as ISCOM/ISCOMATRIX, E.
  • CFA complete Freunds adjuvant
  • IFA Incomplete Freunds adjuvant
  • Saponin a purified extract fraction of Saponin such as Quil A
  • QS-21 a derivative of Saponin
  • lipid particles based on Saponin such as ISCOM/ISCOMATRIX
  • coli heat labile toxin (LT) mutants such as LTK63 and/ or LTK72, aluminium hydroxide, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor- muramyl-L-alanyl-D-isoglutamine (CGP 11637, referred to as nor-MDP), N-acetylmuramyl-L-alanyl-D- isoglutaminyl-L-alanine-2-(1'-2'-dipalmitoyl-sn-glycero-3-hydroxyphosphoryl oxy)-ethylamine (CGP 19835A, referred to as MTP-PE), and RIBI, which contains three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2 % squalene/ Tween 80
  • Adjuvants typically present in a combined influenza-COVID-19 vaccine of the invention may be selected from squalene oil-in-water emulsions, aluminium salts and monophosphoryl Lipid A (MPL). Particularly preferred adjuvants include Addavax®, 5% squalene (MF59), MPL and aluminium hydroxide and aluminium phosphate gel. Kits
  • the invention provides kits comprising the combined influenza-COVID-19 vaccines of the invention, optionally with instructions for use. Any adjuvant may be contained separate from the combined vaccine within the kit or may be combined with the combined vaccine.
  • the combined vaccine in a kit may be ready for use (e.g. including the adjuvant), or may be ready for extemporaneous preparation (e.g.
  • kits of parts comprising the SARS-CoV-2 component of the combined vaccine and the influenza component of the combined vaccine.
  • the two components may be separate within the kit.
  • Any adjuvant may be contained separate within the kit or may be combined with either the SARS-CoV-2 component or the influenza component.
  • the components may be mixed prior to administration to a patient, or the components may remain separate but be administered to a patient substantially at the same time or simultaneously.
  • kits of parts comprising the SARS-CoV-2 component of the combined vaccine and an adjuvant, preferably a squalene oil-in-water emulsion, an aluminium salt or MPL, more preferably Addavax®, MF59, MPL or aluminium hydroxide and aluminium phosphate gel.
  • the kit of parts may include instructions regarding the combining of the SARS-CoV-2 component and adjuvant with an existing influenza vaccine (examples of which are described herein) and administering the combined influenza-COVID-19 vaccine as a single unit, or administering the mixed SARS-CoV-2 and adjuvant to a patient substantially at the same time or simultaneously to the influenza vaccine.
  • the SARS-CoV-2 component and/or the influenza component in a kit may be ready for use, or may be ready for extemporaneous preparation at the time of delivery.
  • This extemporaneous arrangement allows the adjuvant and the SARS-CoV-2 and/or influenza components to be kept separately until the time of use, which is particularly useful when using an oil-in-water emulsion adjuvant.
  • a vaccine is prepared extemporaneously, its components are physically separate from each other within the kit, and this separation can be achieved in various ways.
  • the two components may be in two separate containers, such as vials. The contents of the two vials can then be mixed e.g.
  • one of the kit components is in a syringe and the other is in a container such as a vial.
  • the syringe can be used (e.g. with a needle) to insert its contents into the second container for mixing, and the mixture can then be withdrawn into the syringe.
  • the mixed contents of the syringe can then be administered to a patient, typically through a new sterile needle. Packing one component in a syringe eliminates the need for using a separate syringe for patient administration.
  • the two components of a vaccine are held together but separately in the same syringe e.g. a dual-chamber syringe.
  • the syringe When the syringe is actuated (e.g. during administration to a patient) then the contents of the two chambers are mixed.
  • This arrangement avoids the need for a separate mixing step at the time of use.
  • a vaccine is prepared extemporaneously (either by mixing the combined vaccine with an adjuvant, or by mixing the SARS-CoV-2 component and the influenza component, optionally with an adjuvant), its components will generally be in aqueous form.
  • a component (typically the combined vaccine or the SARS-CoV-2 component and/or the influenza component of said vaccine, rather than the adjuvant component) is in dry form (e.g. in a lyophilised form), with one or more of the other components being in aqueous form.
  • the components can be mixed in order to reactivate the dry component and give an aqueous composition for administration to a patient.
  • SEQUENCE HOMOLOGY Any of a variety of sequence alignment methods can be used to determine percent identity, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art.
  • Non-limiting methods include, e.g., CLUSTAL W, see, e.g., Julie D. Thompson et al., CLUSTAL W: Improving the Sensitivity of Progressive Multiple Sequence Alignment Through Sequence Weighting, Position-Specific Gap Penalties and Weight Matrix Choice, 22(22) Nucleic Acids Research 4673-4680 (1994); and iterative refinement, see, e.g., Osamu Gotoh, Significant Improvement in Accuracy of Multiple Protein.
  • Conservative amino acid substitutions Basic arginine lysine histidine Acidic: glutamic acid aspartic acid Polar: glutamine asparagine Hydrophobic: leucine isoleucine valine Aromatic: phenylalanine tryptophan tyrosine Small: glycine alanine serine threonine methionine
  • non-standard amino acids such as 4- hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric acid, isovaline and a -methyl serine
  • non-standard amino acids such as 4- hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric acid, isovaline and a -methyl serine
  • a limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, and unnatural amino acids may be substituted for polypeptide amino acid residues in the SARS-CoV-2 antigens of the invention.
