WO2021091279A1 - H5n8 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물 - Google Patents
H5n8 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물 Download PDFInfo
- Publication number
- WO2021091279A1 WO2021091279A1 PCT/KR2020/015451 KR2020015451W WO2021091279A1 WO 2021091279 A1 WO2021091279 A1 WO 2021091279A1 KR 2020015451 W KR2020015451 W KR 2020015451W WO 2021091279 A1 WO2021091279 A1 WO 2021091279A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- influenza virus
- virus
- amino acid
- protein
- recombinant
- Prior art date
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/145—Orthomyxoviridae, e.g. influenza virus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- H5N8 recombinant influenza virus a composition for its preparation, and a vaccine composition comprising the same.
- the influenza virus belongs to Orthomyxoviridae and is a virus having 8 negative single-stranded RNA segments as its genome.
- Polymerase units A, B1 and B2 polymerase subunits A, B1 & B2: PA, PB1, and PB2, respectively
- nonstructural proteins 1 & 2 nonstructural proteins 1 &2; NS1 and NS2, respectively
- PA-X and PB1-F2 proteins are made from PA and PB1 genes, respectively, and are known to play an important role in viral pathogenesis.
- Recombinant influenza A vaccine using reverse genetics technology has excellent fetal proliferation.
- Recombinant virus made by combining 8 genomes such as PR8 virus with well-known characteristics or A/Ann Arbor/6/60 (H2N2) virus, which is a cold-adapted weak poison of A/WSN/33 (H1N1) virus, is used as a vaccine line.
- H2N2 A/Ann Arbor/6/60
- H1N1 A/WSN/33
- HA and NA genes are amplified from a recent virus by RT-PCR and cloned into a reverse genetic vector, transfected with the remaining six genes of PR8 to create a vaccine strain, and inactivated the virus to prepare a deadox vaccine. have.
- Some subtypes of recombinant highly pathogenic avian influenza viruses produced using the PR8 virus gene may have poor proliferation in embryonated eggs, and since PR8 is a human influenza A virus, there is a risk of cross-infection between birds and humans.
- PR8 is a human influenza A virus
- the pathogenicity in mammals disappears (Kim et al., 2014, Veterinary microbiology vol.168, p.41-49), embryonated egg highly proliferative, mammalian pathogenic recombinant virus can be produced (Korean Patent No. 1423695).
- the highly pathogenic clade 2.3.4.4a H5N8 influenza A virus which is recently prevalent worldwide, caused great economic damage in Korea. Therefore, the Ministry of Agriculture, Forestry and Quarantine and Inspection has selected H5N8 influenza A virus as a vaccine for emergency prevention, and domestic animal vaccine companies produce and store the virus for vaccine production in a frozen state.
- the low fetal proliferation and heat resistance of the Clade 2.3.4.4a H5N8 vaccine strain constructed using the existing reverse genetics technique affects the efficacy and preservation of the vaccine, resulting in a problem of deterioration of the quality of the vaccine.
- H5N8 recombinant influenza virus is provided.
- It provides a cell transformed with a composition for producing H5N8 recombinant influenza virus.
- It provides a vaccine composition comprising the H5N8 recombinant influenza virus.
- HA hemagglutinin
- NA Neuraminidase
- Influenza virus H1N1 strain of polymerase B1 (polymerase subunit B1: PB1), polymerase A (polymerase subunit A: PA), nucleoprotein (NP), matrix protein (M), and nonstructural protein : It provides a recombinant H5N8 influenza virus comprising at least one protein selected from the group consisting of NS).
- Influenza virus is a virus of the Orthomyxoviridae family and can cause flu or a flu.
- the influenza virus may be a clade 2.3.4.4a H5N8 virus.
- the influenza virus H5N8 strain is also called influenza A virus subtype H5N8.
- Hemagglutinin (HA) protein is also called hemagglutination protein or hemagglutinin.
- the hemagglutinin protein may be a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or 2.
- the hemagglutinin protein may be obtained by mutating the 103rd amino acid from the N-terminus in the amino acid sequence of SEQ ID NO: 1.
- the hemagglutinin protein may be obtained by mutating histidine (H), which is the 103rd amino acid from the N terminal, to tyrosine (Y) in the amino acid sequence of SEQ ID NO: 1.
- the cleavage site of the hemagglutinin protein may be mutated.
- the mutation may be an insertion, truncation, deletion, substitution, point mutation, or lattice shift mutation. By the mutation, the cleavage site of the hemagglutinin protein may be removed.
- the cleavage site of the hemagglutinin protein may be an amino acid sequence from the 339th to the 345th from the N terminal.
- the cleavage site may be N-RERRRK-C (SEQ ID NO: 5), N-REKRRK-C (SEQ ID NO: 6), or N-RKRKK-C (SEQ ID NO: 7).
- the cleavage site can be mutated to any amino acid sequence. For example, the cleavage site is mutated to the amino acid sequence N-ASGR-C.
- the hemagglutinin protein is expressed as a hemagglutinin precursor and can be cleaved into hemagglutinin HA1 and HA2.
- asparagine (N) which is the 498th amino acid from the N-terminus in the amino acid sequence of SEQ ID NO: 1 or the 496th from the N-terminus in the amino acid sequence of SEQ ID NO: 2
- T threonine
- Neuraminidase refers to an enzyme that hydrolyzes neuraminic acid to separate sialic acid.
- the neuraminidase may be required when the virus enters or exits the host's cells.
- the neuraminidase may be neuraminidase derived from influenza virus H5N8 strain.
- the neuraminidase may be a polypeptide comprising the amino acid sequence of SEQ ID NO: 3.
- the low pathogenic influenza virus may be a domestic low pathogenic avian influenza virus, A/chicken/Korea/01310/2001 (H9N2) (hereinafter referred to as '01310') (Korean Patent No. 0790801).
- the 01310 strain is a domestic isolate isolated as in Example 1 of Korean Patent No. 0790801 and has low pathogenicity.
- the 01310 strain although low pathogenic, is a pathogenic virus, so it cannot be deposited with a depository institution, and is currently being stored in the Bird Disease Division of the Agriculture, Forestry and Fisheries Quarantine and Inspection Headquarters.
- Polymerase B2 is one of the subunits of the RNA-dependent RNA polymerase of the influenza virus.
- the polymerase subunit B2 (PB2) protein may be a polypeptide including the amino acid sequence of SEQ ID NO: 4.
- the influenza virus H1N1 strain may be A/Puerto Rico/8/34 (hereinafter referred to as'PR8').
- Polymerase B1 (polymerase subunit B1: PB1) is one of the subunits of the RNA-dependent RNA polymerase of influenza virus.
- the polymerase B1 may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002021 or a polypeptide including the amino acid sequence of Uniprot P03431.
- Polymerase A (polymerase subunit A: PA) is one of the subunits of the RNA-dependent RNA polymerase of the influenza virus.
- the polymerase A may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002022 or a polypeptide comprising the amino acid sequence of Uniprot P03433.
- Nucleoprotein is a structural protein that encapsulates the negative strand virus RNAfmf.
- the nucleocapsid may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002019 or a polypeptide including the amino acid sequence of Uniprot P03466.
- Matrix protein (M) is a structural protein that connects the viral core and the viral envelope.
- the matrix protein may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002016 or a polypeptide including the amino acid sequence of Uniprot P06821 or P03485.
- Nonstructural proteins are homodimeric RNA-binding proteins required for viral replication.
- the non-structural protein may be a polypeptide encoded by the nucleic acid sequence of GenBank accession number NC_002020 or a polypeptide comprising the amino acid sequence of Uniprot P03496.
- the H5N8 recombinant influenza virus may include one or more proteins selected from the group consisting of polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein of the influenza virus H1N1 strain.
- the H5N8 recombinant influenza virus may include all of the polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein of the influenza virus H1N1 strain.
- the H5N8 recombinant influenza virus may be deposited under the accession number KCTC14012BP (2019.10.30).