  • the polypeptides of the present invention can also comprise non-naturally occurring amino acid residues.
  • Non-naturally occurring amino acids include, without limitation, trans-3-methylproline, 2,4- methano-proline, cis-4-hydroxyproline, trans-4-hydroxy-proline, N-methylglycine, allothreonine, methyl-threonine, hydroxy-ethylcysteine, hydroxyethylhomo-cysteine, nitroglutamine, homoglutamine, pipecolic acid, tert-leucine, norvaline, 2-azaphenylalanine, 3-azaphenyl-alanine, 4- azaphenyl-alanine, and 4-fluorophenylalanine.
  • Several methods are known in the art for incorporating non-naturally occurring amino acid residues into proteins.
  • an in vitro system can be employed wherein nonsense mutations are suppressed using chemically aminoacylated suppressor tRNAs.
  • Methods for synthesizing amino acids and aminoacylating tRNA are known in the art. Transcription and translation of plasmids containing nonsense mutations is carried out in a cell free system comprising an E. coli S30 extract and commercially available enzymes and other reagents. Proteins are purified by chromatography. See, for example, Robertson et al., J. Am. Chem.
  • coli cells are cultured in the absence of a natural amino acid that is to be replaced (e.g., phenylalanine) and in the presence of the desired non-naturally occurring amino acid(s) (e.g., 2-azaphenylalanine, 3- azaphenylalanine, 4-azaphenylalanine, or 4- fluorophenylalanine).
  • a natural amino acid that is to be replaced e.g., phenylalanine
  • the desired non-naturally occurring amino acid(s) e.g., 2-azaphenylalanine, 3- azaphenylalanine, 4-azaphenylalanine, or 4- fluorophenylalanine.
  • the non-naturally occurring amino acid is incorporated into the polypeptide in place of its natural counterpart. See, Koide et al., Biochem.33:7470-6, 1994.
  • Naturally occurring amino acid residues can be converted to non-naturally occurring species by in vitro chemical modification.
  • Chemical modification can be combined with site-directed mutagenesis to further expand the range of substitutions (Wynn and Richards, Protein Sci.2:395-403, 1993).
  • a limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, non-naturally occurring amino acids, and unnatural amino acids may be substituted for amino acid residues of polypeptides of the present invention.
  • Essential amino acids in the polypeptides of the present invention can be identified according to procedures known in the art, such as site-directed mutagenesis or alanine scanning mutagenesis (Cunningham and Wells, Science 244: 1081-5, 1989).
  • Sites of biological interaction can also be determined by physical analysis of structure, as determined by such techniques as nuclear magnetic resonance, crystallography, electron diffraction or photoaffinity labelling, in conjunction with mutation of putative contact site amino acids. See, for example, de Vos et al., Science 255:306- 12, 1992; Smith et al., J. Mol. Biol.224:899-904, 1992; Wlodaver et al., FEBS Lett.309:59-64, 1992.
  • the identities of essential amino acids can also be inferred from analysis of homologies with related components (e.g. the translocation or protease components) of the polypeptides of the present invention.
  • Antibody titres were measured by ELISA against the receptor binding domain ( RBD) of the SARS- CoV-2 spike protein (COVID-19 antigen) and against H1N1, H3N2 and B antigens of influenza virus. Antibody titres against influenza antigens are shown in Table 1. Antibody titres against the SARS- CoV-2 spike protein are shown in Table 2. All vaccines elicited a strong antibody response. The use of an adjuvant containing combined influenza-COVID-19 vaccine was able to elicit strong antibody responses against both influenza and the SARS-CoV-2 spike protein, with no evidence of component suppression.
  • Table 1 Antibody titres against influenza antigens
  • Table 2 Antibody titres against SARS-CoV-2 spike protein
  • Example 2 Comparison of immunogenicity of a commercial flu vaccine (Vaxigrip) alone, and a COVID-19 vaccine (full-size spike protein conjugated to HBSAg) alone with a combined Flu-Covid- 19 vaccine Fusion proteins of HBSAg and full-length SARS-CoV-2 spike protein (with an (EAAAK)3 linker) was expressed recombinantly in HEK cells. The recombinant expression was carried out in two independent experiments, with the medium from 5 clones (experiment 1) and 4 clones (experiment 2) pooled and assessed for fusion protein expression as shown in Figure 2.
  • the pooled medium from 5 clones (experiment 1) was designated HBSAg-(EAAAK)3-Cov-S D8-SA01-02-01 (5x) HBSAg.
  • the pooled medium from 4 clones (experiment 2) was designated HBSAg-(EAAAK) 3 -Cov-S D8-SA01-01-01 (4x) HBSAg.
  • the total protein content of both fusion protein pools was determined by Bradford assay and adjusted to 1 mg/ml in a total volume of 100ml.
  • mice were immunised with either HBSAg-(EAAAK)3-Cov-S D8-SA01-02-01 (5x) HBSAg or HBSAg-(EAAAK)3-Cov-S D8-SA01-01-01 (4x) HBSAg, either alone or in combination with Vaxigrip influenza vaccine.
  • the COVID-19/’flu/combination vaccines were administered either without adjuvant, with Alu-280 adjuvant or Adda-Vax adjuvant as shown in Table 3 below.
  • Immunisation with HBSAg-(EAAAK) 3 -Cov-S D8-SA01-02-01 (5x) or HBSAg-(EAAAK) 3 -Cov-S D8- SA01-01-01 (4x) was carried out using 50 ⁇ g/dose (volume 100 ⁇ l). Immunisation with the influenza vaccine was carried out using 1.5 ⁇ g/dose (volume 50 ⁇ l). Where either adjuvant was used, a 1:1 v/v vaccine:adjuvant ratio was used (totalling 100 ⁇ l for adjuvant+1 vaccine; or 150 ⁇ l for adjuvant+2 vaccines). Mice were immunised on day 0, with boosts at day 7, 14 and 28. Serum samples were obtained on day 14, and following sacrifice on day 42.
  • the spleens of the immunised mice were also isolated for testing after sacrifice. Antibody titres were measured by ELISA against the receptor binding domain (RBD) of the SARS-CoV-2 spike protein (COVID-19 antigen). As shown in Figure 3 below, in all experimental groups (groups 1, 3-9 and 11), observable titres of anti- HBSAg-(EAAAK) 3 -Cov-S IgG were present 14 days after the priming immunisation, compared with the PBS control group (group 10) or the influenza vaccine alone (group 2).