- the H5N8 recombinant influenza virus may be a recombinant virus including two or more of H5N8 strain-derived proteins, low pathogenic influenza virus-derived proteins, and H1N1 strain-derived proteins.
- the H5N8 recombinant influenza virus may be a mammalian pathogenic, embryonic hyperproliferative, or heat resistant virus.
- the H5N8 recombinant influenza virus may be a mammalian-free, high-growth, heat-resistant clade 2.3.4.4a H5N8 attenuated recombinant virus.
- the H5N8 recombinant influenza virus is safe because it is not pathogenic to mammals, is highly proliferative in embryonated eggs, so it can increase vaccine productivity, and has high heat resistance, so it is useful for storing vaccine raw materials/products and extending the shelf life.
- Another aspect is a polynucleotide encoding the hemagglutinin protein of the influenza virus H5N8 strain
- composition for producing H5N8 recombinant influenza virus comprising a polynucleotide encoding at least one protein selected from the group consisting of polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein of the influenza virus H1N1 strain.
- Influenza virus H5N8 strain hemagglutinin protein, neuraminidase, hypopathogenic influenza virus, polymerase B2, influenza virus H1N1 strain, polymerase B1, polymerase A, nucleocapsid, matrix protein and non-structural protein are described above. As shown.
- the polynucleotide comprises a nucleic acid sequence encoding any one of the hemagglutinin protein, neuraminidase, polymerase B2, polymerase B1, polymerase A, nucleocapsid, matrix protein, and non-structural protein. It can be a polynucleotide. The polynucleotide may be changed according to codon usage.
- the polynucleotide may be included in a vector.
- the vector may be an expression vector.
- the vector may include regulatory regions (eg, promoters, enhancers, and silencers) necessary for expression in animal cells.
- the polynucleotide may be operably linked to a regulatory region.
- the vector may further include an origin of replication, a polyA sequence, a multiple cloning site, a selection marker, and the like.
- the vector may be a plasmid vector, a cosmid vector, a bacteriophage vector, or a viral vector.
- the viral vector may be an adenovirus vector, a retroviral vector, or an adeno-associated virus vector.
- Another aspect provides a method for producing H5N8 recombinant influenza virus comprising the step of incubating the cells with the composition for producing H5N8 recombinant influenza virus according to one aspect to transform the cells with the H5N8 recombinant influenza virus.
- the cell may be a cell capable of producing a recombinant virus.
- the cells are 293T, MDCK, Vero, DF1, PK15, and ST1 cells.
- the normal cell may be an algal animal cell.
- the cells may be embryonic eggs of chicks or fetal kidney cells.
- the step of incubating the H5N8 recombinant influenza virus preparation composition and cells may include adding the H5N8 recombinant influenza virus to the allantoic fluid of embryonated eggs and culturing the allantoic fluid.
- the transformation may be a nucleic acid of the composition for producing H5N8 recombinant influenza virus is introduced into the cell. Transformation can be carried out by methods known in the art. For example, transformation can be performed by transduction, transfection, microinjection, lipofection, or electroporation.
- the method may further comprise the step of isolating the H5N8 recombinant influenza virus from the transformed cells.
- Another aspect provides a cell transformed with the composition for producing H5N8 recombinant influenza virus according to one aspect.
- composition and transformation for preparing H5N8 recombinant influenza virus are as described above.
- the cell may be a cell capable of producing a recombinant virus.
- the cells are 293T, MDCK, Vero, DF1, PK15, and ST1 cells.
- the normal cell may be an algal animal cell.
- the cells may be embryonic eggs of chicks or fetal kidney cells.
- Another aspect provides a vaccine composition comprising the H5N8 recombinant influenza virus according to one aspect.
- the H5N8 recombinant influenza virus is as described above.
- the vaccine composition may be for preventing flu or bird flu.
- the vaccine composition may be for administration to birds (eg, chickens, ducks) or mammals (eg, humans, pigs, dogs, cats, horses, cows, sheep, mice, camels).
- the prevention refers to any action of inhibiting or delaying the onset of diseases (eg, flu, avian venom) caused by influenza virus by administration of the vaccine composition.
- the vaccine composition may contain an effective amount of H5N8 recombinant influenza virus.
- the term “effective amount” refers to an amount sufficient to exhibit the effect of prophylaxis or treatment when administered to an individual in need of prophylaxis or treatment.
- the effective amount can be appropriately selected by a person skilled in the art according to the cell or individual to be selected.
- the vaccine composition may be administered in an amount including about 1x10 7 to 1x10 11 , 1x10 8 to 5x10 10 , 5x10 8 to 2x10 10 viral particles.
- the vaccine composition may be a dead poison vaccine or a live poison vaccine composition.
- the vaccine composition may contain a pharmaceutically acceptable carrier.
- the carrier is used in the sense of including an excipient, diluent or adjuvant.
- the carrier is, for example, lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, polyvinyl blood. It may be selected from the group consisting of rolidone, water, physiological saline, a buffer such as PBS, methylhydroxy benzoate, propylhydroxy benzoate, talc, magnesium stearate, and mineral oil.
- the composition may contain a filler, an anti-aggregating agent, a lubricant, a wetting agent, a flavoring agent, an emulsifying agent, a preservative, or a combination thereof.
- the vaccine composition may be administered by a parenteral route (eg, intravascular, intravenous, intraarterial, intramuscular or subcutaneous, etc.), oral, nasal, rectal, transdermal, or by inhalation route via aerosol.
- the dosage of the vaccine composition may be, for example, about 1x10 7 to 1x10 11 , 1x10 8 to 5x10 10 , 5x10 8 to 2x10 10 viral particles.
- the administration may be administered once a day, 2 to 24 times a day, 1 to 6 times a week, 1 to 3 times a month, or 1 to 12 times a year.
- the vaccine composition may be formulated as an oral dosage form (eg, powder, tablet, capsule, syrup, pill, or granule), or a parenteral formulation (eg, an injection).
- the composition may be prepared in a systemic formulation or a topical formulation.
- the vaccine composition may be administered as an individual therapeutic agent or administered in combination with other therapeutic agents, and may be administered sequentially or simultaneously with a conventional therapeutic agent. And can be administered single or multiple.
- Another aspect provides a method of preventing flu or bird flu, comprising administering to an individual a vaccine composition according to one aspect.
- the individual may be a bird (eg, chicken, duck) or a mammal (eg, human, pig, dog, mouse).
- a bird eg, chicken, duck
- a mammal eg, human, pig, dog, mouse
- the dosage of the vaccine composition varies depending on the condition and weight of the patient, the degree of disease, the form of the drug, the route and duration of administration, but may be appropriately selected by those skilled in the art.
- the vaccine composition may be administered in an amount including about 1x10 7 to 1x10 11 , 1x10 8 to 5x10 10 , 5x10 8 to 2x10 10 viral particles.
- the administration may be administered once a day, 2 to 24 times a day, 1 to 6 times a week, 1 to 3 times a month, or 1 to 12 times a year.
- Mammalian pathogenicity, embryonic egg high proliferation, heat resistance, attenuated clade 2.3.4.4a H5N8 recombinant influenza A virus can be usefully used as a vaccine strain with high productivity and excellent efficacy.
- FIG. 1 shows a schematic diagram of the recombinant viruses rH5N8, rH5N8-hmH103Y, and rH5N8-hmH103Y-310PB2.
- Figure 2a is a graph showing the cell culture infection capacity (TCID 50 /0.1ml) according to time after inoculation of rH5N8, rH5N8-hmH103Y, and rH5N8-hmH103Y-310PB2 in MDCK cells (*: when the virus is compared with other viruses Statistically significant difference was shown, confidence interval 95%, p ⁇ 0.05),
- Figure 2b shows the cell culture infection dose (TCID 50 /) after inoculation of rH5N8, rH5N8-hmH103Y, and rH5N8-hmH103Y-310PB2 in A549 cells. 0.1ml) (*: the virus shows a statistically significant difference when compared to other viruses, confidence interval 95%, p ⁇ 0.05).
- 3A and 3B are graphs showing the body weight (g) and survival rate (%) of mice according to time after inoculation of rH5N8, rH5N8-hmH103Y, and rH5N8-hmH103Y-310PB2 to mice, respectively ( ⁇ : rH5N8, ⁇ : rH5N8 -hmH103Y, ⁇ : rH5N8-hmH103Y-310PB2, ⁇ : rPR8, ⁇ : mock).
- FIG 4 is a graph showing the HA titer (log2) according to the incubation temperature (°C) of rH5N8 and rH5N8-hmH103Y.
- Example 1 Construction and Characterization of Recombinant Viruses Having HA, NA Genome and PB2 Genome Segment of 01310 of High Pathogenic H5N8 Influenza Virus
- the HA gene and the NA gene in which Asparagine (N) at No. 154 of the HA2 protein was changed to Threonine (T) were synthesized, respectively, and cloned into a Hoffman plasmid vector (Korean Patent No. 0862758).
- the synthesized H5N8 HA protein in order to replace amino acid 103 from the N-terminus from histidine (H) to tyrosine (Y), the nucleotide constituting the codon of the corresponding amino acid in the HA gene is substituted from CAC to TAC. And, a complementary primer set of about 30 bp having the same sequence in both directions was prepared around it. Using primers and Muta-Direct Site Directed Mutagenesis Kit (iNtRon Co. South Korea), the HA genome cloning vector plasmid of the synthesized H5N8 virus in which the genome of amino acid 103 of the HA protein was replaced by TAC in CAC was constructed.
- HA hemagglutinin
- a vector in which HA and NA nucleic acid fragments of the highly pathogenic H5N8 influenza virus synthesized in Example 1-1 were cloned was prepared.
- the Hoffman plasmid vector in which the PB2 nucleic acid fragment of the low pathogenic influenza virus 01310 strain was cloned was prepared, and the Hoffman plasmid vector in which the PB1, PA, NP, M, and NS nucleic acid fragments of the influenza A virus PR8 strain were cloned were prepared.
- DMEM (GIBCO BRL) medium containing 5% (v/v) FBS was added to a 6-well cell culture vessel, and 1 ⁇ 10 6 cells/2 ml of 293T cells (Bio Resource Center, KCTC) were added to each well. Cells were attached by incubation at 37° C. and 5% CO 2 for about 24 hours. After removing the medium, 0.8 ml of Opti-MEM medium (Invitrogen Co. USA) was added.
- All eight of the prepared plasmids were put in an amount of 300 ng each in one 1.5 ml tube, and Opti-MEM medium was added to a final 25 ⁇ l.
- Opti-MEM medium was added to a final 25 ⁇ l.
- 6 ⁇ l of Plus reagent (Invitrogen Co. USA) and 69 ⁇ l of Opti-MEM medium were added and mixed, and then added to a 1.5 ml tube containing the plasmid for mixing, and the mixture was mixed at room temperature. Incubated for about 15 minutes at.
- the inoculated embryonated eggs were cultured at 37° C. for 3 days, and the allantoic fluid was harvested to check whether hemagglutination occurred. All inoculated embryos were positive for hemagglutination.
- the recombinant virus was named rH5N8, rH5N8-hmH103Y, or rH5N8-hmH103Y-310PB2, and a schematic diagram of the virus is shown in FIG. 1.
- the hemagglutination titer of this recombinant virus was measured, diluted 100 times, and the virus (E2) grown in embryonated eggs by the same method was stored at -70°C.
- the proliferation titer (50% embryo infection dose, EID 50 /ml) of the recombinant virus (E2) of Example 1-2 in fetuses was measured. Specifically, each of the recombinant viruses was diluted 10 -1 to 10 -9 with a phosphate buffer solution, and inoculated to 5 SPF embryos of 10 to 11 days old for each dilution factor by 100 ⁇ l by the allantoic route. After incubation for 3 days, the allantoic fluid was harvested. Hemagglutination was confirmed with red blood cells of chickens, and virus titer (EID 50 / ml) was measured according to the calculation formula of the Spearman-Karber method.
- Example 1-3 Based on the virus titer (EID 50 /ml (log 10)) obtained in Example 1-3, 100 EID 50 virus was inoculated into each of five 10-day-old embryonated eggs by 100 ⁇ l by the allantoic route. After culturing for 3 days, the allantoic solution was harvested, and the results of comparing the proliferative properties in embryonated eggs by measuring EID 50/ml as described in Example 1-3 are shown in Table 1.
- the viral titer of rH5N8 is 10 8.3 EID 50 / ml
- the viral titer of rH5N8-hmH103Y is 10 9.3 EID 50 / ml
- the viral titer of rH5N8-hmH103Y-310PB2 is 10 9.3 EID 50 /ml. Therefore, it was confirmed that the proliferative properties of rH5N8-hmH103Y and rH5N8-hmH103Y-310PB2 were increased in embryonated eggs.
- Example 1-2 proliferates in mammalian cells.
- MDCK Madin-Darby Canine Kidney
- the MDCK cell line was maintained in Dulbecco's Modified Eagle Medium (DMEM) (Life technologies Co., CA, USA) medium containing 10% (v/v) fetal calf serum (FBS), and the A549 cell line was maintained at 10% (v/v). ) It was maintained in DMEM/F12 (Life technologies Co., CA, USA) medium containing fetal calf serum (FBS).
- DMEM Dulbecco's Modified Eagle Medium
- FBS fetal calf serum
- FBS fetal calf serum
- the obtained supernatant was diluted in decimal to 10 -1 to 10 -9 and inoculated into MDCK cells having a single layer in a 96-well cell culture plate, and Tissue Culture Infectious Dose (TCID 50 /0.1 ml) was measured, and the The results are shown in FIGS. 2A (MDCK cells) and 2B (A549 cells).
- rH5N8-hmH103Y has increased proliferation in both the MDCK cell line and the A549 cell line
- rH5N8-hmH103Y-310PB2 confirmed that it cannot proliferate in both the MDCK cell line and the A549 cell line. I did.
- the recombinant virus of Example 1-2 was inoculated into 6-week-old female BALB/c mice (KOATEC, Pyeongtaek, Korea) each of 8 mice. On the 3rd day after inoculation, lungs of 3 mice were sampled to compare the proliferative properties in the lungs, and weight change of 5 mice for 2 weeks was observed.
- mice were sedated with Zoletil50 (15mg/kg, Virbac, Carros, France), and each virus was inoculated through the nasal cavity at a dose of 10 6 EID 50 /0.1 ml. Euthanasia was performed when there was a change in body weight of 20% or more during the 2-week body weight change observation period.
- the body weight change and survival rate for 2 weeks are shown in FIGS. 3A and 3B, respectively ( ⁇ : rH5N8, ⁇ : rH5N8-hmH103Y, ⁇ : rH5N8-hmH103Y-310PB2, ⁇ : rPR8, ⁇ : mock).
- H103Y actually increased the heat resistance and increased proliferation in embryonated eggs and mammalian cell lines and mice.
- the rH5N8 and rH5N8-hmH103Y viruses were treated at 50° C., 55° C., and 60° C. for 30 minutes, respectively, and then HA titers were measured through the HA test, and the results are shown in FIG. 4.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Wood Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Immunology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Pulmonology (AREA)
- Mycology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
포유류 무병원성, 발육란 고증식성, 내열성, 약독화 클레이드 2.3.4.4a H5N8 재조합 인플루엔자 A 바이러스, 이의 제조용 조성물, 이에 의해 형질감염된 세포, 백신 조성물, 및 독감 또는 조류 독감의 예방 방법을 제공한다.
Description
H5N8 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물에 관한 것이다.