  • the titre of anti-COVID spike protein IgG quantified using ELISA was (alone or in combination with Vaxigrip) was compared with the IgG produced against a similar fusion protein containing only the receptor-binding domain (RBD) of the SARS-CoV-2 spike protein, HBSAg-(EAAAK)3-Cov-S.
  • RBD receptor-binding domain
  • HBSAg-(EAAAK)3-Cov-S alone is shown in Figure 4A, and compared with HBSAg-(EAAAK)3-Cov-S D8-SA01-02-01 (5x) in Figure 4B.
  • Higher titres were obtained using the RBD-fusions ( Figure 4B).
  • Antibody titres were measured again 42 days after the priming immunisation.
  • the titre of anti-COVID spike protein IgG quantified using ELISA was (alone or in combination with Vaxigrip) was compared with the IgG produced against a similar fusion protein containing only the receptor-binding domain (RBD) of the SARS-CoV-2 spike protein, HBSAg-(EAAAK)3-Cov-S.
  • RBD receptor-binding domain
  • Data for HBSAg-(EAAAK)3-Cov-S alone at day 42 is shown in Figure 5A, and compared with HBSAg- (EAAAK)3-Cov-S D8-SA01-02-01 (5x) and HBSAg-(EAAAK)3-Cov-S D8-SA01-01-01 (4x) in Figure 5B.
  • Example 3 Neutralisation assay comparing a commercial flu vaccine (Vaxigrip) alone, and a COVID-19 vaccine (full-size spike protein conjugated to HBSAg) alone with a combined Flu-Covid- 19 vaccine
  • the ability of SARS-CoV-2 fusion proteins, ‘flu vaccine and combined COVID-19-‘flu vaccines of the invention to generate neutralising antibodies against their respective antibodies can be tested using micro-neutralisation assays based on cytopathic effect (MN-CPE). Groups of 5 Balb/c mice were vaccinated with 0.5 ml of each the above vaccines (day 0). Serum samples were taken from the mice on day 0, 14 and 42. 1.
  • Commercial Flu vaccine e.g. Vaxigrip
  • Covid-19 vaccine e.g. HBSAg-(EAAAK)3-Cov-S
  • Addavax adjuvant
  • Vero E6 cells are seeded in 96 well plates and cultured to achieve sub-confluency.
  • the titre of SARS-CoV-2 is calculated using a standard titration assay, and a ten-fold serial dilution (log10) of the SARS-CoV-2 is prepared. Alternatively a 3.16-fold serial dilution (0.5Log10) can be carried out.
  • the serially diluted SARS-CoV-2 is applied to the confluent Vero cells in the 96 well plate.
  • a column of the plate is left untreated with SARS-CoV-2 as a cell control.
  • a sample containing known SARS-CoV-2 specific neutralising antibodies can be used as a positive control, and a human or animal depleted sample may be used as a negative control (e.g. human serum minus IgA/IgM/IgG).
  • the plates are incubated at 37°C, 5% CO2 for 3 days (the incubation time may be varied depending on the SARS-CoV-2 strain and variants). After incubation, the plates are observed under an inverted microscope and wells are scored as positive for SARS-CoV- 2 (i.e.
  • the MN-CPE assay can be carried out.
  • Vero E6 cells are cultured and seeded in 96 well plates as before. Serum samples from the vaccinated mice are heat treated at 56 ⁇ 1 °C for 30 minutes ⁇ 10 minutes. The serum samples from the treated mice are serially diluted, first by 1:10. , and then 2-fold serial dilutions are performed across the rows of the plate.
  • the desired viral titre (one plate for SARS-CoV- 2, one plate for influenza) is added to each well of the plate, following which the plates are incubated at 37 ⁇ 1 °C, 5 ⁇ 1 % CO2 for 1 hour.
  • the virus-serum mixtures are then applied to the sub- confluent pre-cultured Vero E6 cells, and the plates are incubated at 37° ⁇ 1 C, 5% ⁇ 1 CO2 for 3 days (the incubation time may be varied depending on the SARS-CoV-2 strain and variants).
  • the microneutralisation titre (MNt) is the reciprocal of the highest sample dilution that protects from CPE at least 50% of the cells.
  • mice treated with HBSAg-(EAAAK) 3 -Cov-S demonstrates effective neutralisation and inhibition of the CPE in Vero cells.
  • mice treated with the influenza vaccine produce serum with neutralisation activity against influenza.
  • mice are treated with a combination of and HBSAg-(EAAAK)3-Cov-S an influenza vaccine neutralisation is achieved against both SARS-CoV-2 and influenza, demonstrating that there is no component suppression when using a combined SARS-CoV-2 and influenza vaccine.
  • the experiment is repeated using a combination of a SARS-CoV-2 RBD fragment vaccine and an influenza vaccine. Again, no component suppression is observed.
  • SEQ ID NO: 4 translates to give the native SARS-CoV-2 spike protein of SEQ ID NO: 1 SEQ ID NO: 5 – nucleic acid encoding for fusion protein HPV18L1/SARS-CoV-2 spike protein– optimised for expression in K. pastoris and containing BstB1 and NotI single cloning sites.
  • SEQ ID NO: 6 nucleic acid encoding for fusion protein HPV16L1/SARS-CoV-2 spike protein nucleic – optimised for expression in K. pastoris and containing BstB1 and NotI single cloning sites.
  • SEQ ID NO: 7 SARS-CoV-2 spike protein nucleic acid sequence – optimised for expression in humans (293F) and containing NheI and NotI single cloning sites.
  • SEQ ID NO: 7 translates to give the native SARS-CoV-2 spike protein of SEQ ID NO: 1 SEQ ID NO: 8 – nucleic acid encoding for fusion protein HBSAg/SARS-CoV-2 spike protein– optimised for expression in humans (293F) and containing NheI and NotI single cloning sites.
  • SEQ ID NO: 9 amino acid sequence corresponding to SEQ ID NO: 3 (fusion protein HEV-SARS-CoV-2 spike protein– optimised for expression in E. coli and containing SacI and NotI single cloning sites.) MIALTLFNLADTLLGGLPTELISSAGGQLFYSRPVVSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRVVIQ DYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDW TKVTLDGRPLSTIQQYSKTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAG PVSISAVAVLAPHSAFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSN VTWFHAIH
  • the (EAAAK)3 linker is underlined