인플루엔자 바이러스는 오소믹소바이러스(Orthomyxoviridae)에 속하며, 음성의 단일가닥 RNA 절편 8개를 게놈으로 갖는 바이러스이다. 8개의 RNA 절편으로부터 혈구응집 단백질(hemagglutinin: HA), 뉴라미니다제(neuraminidase: NA), 뉴클레오캡시드 단백질(nucleoprotein: NP), 매트릭스 단백질 1 및 2(matrix 1 & 2: 각각 M1 및 M2), 중합효소 단위체 A, B1 및 B2(polymerase subunit A, B1 & B2: 각각 PA, PB1, 및 PB2), 및 비구조 단백질 1 및 2(nonstructural protein 1 & 2; 각각 NS1, NS2)가 만들어진다. 또한, 최근 PA와 PB1 유전자로부터 각각 PA-X와 PB1-F2 단백질이 만들어져 바이러스 병원성에 중요한 역할을 하는 것으로 알려져 있다.
역 유전학 기술을 사용한 재조합 A형 인플루엔자 백신은 계태아 증식성이 탁월하다. 특성이 잘 알려진 PR8 바이러스나 A/WSN/33(H1N1) 바이러스의 저온 적응 약독주인 A/Ann Arbor/6/60(H2N2) 바이러스 등의 8개 게놈을 조합하여 만든 재조합 바이러스를 백신주로 이용하고 있다(한국 특허 제0908757호 및 한국 특허 제0862758호). 통상적으로, HA와 NA 유전자는 최근 유행하는 바이러스로부터 RT-PCR 법으로 증폭하여 역 유전학 벡터에 클로닝 하고, PR8의 나머지 유전자 6개와 함께 transfection 하여 백신주를 작출하며 바이러스를 불활화하여 사독백신을 제조하고 있다.
PR8 바이러스의 유전자를 사용하여 제작한 재조합 고병원성 조류인플루엔자 바이러스 중 일부 아형은 발육란에서의 증식성이 좋지 않은 경우가 있고, PR8이 인체 인플루엔자 A 바이러스이기에 조류와 사람간의 교차감염의 위험성이 존재한다. 저병원성 H9N2 조류인플루엔자 바이러스인 A/chicken/Korea/01310/2001(H9N2) (01310)의 PB2 유전자를 PR8 바이러스에 재조합하여 마우스에 접종하면, 포유류에서의 병원성이 없어지고(Kim et al., 2014, Veterinary microbiology vol.168, p.41-49), 발육란 고증식성, 포유류 무병원성 재조합 바이러스가 제작 가능하다(한국 특허 제1423695호).
최근 전세계적으로 유행하고 있는 고병원성 클레이드 2.3.4.4a H5N8 인플루엔자 A 바이러스는 국내에서도 큰 경제적 피해를 초래하였다. 이에, 농림검역검사본부에서는 H5N8 인플루엔자 A 바이러스를 비상시 예방용 백신주로 선정하였고, 국내 동물백신회사에서 백신 제조용 바이러스를 원료를 생산하여 냉동보관하고 있다. 그러나 기존의 역유전학 기술을 이용하여 작출된 클레이드 2.3.4.4a H5N8 백신주의 계태아 증식성과 내열성이 낮아 백신 효능과 보존성에 영향을 주어 백신 품질의 저하가 문제된다.
H5N8 재조합 인플루엔자 바이러스를 제공한다.
H5N8 재조합 인플루엔자 바이러스 제조용 조성물 또는 이를 이용한 제조 방법을 제공한다.
H5N8 재조합 인플루엔자 바이러스 제조용 조성물로 형질전환된 세포를 제공한다.
H5N8 재조합 인플루엔자 바이러스를 포함하는 백신 조성물을 제공한다.
일 양상은 인플루엔자 바이러스 H5N8 스트레인의 헤마글루티닌(hemagglutinin: HA) 단백질;
H5N8 스트레인의 뉴라미니다제(neuraminidase: NA);
저병원성 인플루엔자 바이러스의 중합효소 B2(polymerase subunit B2: PB2); 및
인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1(polymerase subunit B1: PB1), 중합효소 A(polymerase subunit A: PA), 뉴클레오캡시드(nucleoprotein: NP), 매트릭스 단백질(matrix: M) 및 비구조적 단백질(nonstructural protein: NS)로 이루어진 군으로부터 선택된 하나 이상의 단백질을 포함하는 H5N8 재조합 인플루엔자 바이러스를 제공한다.
인플루엔자 바이러스는 오소믹소바이러스과(Orthomyxoviridae)의 바이러스로서, 독감 또는 유행성 감기를 유발할 수 있다. 상기 인플루엔자 바이러스는 클레이드(clade) 2.3.4.4a H5N8 바이러스일 수 있다. 상기 인플루엔자 바이러스 H5N8 스트레인은 인플루엔자 A 바이러스 서브타입 H5N8이라고도 불린다.
헤마글루티닌(hemagglutinin: HA) 단백질은 적혈구응집 단백질 또는 혈구응집소라고도 불린다. 상기 헤마글루티닌 단백질은 서열번호 1 또는 2의 아미노산 서열을 포함하는 폴리펩티드일 수 있다. 상기 헤마글루티닌 단백질은 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산이 돌연변이된 것일 수 있다. 상기 헤마글루티닌 단백질은 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산인 히스티딘(H)이 티로신(Y)로 돌연변이된 것일 수 있다.
상기 헤마글루티닌 단백질의 절단 부위(cleavage site)는 돌연변이된 것일 수 있다. 상기 돌연변이는 삽입, 절단, 결실, 치환, 점 돌연변이, 또는 격자이동 돌연변이일 수 있다. 상기 돌연변이에 의해 헤마글루티닌 단백질의 절단 부위는 제거될 수 있다. 상기 헤마글루티닌 단백질의 절단 부위는 N 말단으로부터 339번째 내지 345번째 아미노산 서열일 수 있다. 상기 절단 부위는 N-RERRRK-C(서열번호 5), N-REKRRK-C(서열번호 6), 또는 N-RKRKK-C(서열번호 7)일 수 있다. 상기 절단 부위는 임의의 아미노산 서열로 돌연변이될 수 있다. 예를 들어, 상기 절단 부위는 아미노산 서열 N-ASGR-C로 돌연변이된다.
상기 헤마글루티닌 단백질은 헤마글루티닌 전구체로 발현되어, 헤마글루티닌 HA1 및 HA2로 절단될 수 있다. 상기 헤마글루티닌 단백질의 HA2 도메인은 서열번호 1의 아미노산 서열에서 N 말단으로부터 498번째 아미노산 또는 서열번호 2의 아미노산 서열에서 N 말단으로부터 496번째인 아스파라긴(N)이 트레오닌(T)로 돌연변이될 수 있다.
뉴라미니다제(neuraminidase: NA)는 뉴라민산(neuraminic acid)을 가수분해하여 시알산을 분리하는 효소를 말한다. 상기 뉴라미니다제는 바이러스가 숙주의 세포에 침입하거나 빠져나올때 필요할 수 있다. 상기 뉴라미니다제는 인플루엔자 바이러스 H5N8 스트레인 유래의 뉴라미니다제일 수 있다. 상기 뉴라미니다제는 서열번호 3의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.
상기 저병원성 인플루엔자 바이러스는 국내 저병원성 조류 인플루엔자 바이러스인 A/chicken/Korea/01310/2001(H9N2)(이하, '01310'라고 함)(한국 특허 제0790801호)일 수 있다. 상기 01310 균주는 한국 특허 제0790801호의 실시예1에서와 같이 분리된 국내 분리주로서 저병원성이다. 그러나, 상기 01310 균주는 저병원성이긴 하지만 병원성 바이러스이기 때문에 기탁기관에 기탁이 불가능하며, 현재 농림수산검역검사본부 조류질병과에 보관중이다.
중합효소 B2는 인플루엔자 바이러스의 RNA-의존성 RNA 중합효소의 서브유닛 중 하나이다. 상기 중합효소 B2(polymerase subunit B2: PB2) 단백질은 서열번호 4의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.
상기 인플루엔자 바이러스 H1N1 스트레인은 A/Puerto Rico/8/34(이하, 'PR8'이라고 함)일 수 있다.
중합효소 B1(polymerase subunit B1: PB1)은 인플루엔자 바이러스의 RNA-의존성 RNA 중합효소의 서브유닛 중 하나이다. 상기 중합효소 B1은 GenBank accession number NC_002021의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P03431의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.
중합효소 A(polymerase subunit A: PA)는 인플루엔자 바이러스의 RNA-의존성 RNA 중합효소의 서브유닛 중 하나이다. 상기 중합효소 A는 GenBank accession number NC_002022의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P03433의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.
뉴클레오캡시드(nucleoprotein: NP)는 음성(negative) 가닥 바이러스 RNAfmf 캡슐화하는 구조 단백질이다. 상기 뉴클레오캡시드는 GenBank accession number NC_002019의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P03466의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.
매트릭스 단백질(matrix: M)은 바이러스 코어와 바이러스 외피를 연결시켜주는 구조 단백질이다. 상기 매트릭스 단백질은 GenBank accession number NC_002016의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P06821 또는 P03485의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.
비구조적 단백질(nonstructural protein: NS)은 바이러스 복제에 필요한 동종이량체(homodimeric) RNA-결합 단백질이다. 상기 비구조적 단백질은 GenBank accession number NC_002020의 핵산 서열로 코딩되는 폴리펩티드 또는 Uniprot P03496의 아미노산 서열을 포함하는 폴리펩티드일 수 있다.
상기 H5N8 재조합 인플루엔자 바이러스는 인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질로 이루어진 군으로부터 선택된 하나 이상의 단백질을 포함할 수 있다. 상기 H5N8 재조합 인플루엔자 바이러스는 인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질 모두를 포함할 수 있다.
상기 H5N8 재조합 인플루엔자 바이러스는 기탁번호 KCTC14012BP(2019.10.30)으로 기탁된 것일 수 있다.
상기 H5N8 재조합 인플루엔자 바이러스는 H5N8 스트레인 유래 단백질, 저병원성 인플루엔자 바이러스 유래 단백질, 및 H1N1 스트레인 유래 단백질 중 2 이상을 포함한 재조합 바이러스일 수 있다.
상기 H5N8 재조합 인플루엔자 바이러스는 포유류 무병원성, 발육란 고증식성, 또는 내열성 바이러스일 수 있다. 상기 H5N8 재조합 인플루엔자 바이러스는 포유류무병원성, 발육란고증식성, 내열성 클레이드 2.3.4.4a H5N8 약독화 재조합 바이러스일 수 있다. 상기 H5N8 재조합 인플루엔자 바이러스는 포유류에 병원성이 없어 안전하고, 발육란에서 고증식성이어서 백신 생산성을 높일 수 있고, 높은 내열성을 갖추고 있어 백신 원료/제품 보관 및 유통 기간 연장에 유용하다.
다른 양상은 인플루엔자 바이러스 H5N8 스트레인의 헤마글루티닌 단백질을 코딩하는 폴리뉴클레오티드;
H5N8 스트레인의 뉴라미니다제를 코딩하는 폴리뉴클레오티드;
저병원성 인플루엔자 바이러스의 중합효소 B2를 코딩하는 폴리뉴클레오티드; 및
인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질로 이루어진 군으로부터 선택된 하나 이상의 단백질을 코딩하는 폴리뉴클레오티드를 포함하는 H5N8 재조합 인플루엔자 바이러스 제조용 조성물을 제공한다.
인플루엔자 바이러스 H5N8 스트레인, 헤마글루티닌 단백질, 뉴라미니다제, 저병원성 인플루엔자 바이러스, 중합효소 B2, 인플루엔자 바이러스 H1N1 스트레인, 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질은 전술한 바와 같다.
상기 폴리뉴클레오티드는 상기 헤마글루티닌 단백질, 뉴라미니다제, 중합효소 B2, 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질, 및 비구조적 단백질 중 어느 하나를 코딩하는 핵산 서열을 포함하는 폴리뉴클레오티드일 수 있다. 상기 폴리뉴클레오티드는 코돈 사용 빈도(codon usage)에 따라 변경될 수 있다.
상기 폴리뉴클레오티드는 벡터에 포함된 것일 수 있다. 상기 벡터는 발현 벡터일 수 있다. 상기 벡터는 동물세포에서의 발현을 위해 필요한 조절 영역(예, 프로모터, 인핸서, 및 사일런서)를 포함할 수 있다. 상기 폴리뉴클레오티드는 조절 영역과 작동 가능하게 연결된 것일 수 있다. 상기 벡터는 복제원점, 폴리A 서열, 다중 클로닝 부위, 선별 마커 등을 더 포함할 수 있다.
상기 벡터는 플라스미드 벡터, 코스미드 벡터, 박테리오파지 벡터, 또는 바이러스 벡터일 수 있다. 상기 바이러스 벡터는 아데너바이러스 벡터, 레트로바이러스 벡터, 또는 아데노연관 바이러스 벡터일 수 있다.
다른 양상은 일 양상에 따른 H5N8 재조합 인플루엔자 바이러스 제조용 조성물과 세포를 인큐베이션하여 세포에 H5N8 재조합 인플루엔자 바이러스를 형질전환시키는 단계를 포함하는 H5N8 재조합 인플루엔자 바이러스 제조 방법을 제공한다.
상기 세포는 재조합 바이러스를 생산할 수 있는 세포일 수 있다. 예를 들어, 상기 세포는 293T, MDCK, Vero, DF1, PK15, 및 ST1 세포이다. 상시 세포는 조류의 동물 세포일 수 있다. 상기 세포는 병아리의 발육란 또는 계태아 신장세포일 수 있다.
상기 H5N8 재조합 인플루엔자 바이러스 제조용 조성물과 세포를 인큐베이션하는 단계는 H5N8 재조합 인플루엔자 바이러스를 발육란의 요막액에 가하고, 요막액을 배양하는 것일 수 있다.
상기 형질전환은 세포에 H5N8 재조합 인플루엔자 바이러스 제조용 조성물의 핵산이 도입되는 것일 수 있다. 형질전환은 당업계에 알려진 방법으로 수행될 수 있다. 예를 들어, 형질전환은 형질도입, 형질감염, 미세 주입법, 리포펙션, 또는 전기천공법으로 수행될 수 있다.
상기 방법은 형질전환된 세포로부터 H5N8 재조합 인플루엔자 바이러스를 분리하는 단계를 더 포함할 수 있다.
다른 양상은 일 양상에 따른 H5N8 재조합 인플루엔자 바이러스 제조용 조성물로 형질전환된 세포를 제공한다.
H5N8 재조합 인플루엔자 바이러스 제조용 조성물 및 형질전환은 전술한 바와 같다.
상기 세포는 재조합 바이러스를 생산할 수 있는 세포일 수 있다. 예를 들어, 상기 세포는 293T, MDCK, Vero, DF1, PK15, 및 ST1 세포이다. 상시 세포는 조류의 동물 세포일 수 있다. 상기 세포는 병아리의 발육란 또는 계태아 신장세포일 수 있다.
다른 양상은 일 양상에 따른 H5N8 재조합 인플루엔자 바이러스를 포함하는 백신 조성물을 제공한다.
상기 H5N8 재조합 인플루엔자 바이러스는 전술한 바와 같다.
상기 백신 조성물은 독감 또는 조류 독감을 예방하기 위한 것일 수 있다. 상기 백신 조성물은 조류(예, 닭, 오리) 또는 포유류(예, 사람, 돼지, 개, 고양이, 말, 소, 양, 마우스, 낙타)에 투여하기 위한 것일 수 있다. 상기 예방은 상기 백신 조성물의 투여에 의해 인플루엔자 바이러스에 의해 유발되는 질환(예, 독감, 조류 독삼)의 발생을 억제하거나 그의 발병을 지연시키는 모든 행위를 말한다.
상기 백신 조성물은 H5N8 재조합 인플루엔자 바이러스를 유효한 양으로 포함할 수 있다. 용어 "유효한 양"은 예방 또는 치료를 필요로 하는 개체에게 투여되는 경우 예방 또는 치료의 효과를 나타내기에 충분한 양을 말한다. 상기 유효한 양은 당업자가 선택되는 세포 또는 개체에 따라 적절하게 선택할 수 있다. 질환의 중증도, 환자의 연령, 체중, 건강, 성별, 환자의 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 사용된 조성물과 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 상기 백신 조성물은 약 1x107 내지 1x1011, 1x108 내지 5x1010, 5x108 내지 2x1010 개의 바이러스 입자를 포함한 양으로 투여될 수 있다.