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Virology (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Communicable Diseases (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Pulmonology (AREA)
  • Molecular Biology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/IB2021/056102 2020-07-07 2021-07-07 Sars-cov-2 and influenza combination vaccine Ceased WO2022009121A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
CA3184878A CA3184878A1 (en) 2020-07-07 2021-07-07 Sars-cov-2 and influenza combination vaccine
JP2023501632A JP2023533772A (ja) 2020-07-07 2021-07-07 SARS-CoV-2及びインフルエンザ混合ワクチン
KR1020237003756A KR20230049084A (ko) 2020-07-07 2021-07-07 Sars-cov-2 및 인플루엔자 조합 백신
BR112023000323A BR112023000323A2 (pt) 2020-07-07 2021-07-07 Vacina combinada contra sars-cov-2 e influenza
EP21740222.1A EP4178612A1 (en) 2020-07-07 2021-07-07 Sars-cov-2 and influenza combination vaccine
MX2023000411A MX2023000411A (es) 2020-07-07 2021-07-07 Vacuna combinada de sars-cov-2 e influenza.
IL299735A IL299735A (en) 2020-07-07 2021-07-07 Combined vaccine for SARS-COV-2 and INFLUENZA
AU2021303789A AU2021303789A1 (en) 2020-07-07 2021-07-07 SARS-CoV-2 and influenza combination vaccine
CN202180054553.3A CN117957016A (zh) 2020-07-07 2021-07-07 Sars-cov-2与流感联合疫苗
US18/015,025 US20230256085A1 (en) 2020-07-07 2021-07-07 Combination vaccine
CONC2023/0001072A CO2023001072A2 (es) 2020-07-07 2023-01-31 Vacuna combinada de sars-cov-2 e influenza