상기 백신 조성물은 사독 백신 또는 생독 백신 조성물일 수 있다.
상기 백신 조성물은 약학적으로 허용가능한 담체를 포함할 수 있다. 상기 담체는 부형제, 희석제 또는 보조제를 포함하는 의미로 사용된다. 상기 담체는 예를 들면, 락토스, 덱스트로스, 수크로스, 소르비톨, 만니톨, 자일리톨, 에리트리톨, 말티톨, 전분, 아카시아 고무, 알기네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로스, 메틸 셀룰로스, 폴리비닐 피롤리돈, 물, 생리식염수, PBS와 같은 완충액, 메틸히드록시 벤조에이트, 프로필히드록시 벤조에이트, 탈크, 마그네슘 스테아레이트, 및 미네랄 오일로 이루어진 군으로부터 선택된 것일 수 있다. 상기 조성물은 충진제, 항응집제, 윤활제, 습윤제, 풍미제, 유화제, 보존제, 또는 이들의 조합을 포함할 수 있다.
상기 백신 조성물은 비경구 경로(예, 혈관내, 정맥내, 동맥내, 근육내 또는 피하 등), 경구, 비강, 직장, 경피 또는 에어로졸을 통한 흡입 경로로 투여될 수 있다. 상기 백신 조성물의 투여량은 예를 들어, 약 1x107 내지 1x1011, 1x108 내지 5x1010, 5x108 내지 2x1010 개의 바이러스 입자일 수 있다. 상기 투여는 1일 1회, 1일 2회 내지 24회, 1주일에 1회 내지 6회, 1개월에 1회 내지 3회, 또는 1년에 1회 내지 12회 투여될 수 있다.
상기 백신 조성물은 경구 투여 제형(예를 들면, 분말, 정제, 캡슐, 시럽, 알약, 또는 과립), 또는 비경구 제형(예를 들면, 주사제)으로 제형화될 수 있다. 또한, 상기 조성물은 전신 제형, 또는 국부 제형으로 제조될 수 있다.
상기 백신 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다. 그리고 단일 또는 다중 투여될 수 있다.
다른 양상은 일 양상에 따른 백신 조성물을 개체에 투여하는 단계를 포함하는 독감 또는 조류 독감의 예방 방법을 제공한다.
상기 개체는 조류(예, 닭, 오리) 또는 포유류(예, 사람, 돼지, 개, 마우스)일 수 있다.
상기 백신 조성물의 투여량은 환자의 상태 및 체중, 질병의 정도, 약물 형태, 투여 경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 상기 백신 조성물은 약 1x107 내지 1x1011, 1x108 내지 5x1010, 5x108 내지 2x1010 개의 바이러스 입자를 포함한 양으로 투여될 수 있다. 상기 투여는 1일 1회, 1일 2회 내지 24회, 1주일에 1회 내지 6회, 1개월에 1회 내지 3회, 또는 1년에 1회 내지 12회 투여될 수 있다.
포유류 무병원성, 발육란 고증식성, 내열성, 약독화 클레이드 2.3.4.4a H5N8 재조합 인플루엔자 A 바이러스는 생산성이 높고 효능이 우수한 백신주로 유용하게 활용될 수 있다.
도 1은 재조합 바이러스 rH5N8, rH5N8-hmH103Y, 및 rH5N8-hmH103Y-310PB2의 모식도를 나타낸다.
도 2a는 MDCK 세포에서 rH5N8, rH5N8-hmH103Y, 및 rH5N8-hmH103Y-310PB2의 접종 후 시간에 따른 세포 배양 감염 용량(TCID50/0.1ml)을 나타낸 그래프이고(*: 해당 바이러스가 다른 바이러스와 비교 시 통계적으로 유의적인 차이를 보임, 신뢰구간 95%, p<0.05), 도 2b는 A549 세포에서 rH5N8, rH5N8-hmH103Y, 및 rH5N8-hmH103Y-310PB2의 접종 후 시간에 따른 세포 배양 감염 용량(TCID50/0.1ml)을 나타낸 그래프이다(*: 해당 바이러스가 다른 바이러스와 비교 시 통계적으로 유의적인 차이를 보임, 신뢰구간 95%, p<0.05).
도 3a 및 도 3b는 각각 마우스에 rH5N8, rH5N8-hmH103Y, 및 rH5N8-hmH103Y-310PB2의 접종 후 시간에 따른 마우스의 체중(g) 및 생존율(%)을 나타내는 그래프이다(●: rH5N8, ■: rH5N8-hmH103Y, ▼: rH5N8-hmH103Y-310PB2, ○: rPR8, □: mock).
도 4는 rH5N8 및 rH5N8-hmH103Y의 인큐베이션 온도(℃)에 따른 HA 역가(log2)를 나타낸 그래프이다.
이하 실시예를 통하여 보다 상세하게 설명한다. 그러나, 이들 실시예는 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1. 고병원성 H5N8 인플루엔자 바이러스의 HA, NA 게놈 및 01310의 PB2 게놈 분절을 갖는 재조합 바이러스 제작 및 특성 분석
1-1. 인플루엔자 바이러스 HA 단백질이 돌연변이된 HA 플라스미드 제작
국내에서 분리된 고병원성 인플루엔자 바이러스 H5N8, H5N6의 HA와 NA 단백질의 아미노산 서열을 비교 및 분석하여, 가장 일치도가 높은 HA 또는 NA의 영역을 선정하였다. 부위 특이적 돌연변이로, HA의 절단 부위(N 말단으로부터 339번 내지 345번 아미노산 서열: N-RERRRKR-C)를 아미노산 서열 N-ASGR-C로 치환하여, 인플루엔자 바이러스의 병원성을 제거하였다.
HA2 단백질의 154번 아스파라긴(Asparagine, N)을 트레오닌(Threonine, T)으로 변경한 HA 유전자와 NA 유전자를 각각 합성하고, 호프만 플라스미드 벡터(한국 특허 제0862758호)에 클로닝하였다.
합성한 H5N8의 HA 단백질의 경우, N 말단으로부터 103번 아미노산을 히스티딘(Histidine: H)에서 티로신(Tyrosine: Y)으로 치환하기 위해 HA 유전자에서 해당하는 아미노산의 코돈을 이루는 뉴클레오티드를 CAC에서 TAC로 치환하고, 그를 중심으로 양 방향으로 동일한 서열을 가지는 약 30bp의 상보적인 프라이머 세트를 제작하였다. 프라이머와 Muta-Direct Site Directed Mutagenesis Kit(iNtRon Co. South Korea)를 사용해 HA 단백질의 103번 아미노산 부분의 게놈이 CAC에서 TAC로 치환된 합성한 H5N8 바이러스의 HA 게놈 클로닝 벡터 플라스미드를 제작하였다.
야생형(wild type) 헤마글루티닌(hemagglutinin: HA)의 아미노산 서열(서열번호 1) 및 HA-H103Y의 아미노산 서열(서열번호 2)을 하기에 나타내었다(N 말단->C말단).
HA:
MEKIVLLLAIVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGTLNDYEELK H LLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGASSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPNTYVSVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPLRERRRKGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVR NGT YDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRICI (서열번호 1)
HA-H103Y:
MEKIVLLLAIVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTHAQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPANDLCYPGTLNDYEELK Y LLSRINHFEKILIIPKSSWPNHETSLGVSAACPYQGASSFFRNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPNTYVSVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPLASGRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVR NGT YDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRICI (서열번호 2)
서열번호 1 및 2에서, 진한 문자 및 밑줄은 HA의 103번째 아미노산의 돌연변이 위치를 나타내고, 진한 문자는 절단 부위의 돌연변이 위치를 나타내고, 이탤릭 문자 및 밑줄은 아스파라긴(N)이 트레오닌(T)로 돌연변이될 수 있는 위치를 나타낸다.
1-2. 재조합 바이러스 제작
재조합 인플루엔자 바이러스 제작을 위하여, 호프만의 역유전학 벡터시스템(한국 특허 제0862758호)을 이용하였다.
구체적으로, 실시예 1-1에서 합성한 고병원성 H5N8 인플루엔자 바이러스의 HA와 NA 핵산 단편이 클로닝된 벡터를 준비하였다. 또한, 저병원성 인플루엔자 바이러스 01310 스트레인의 PB2 핵산 절편이 클로닝된 호프만 플라스미드 벡터, 및 인플루엔자 A 바이러스 PR8 스트레인의 PB1, PA, NP, M, 및 NS 핵산 절편이 클로닝된 호프만 플라스미드 벡터를 준비하였다.
6-웰 세포배양용기에 5%(v/v) FBS를 함유한 DMEM(GIBCO BRL) 배지를 가하고, 1X106개/2 ㎖의 293T 세포(생물자원센터, KCTC)를 각 웰에 첨가한 후 37℃ 및 5% CO2의 조건에서 약 24 시간 동안 인큐베션하여 세포를 부착시켰다. 배지를 제거한 후 Opti-MEM 배지(Invitrogen Co. USA) 0.8 ㎖를 첨가하였다.
준비된 플라스미드 8개를 모두 하나의 1.5 ㎖ 튜브에 각각 300 ng씩의 양으로 넣고, 최종 25㎕가 되도록 Opti-MEM 배지를 첨가하였다. 또다른 1.5 ㎖의 튜브에 6 ㎕의 Plus reagent(Invitrogen Co. USA)와 69 ㎕의 Opti-MEM 배지를 첨가하여 혼합한 후, 플라스미드가 들어있는 1.5 ㎖의 튜브에 첨가하여 혼합하고, 혼합물을 실온에서 약 15분간 인규베이션하였다.
4 ㎕의 lipofectamine(Invitrogen Co)과 96 ㎕의 Opti-MEM을 혼합하고, 상기 플라스미드가 있는 튜브에 첨가한 후 15분간 더 인큐베이션하였다. 반응 생성물을 293T 세포가 들어있는 각 웰에 200 ㎕씩 첨가하였다. 세포를 37℃ 및 5% CO2의 조건에서 20 시간 동안 배양한 후, 웰 당 10 ㎍의 트립신(2.5 ㎍/4 ㎕)과 1 ㎖의 opti-MEM 배지를 첨가하였다. 24시간 후 상층액을 수확하고, 수확된 원액 200 ㎕를 10 내지 11일령 SPF 발육란(Sunrise Co., NY)에 요막강 경로로 접종하였다. 접종된 발육란을 37℃에서 3일간 배양하고, 요막액을 수확하여 혈구응집 여부를 확인하였다. 접종된 발육란은 모두 혈구응집 양성을 보였다. 재조합 바이러스를 rH5N8, rH5N8-hmH103Y, 또는 rH5N8-hmH103Y-310PB2로 명명하고, 바이러스의 모식도를 도 1에 나타내었다.
이 재조합 바이러스의 혈구응집역가를 측정하고, 100배 희석하여 동일한 방법으로 발생란에서 증식시킨 바이러스(E2)를 -70℃에서 보관하였다.
1-3. 바이러스 역가 측정
실시예 1-2의 재조합 바이러스(E2)의 계태아에서의 증식 역가(50% embryo infection dose, EID50/㎖)를 측정하였다. 구체적으로, 각각의 재조합 바이러스들을 인산완충용액으로 10-1 내지 10-9까지 10진 희석하여 각 희석 배수 별로 10 내지 11일령의 SPF 발육란 5개에 요막강 경로로 100 ㎕씩 접종하였다. 그 후 3일간 배양한 후 요막액을 수확하였다. 닭의 적혈구로 혈구응집여부를 확인하고, Spearman-Karber 방법의 계산식에 따라 바이러스 역가(EID50/㎖)를 측정하였다.
1-4. 10일령 발육란에서의 증식성 비교
실시예 1-3에서 얻어진 바이러스 역가(EID50/㎖(log10))를 토대로, 100 EID50의 바이러스를 각 5개의 10일령 발육란에 요막강 경로로 100 ㎕씩 접종하였다. 3일간 배양한 후 요막액을 수확하여 실시예 1-3에 기재된 바와 같이 EID50/㎖를 측정하여 발육란에서의 증식성을 비교한 결과를 표 1에 나타내었다.
재조합 바이러스 | EID50/㎖(log10) |
rH5N8 | 8.3 ± 0.3 |
rH5N8-hmH103Y | 9.3 ± 0.3 |
rH5N8-hmH103Y-310PB2 | 9.3 ± 0.1 |
표 1에 나타난 바와 같이, rH5N8의 바이러스 역가는 108.3 EID50/㎖인 것에 반해, rH5N8-hmH103Y의 바이러스 역가는 109.3 EID50/㎖이고, rH5N8-hmH103Y-310PB2의 바이러스 역가는 109.3 EID50/ml이었다. 따라서, rH5N8-hmH103Y 및 rH5N8-hmH103Y-310PB2의 발육란에서의 증식성이 상승한 것을 확인하였다.
1-5. 재조합 바이러스의 포유류세포에서의 증식성 확인
실시예 1-2의 재조합 바이러스가 포유류 세포에서 증식하는지 비교하기 위해, Madin-Darby Canine Kidney(MDCK) 세포주와 A549 세포주에서의 성장곡선을 확인하였다.
MDCK 세포주는 10%(v/v) 우태아혈청(FBS)을 함유한 Dulbecco's Modified Eagle Medium(DMEM)(Life technologies Co., CA, USA) 배지에서 유지시켰고, A549 세포주는 10%(v/v) 우태아혈청(FBS)을 함유한 DMEM/F12(Life technologies Co., CA, USA) 배지에서 유지시켰다. 두 세포주를 각각 12-웰 세포배양 플레이트에 접종하여 단일 층을 형성시킨 후, 각 재조합 바이러스를 5X105/0.1 ㎖의 양으로 접종하였다. 접종 후, 0 시간, 24 시간, 48 시간, 및 72 시간 마다 상층액을 100 ㎕씩 수득하였다. 수득한 상층액은 10-1 내지 10-9까지 10진 희석하여 96-웰 세포배양 플레이트에 단일 층이 형성된 MDCK 세포에 접종하여, Tissue Culture Infectious Dose (TCID50/0.1ml)을 측정하고, 그 결과를 도 2a(MDCK 세포) 및 도 2b(A549 세포)에 나타내었다.
도 2a 및 도 2b에 나타난 바와 같이, rH5N8과 비교하여, rH5N8-hmH103Y는 MDCK 세포주와 A549 세포주 모두에서 증식성이 높아졌으며, rH5N8-hmH103Y-310PB2는 MDCK 세포주와 A549 세포주 모두에서 증식하지 못하는 것을 확인하였다.
1-6. 마우스에서의 병원성 비교
재조합 바이러스의 포유류 병원성을 확인하기 위해서, 실시예 1-2의 재조합 바이러스를 6주령 암컷 BALB/c 마우스(KOATEC, Pyeongtaek, Korea)에 각각 8마리씩 접종하였다. 접종 후 3일째에 3마리의 마우스의 폐를 샘플링하여 폐에서의 증식성을 비교하였고, 5마리의 2주간 체중변화를 관찰하였다.
마우스를 Zoletil50(15mg/kg, Virbac, Carros, France)을 이용하여 진정시킨 후, 각 바이러스를 비강을 통해 106 EID50/0.1 ㎖의 용량으로 접종하였다. 2주간 체중 변화 관찰 기간 중에 20% 이상 체중 변화가 있는 경우 안락사하였다. 2주간 체중 변화와 생존율을 각각 도 3a 및 도 3b에 나타내었다(●: rH5N8, ■: rH5N8-hmH103Y, ▼: rH5N8-hmH103Y-310PB2, ○: rPR8, □: mock).