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB2010425.3A GB2596820A (en) 2020-07-07 2020-07-07 Combination vaccine
GB2010425.3 2020-07-07

Publications (1)

Publication Number Publication Date
WO2022009121A1 true WO2022009121A1 (en) 2022-01-13

Family

ID=72050416

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2021/056102 Ceased WO2022009121A1 (en) 2020-07-07 2021-07-07 Sars-cov-2 and influenza combination vaccine

Country Status (15)

Country Link
US (1) US20230256085A1 (enExample)
EP (1) EP4178612A1 (enExample)
JP (1) JP2023533772A (enExample)
KR (1) KR20230049084A (enExample)
CN (1) CN117957016A (enExample)
AR (1) AR122899A1 (enExample)
AU (1) AU2021303789A1 (enExample)
BR (1) BR112023000323A2 (enExample)
CA (1) CA3184878A1 (enExample)
CO (1) CO2023001072A2 (enExample)
GB (1) GB2596820A (enExample)
IL (1) IL299735A (enExample)
MX (1) MX2023000411A (enExample)
TW (1) TW202207979A (enExample)
WO (1) WO2022009121A1 (enExample)

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022221440A1 (en) * 2021-04-14 2022-10-20 Modernatx, Inc. Influenza-coronavirus combination vaccines
US11547673B1 (en) 2020-04-22 2023-01-10 BioNTech SE Coronavirus vaccine
US11576961B2 (en) 2017-03-15 2023-02-14 Modernatx, Inc. Broad spectrum influenza virus vaccine
CN115992101A (zh) * 2023-03-22 2023-04-21 深圳市卫光生物制品股份有限公司 一种流感病毒裂解疫苗原液的制备方法
CN116327910A (zh) * 2023-03-31 2023-06-27 北京吉诺卫生物科技有限公司 一种新冠病毒、流感病毒和/或rsv的联合疫苗、其制备方法与应用
CN116350769A (zh) * 2023-03-31 2023-06-30 北京吉诺卫生物科技有限公司 一种新冠病毒和流感病毒的联合疫苗、其制备方法与应用
US11696946B2 (en) 2016-11-11 2023-07-11 Modernatx, Inc. Influenza vaccine
US11878055B1 (en) 2022-06-26 2024-01-23 BioNTech SE Coronavirus vaccine
WO2024174012A1 (pt) * 2023-02-24 2024-08-29 Instituto Butantan Composição imunogênica, uso da mesma e processo de obtenção de uma composição imunogênica combinada contra covid-19 e influenza sazonal
WO2024232415A1 (ja) * 2023-05-10 2024-11-14 国立大学法人北海道大学 インフルエンザ及びコロナウイルス感染症予防のための混合ワクチン
US12186387B2 (en) 2021-11-29 2025-01-07 BioNTech SE Coronavirus vaccine

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113980140B (zh) * 2020-10-23 2024-06-25 江苏省疾病预防控制中心(江苏省公共卫生研究院) 融合蛋白及其应用
CN113293145B (zh) * 2021-02-01 2022-08-26 上海青赛生物科技有限公司 一种麻疹病毒活载体新冠疫苗
CN113462700B (zh) * 2021-05-07 2023-06-09 杨光华 SARS-CoV-2线性DNA疫苗
CN114717251B (zh) * 2021-08-24 2023-03-24 广州恩宝生物医药科技有限公司 一种用于预防SARS-CoV-2原始株和Beta株的腺病毒载体疫苗
US20240398930A1 (en) * 2021-09-24 2024-12-05 Bharat Biotech International Limited A vaccine for coronavirus and influenza virus, and method for preparation thereof
CN113755644B (zh) * 2021-09-24 2024-05-03 中国科学院武汉病毒研究所 一种检测新型冠状病毒Alpha和Delta突变体试剂盒及应用
CN114891817A (zh) * 2022-04-15 2022-08-12 华南理工大学 一种多聚肽及其制备方法与应用
CN118141906B (zh) * 2024-02-22 2025-08-22 安徽智飞龙科马生物制药有限公司 一种新冠流感联合疫苗及其制备方法

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4518584A (en) 1983-04-15 1985-05-21 Cetus Corporation Human recombinant interleukin-2 muteins
US4737462A (en) 1982-10-19 1988-04-12 Cetus Corporation Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β
WO1992006204A1 (en) 1990-09-28 1992-04-16 Ixsys, Inc. Surface expression libraries of heteromeric receptors
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
WO2012172277A1 (en) 2011-05-25 2012-12-20 Isis Innovation Limited Simian adenovirus and hybrid adenoviral vectors
CN111217917A (zh) * 2020-02-26 2020-06-02 康希诺生物股份公司 一种新型冠状病毒SARS-CoV-2疫苗及其制备方法

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9419979D0 (en) * 1994-10-04 1994-11-16 Medeva Holdings Bv Vaccine compositions
CN1775287A (zh) * 2004-11-16 2006-05-24 北京科兴生物制品有限公司 一种sars流感二价联合疫苗及其制备工艺
GB0822001D0 (en) * 2008-12-02 2009-01-07 Glaxosmithkline Biolog Sa Vaccine
RU2553222C2 (ru) * 2011-02-04 2015-06-10 ЗОИТИС ЭлЭлСи Композиции для лечения и предупреждения комплекса респираторных заболеваний собак
US20130236494A1 (en) * 2012-03-06 2013-09-12 Crucell Holland B.V. Vaccination against influenza
CN107961371B (zh) * 2017-04-19 2020-08-11 武汉博沃生物科技有限公司 季节流感-rsv联合疫苗及其制备方法和应用
CN110974950B (zh) * 2020-03-05 2020-08-07 广州恩宝生物医药科技有限公司 一种用于预防SARS-CoV-2感染的腺病毒载体疫苗
CN111218458B (zh) * 2020-02-27 2020-11-20 珠海丽凡达生物技术有限公司 编码SARS-CoV-2病毒抗原的mRNA和疫苗及疫苗的制备方法

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4737462A (en) 1982-10-19 1988-04-12 Cetus Corporation Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β
US4518584A (en) 1983-04-15 1985-05-21 Cetus Corporation Human recombinant interleukin-2 muteins
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
WO1992006204A1 (en) 1990-09-28 1992-04-16 Ixsys, Inc. Surface expression libraries of heteromeric receptors
WO2012172277A1 (en) 2011-05-25 2012-12-20 Isis Innovation Limited Simian adenovirus and hybrid adenoviral vectors
CN111217917A (zh) * 2020-02-26 2020-06-02 康希诺生物股份公司 一种新型冠状病毒SARS-CoV-2疫苗及其制备方法

Non-Patent Citations (46)

* Cited by examiner, † Cited by third party
Title
"Bayesian Methods for Nonlinear Classification and Regression (Wiley Series in Probability and Statistics", July 2002, JOHN WILEY & SONS
"Genbank", Database accession no. MN908947
ALTSCHUL ET AL., BULL. MATH. BIO., vol. 48, 1986, pages 603 - 16
ANONYMOUS: "An Early Look at Vaccines for COVID-19 - The Native Antigen Company", 14 April 2020 (2020-04-14), pages 1 - 43, XP055823973, Retrieved from the Internet <URL:https://thenativeantigencompany.com/an-early-look-at-vaccines-for-covid-19/> [retrieved on 20210713] *
BAUER ET AL., GENE, vol. 37, 1985, pages 73
BOWIESAUER, PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 2152 - 6
C. E. LAWRENCE ET AL.: "Detecting Subtle Sequence Signals: A Gibbs Sampling Strategy for Multiple Alignment", SCIENCE, vol. 262, no. 5131, 1993, pages 208 - 214, XP001152872, DOI: 10.1126/science.8211139
CAI ET AL., SCIENCE, vol. 369, 2020, pages 1586 - 1592
CHABANON ANNE LAURE ET AL: "Report from enhanced safety surveillance of two influenza vaccines (Vaxigrip and Intanza 15 [mu]g) in two European countries during influenza season 2016/17 and comparison with 2015/16 season", HUMAN VACCINES & IMMUNOTHERAPEUTICS, vol. 14, no. 2, 1 February 2018 (2018-02-01), US, pages 378 - 385, XP055839979, ISSN: 2164-5515, Retrieved from the Internet <URL:https://www.tandfonline.com/doi/pdf/10.1080/21645515.2017.1405882?needAccess=true> DOI: 10.1080/21645515.2017.1405882 *
CHOTHIALESK: "Canonical Structures for the Hypervariable Regions of Immunoglobulins", J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHUNG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 10145 - 9
CHUNG ET AL., SCIENCE, vol. 259, 1993, pages 806 - 9
CRAIK, BIOTECHNIQUES, January 1985 (1985-01-01), pages 12 - 19
CUNNINGHAMWELLS, SCIENCE, vol. 244, 1989, pages 1081 - 5
DE VOS ET AL., SCIENCE, vol. 255, 1992, pages 306 - 12
DERBYSHIRE ET AL., GENE, vol. 46, 1986, pages 145
EDELMAN, G.M. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 63, 1969, pages 78 - 85
ELLMAN ET AL., METHODS ENZYMOL., vol. 202, 1991, pages 301
ERIC DEPIEREUXERNEST FEYTMANS: "Match-Box: A Fundamentally New Algorithm for the Simultaneous Alignment of Several Protein Sequences", CABIOS, vol. 8, no. 5, 1992, pages 501 - 509
GHOSE, ARUP K. ET AL.: "Combinatorial Library Design and Evaluation Principles", SOFTWARE, TOOLS, AND APPLICATIONS IN DRUG DISCOVERY, ISBN: 0-8247-0487-8
GRGACIC ET AL., METHODS, vol. 40, 2006, pages 60 - 65
HAJITOU ET AL., CELL, vol. 125, no. 2, 2006, pages 385 - 398
HENIKOFFHENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915 - 19
IVO VAN WALLE ET AL.: "Align-M - A New Algorithm for Multiple Alignment of Highly Divergent Sequences", BIOINFORMATICS, vol. 20, no. 9, 2004, pages 1428 - 1435
JULIE D. THOMPSON ET AL.: "CLUSTAL W: Improving the Sensitivity of Progressive Multiple Sequence Alignment Through Sequence Weighting, Position-Specific Gap Penalties and Weight Matrix Choice", NUCLEIC ACIDS RESEARCH, vol. 22, no. 22, 1994, pages 4673 - 4680, XP002956304
KANDEL, ABRAHAM ET AL.: "Computer-Assisted Reasoning in Cluster Analysis", 11 May 1995, PRENTICE HALL PTR
KOIDE ET AL., BIOCHEM., vol. 33, 1994, pages 7470 - 6
KORBER ET AL., BIORXIV, Retrieved from the Internet <URL:https://doi.org/10.1101/2020.04.29.069054>
KRZANOWSKI, WOJTEK: "Principles of Multivariate Analysis: A User's Perspective (Oxford Statistical Science Series, No 22 (Paper", December 2000, OXFORD UNIVERSITY PRESS
LEFRANC ET AL.: "IMGT Unique Numbering for Immunoglobulin and Cell Receptor Variable Domains and Ig superfamily V-like domains", DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77, XP055585227, DOI: 10.1016/S0145-305X(02)00039-3
LONG ET AL., NAT. MED., 2020, Retrieved from the Internet <URL:https://doi.org/10.1038/s41591-020-0965-6>
LOWMAN ET AL., BIOCHEM., vol. 30, 1991, pages 10832 - 7
NER ET AL., DNA, vol. 7, 1988, pages 127
NOADROY, TRENDS IN MICROBIOLOGY, vol. 11, 2003, pages 438 - 444
NORMAN ET AL.: "Applied Regression Analysis", April 1998, WILEY-INTERSCIENCE
OSAMU GOTOH: "Significant Improvement in Accuracy of Multiple Protein. Sequence Alignments by Iterative Refinement as Assessed by Reference to Structural Alignments", J. MOL. BIOL., vol. 264, no. 4, 1996, pages 823 - 838
REIDHAAR-OLSONSAUER, SCIENCE, vol. 241, 1988, pages 53 - 7
ROBERTSON ET AL., J. AM. CHEM. SOC., vol. 113, 1991, pages 2722
SAHA ET AL., CHEMRXIV, Retrieved from the Internet <URL:http://doi.org/10.26434/chemrxiv.12320567.vl>
SMITH ET AL., J. MOL. BIOL., vol. 224, 1992, pages 899 - 904
SMITH ET AL.: "Genetic Engineering: Principles and Methods", 1981, PLENUM PRESS
TURCATTI ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 19991 - 8
WITTEN, IAN H. ET AL.: "Data Mining: Practical Machine Learning Tools and Techniques with Java Implementations", 11 October 1999, MORGAN KAUFMANN
WLODAVER ET AL., FEBS LETT., vol. 309, 1992, pages 59 - 64
WOLD ET AL.: "Chemometrics-Mathematics and Statistics in Chemistry", 1984, D. REIDEL PUBLISHING COMPANY, article "Multivariate data analysis in chemistry"
WYNNRICHARDS, PROTEIN SCI., vol. 2, 1993, pages 395 - 403

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11696946B2 (en) 2016-11-11 2023-07-11 Modernatx, Inc. Influenza vaccine
US12409218B2 (en) 2016-11-11 2025-09-09 Modernatx, Inc. Influenza vaccine
US12318443B2 (en) 2016-11-11 2025-06-03 Modernatx, Inc. Influenza vaccine
US11576961B2 (en) 2017-03-15 2023-02-14 Modernatx, Inc. Broad spectrum influenza virus vaccine
US12133899B2 (en) 2020-04-22 2024-11-05 BioNTech SE Coronavirus vaccine
US11547673B1 (en) 2020-04-22 2023-01-10 BioNTech SE Coronavirus vaccine
US11779659B2 (en) 2020-04-22 2023-10-10 BioNTech SE RNA constructs and uses thereof
US11925694B2 (en) 2020-04-22 2024-03-12 BioNTech SE Coronavirus vaccine
US11951185B2 (en) 2020-04-22 2024-04-09 BioNTech SE RNA constructs and uses thereof
WO2022221440A1 (en) * 2021-04-14 2022-10-20 Modernatx, Inc. Influenza-coronavirus combination vaccines
US12208136B2 (en) 2021-11-29 2025-01-28 BioNTech SE Coronavirus vaccine
US12186387B2 (en) 2021-11-29 2025-01-07 BioNTech SE Coronavirus vaccine
US11878055B1 (en) 2022-06-26 2024-01-23 BioNTech SE Coronavirus vaccine
WO2024174012A1 (pt) * 2023-02-24 2024-08-29 Instituto Butantan Composição imunogênica, uso da mesma e processo de obtenção de uma composição imunogênica combinada contra covid-19 e influenza sazonal
CN115992101B (zh) * 2023-03-22 2023-07-28 深圳市卫光生物制品股份有限公司 一种流感病毒裂解疫苗原液的制备方法
CN115992101A (zh) * 2023-03-22 2023-04-21 深圳市卫光生物制品股份有限公司 一种流感病毒裂解疫苗原液的制备方法
CN116350769B (zh) * 2023-03-31 2024-07-19 北京吉诺卫生物科技有限公司 一种新冠病毒和流感病毒的联合疫苗、其制备方法与应用
CN116327910B (zh) * 2023-03-31 2024-05-03 北京吉诺卫生物科技有限公司 一种新冠病毒、流感病毒和/或rsv的联合疫苗、其制备方法与应用
CN116350769A (zh) * 2023-03-31 2023-06-30 北京吉诺卫生物科技有限公司 一种新冠病毒和流感病毒的联合疫苗、其制备方法与应用
CN116327910A (zh) * 2023-03-31 2023-06-27 北京吉诺卫生物科技有限公司 一种新冠病毒、流感病毒和/或rsv的联合疫苗、其制备方法与应用
WO2024232415A1 (ja) * 2023-05-10 2024-11-14 国立大学法人北海道大学 インフルエンザ及びコロナウイルス感染症予防のための混合ワクチン

Also Published As

Publication number Publication date
AR122899A1 (es) 2022-10-12
AU2021303789A1 (en) 2023-02-16
EP4178612A1 (en) 2023-05-17
CO2023001072A2 (es) 2023-06-20
CN117957016A (zh) 2024-04-30
GB202010425D0 (en) 2020-08-19
GB2596820A (en) 2022-01-12
BR112023000323A2 (pt) 2023-01-31
TW202207979A (zh) 2022-03-01
US20230256085A1 (en) 2023-08-17
JP2023533772A (ja) 2023-08-04
KR20230049084A (ko) 2023-04-12
IL299735A (en) 2023-03-01
CA3184878A1 (en) 2022-01-13
MX2023000411A (es) 2023-04-10

Similar Documents

Publication Publication Date Title
US20230256085A1 (en) Combination vaccine
JP7445375B2 (ja) ブタサーコウイルス3型免疫原性組成物、その製造方法、およびその使用方法
US11938221B2 (en) Multivalent nanoparticle-based vaccines
US20240108715A1 (en) 2019-ncov (sars-cov-2) vaccine
KR101983989B1 (ko) 인플루엔자 바이러스 백신 및 이의 용도
AU2022204267A1 (en) Vaccine compositions
CN105452270B (zh) 流行性感冒病毒疫苗及其用途
ES2858315T3 (es) Proteína F de prefusión de VRS soluble estabilizada para uso en la profilaxis de la infección por VRS
AU2010303568B2 (en) Immunopotentiator-linked oligomeric influenza immunogenic compositions
US20140227309A1 (en) Combination vaccine for respiratory syncytial virus and influenza
EP3541419B1 (en) Immunogenic composition for mers coronavirus infection
JP2023519837A (ja) コロナウイルスを処置するためのワクチン組成物
EP4118096A1 (en) Stabilised viral fusion proteins
CN105085671B (zh) 抗肠道病毒3d蛋白的单克隆免疫球蛋白g抗体及其免疫原性组合物

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21740222

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3184878

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 202317001320

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2023501632

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023000323

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112023000323

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230106

WWE Wipo information: entry into national phase

Ref document number: NC2023/0001072

Country of ref document: CO

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021740222

Country of ref document: EP

Effective date: 20230207

ENP Entry into the national phase

Ref document number: 2021303789

Country of ref document: AU

Date of ref document: 20210707

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202180054553.3

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: NC2023/0001072

Country of ref document: CO