3일째에는 각 그룹에서 3마리의 마우스 폐를 샘플링하여, TissueLyzer 2 (Qiagen, Valencia, CA, USA)로 직경 5 mm의 stainless steel beads와 폐 무게의 1/10만큼의 PBS를 넣고 유제하였다. 유제한 후, 13,000 rpm에 10분간 원심분리한 상층액을 10일령 발육란에 접종하여 바이러스 증식여부를 확인하였다. 3개의 샘플을 풀링한 뒤, 10진 희석하여 접종하여 EID50을 측정하고, 그 결과를 표 2에 나타내었다.
재조합 바이러스 | 접종 3일째 마우스 폐에서의 바이러스 재분리율 | 접종 3일째 마우스 폐에서의 EID50/ml(log10) |
rH5N8 | 3/3 | 3.70 |
rH5N8-hmH103Y | 3/3 | 4.50 |
rH5N8-hmH103Y-310PB2 | 0/3 | 0.00 |
rPR8 | 3/3 | 7.25 |
도 3a 및 도 3b에 나타난 바와 같이, 모든 재조합 바이러스는 마우스에서의 체중변화 및 병원성을 보이지 않았다. 그러나, 표 2에 나타난 바와 같이, rH5N8과 rH5N8-hmH103Y의 폐에서 증식하였고, rH5N8-hmH103Y-310PB2는 폐에서도 증식하지 않아, 재조합 바이러스는 포유류에 대한 병원성이 제거되었음을 확인하였다.
1-7. 내열성 비교
H103Y가 실제로 내열성을 높여, 발육란 및 포유류 세포주와 마우스에서의 증식성이 증가하는지 확인하였다.
구체적으로, rH5N8과 rH5N8-hmH103Y 바이러스를 각각 50℃, 55℃, 및 60℃에서 30분간 처리한 후 HA 검사를 통하여 HA 역가를 측정하고, 그 결과를 도 4에 나타내었다.
도 4에 나타난 바와 같이, rH5N8과 달리, rH5N8-hmH103Y의 경우 55℃까지도 HA 단백질이 안정하였다. 따라서, rH5N8-hmH103Y는 내열성을 높이는 것을 확인하였다.
[수탁번호]
기탁기관명 : 생물자원센터
수탁번호 : KCTC14012BP
수탁일자 : 20191030
Claims (14)
- 인플루엔자 바이러스 H5N8 스트레인의 헤마글루티닌(hemagglutinin: HA) 단백질로서,상기 헤마글루티닌 단백질은 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산이 돌연변이된 헤마글루티닌 단백질;H5N8 스트레인의 뉴라미니다제(neuraminidase: NA);저병원성 인플루엔자 바이러스의 중합효소 B2(polymerase subunit B2: PB2); 및인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1(polymerase subunit B1: PB1), 중합효소 A(polymerase subunit A: PA), 뉴클레오캡시드(nucleoprotein: NP), 매트릭스 단백질(matrix: M) 및 비구조적 단백질(nonstructural protein: NS)로 이루어진 군으로부터 선택된 하나 이상의 단백질을 포함하는 H5N8 재조합 인플루엔자 바이러스.
- 청구항 1에 있어서, 상기 헤마글루티닌 단백질은 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산인 히스티딘(H)이 티로신(Y)로 돌연변이된 것인 H5N8 재조합 인플루엔자 바이러스.
- 청구항 1에 있어서, 상기 헤마글루티닌 단백질의 절단 부위(cleavage site)는 돌연변이된 것인 H5N8 재조합 인플루엔자 바이러스.
- 청구항 3에 있어서, 상기 헤마글루티닌 단백질의 절단 부위는 N 말단으로부터 339번째 내지 345번째 아미노산 서열인 것인 H5N8 재조합 인플루엔자 바이러스.
- 청구항 3에 있어서, 상기 헤마글루티닌 단백질의 절단 부위는 아미노산 서열 N-ASGR-C로 돌연변이된 것인 H5N8 재조합 인플루엔자 바이러스.
- 청구항 1에 있어서, 상기 헤마글루티닌 단백질의 HA2 도메인은 서열번호 1의 아미노산 서열에서 N 말단으로부터 498번째 아미노산인 아스파라긴(N)이 트레오닌(T)로 돌연변이된 것인 H5N8 재조합 인플루엔자 바이러스.
- 청구항 1에 있어서, 저병원성 인플루엔자 바이러스는 저병원성 인플루엔자 바이러스 01310 스트레인인 것인 H5N8 재조합 인플루엔자 바이러스.
- 청구항 1에 있어서, 인플루엔자 바이러스 H1N1 스트레인은 A/Puerto Rico/8/34(PR8)인 것인 H5N8 재조합 인플루엔자 바이러스.
- 청구항 1에 있어서, 기탁번호 KCTC14012BP로 기탁된 바이러스인 것인 H5N8 재조합 인플루엔자 바이러스.
- 인플루엔자 바이러스 H5N8 스트레인의 헤마글루티닌 단백질을 코딩하는 폴리뉴클레오티드로서,상기 헤마글루티닌 단백질의 서열번호 1의 아미노산 서열에서 N 말단으로부터 103번째 아미노산이 돌연변이된 폴리뉴클레오티드;H5N8 스트레인의 뉴라미니다제를 코딩하는 폴리뉴클레오티드;저병원성 인플루엔자 바이러스의 중합효소 B2를 코딩하는 폴리뉴클레오티드; 및인플루엔자 바이러스 H1N1 스트레인의 중합효소 B1, 중합효소 A, 뉴클레오캡시드, 매트릭스 단백질 및 비구조적 단백질로 이루어진 군으로부터 선택된 하나 이상의 단백질을 코딩하는 폴리뉴클레오티드를 포함하는 H5N8 재조합 인플루엔자 바이러스 제조용 조성물.
- 청구항 10에 있어서, 상기 폴리뉴클레오티드는 벡터에 포함된 것인 조성물.
- 청구항 10의 H5N8 재조합 인플루엔자 바이러스 제조용 조성물로 형질전환된 세포.
- 청구항 12에 있어서, 상기 세포는 293T, MDCK, Vero, DF1, PK15, 및 ST1 세포로 이루어진 군으로부터 선택된 것인 세포.
- 청구항 1의 H5N8 재조합 인플루엔자 바이러스를 포함하는 백신 조성물.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR10-2019-0143003 | 2019-11-08 | ||
KR1020190143003A KR102259392B1 (ko) | 2019-11-08 | 2019-11-08 | H5n8 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021091279A1 true WO2021091279A1 (ko) | 2021-05-14 |
Family
ID=75848981
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2020/015451 WO2021091279A1 (ko) | 2019-11-08 | 2020-11-06 | H5n8 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물 |
Country Status (2)
Country | Link |
---|---|
KR (1) | KR102259392B1 (ko) |
WO (1) | WO2021091279A1 (ko) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN113913395A (zh) * | 2021-10-19 | 2022-01-11 | 中国农业科学院哈尔滨兽医研究所(中国动物卫生与流行病学中心哈尔滨分中心) | 人工重组的h5n8流感病毒及其制备方法和应用 |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN114524862B (zh) * | 2021-12-16 | 2022-12-27 | 中国农业科学院哈尔滨兽医研究所(中国动物卫生与流行病学中心哈尔滨分中心) | 禽流感(h5+h7)三价dna疫苗的构建及其应用 |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20160073345A (ko) * | 2014-12-16 | 2016-06-24 | 서울대학교산학협력단 | 발육란 고증식성 무병원성 재조합 인플루엔자 바이러스 및 이의 용도 |
KR20180073067A (ko) * | 2016-12-22 | 2018-07-02 | 아이디바이오 주식회사 | 인플루엔자 바이러스의 h9 및 h5의 다중 아형에 대한 교차 면역반응을 형성하는 신규한 재조합 인플루엔자 바이러스 및 이를 포함하는 백신 |
KR20190109876A (ko) * | 2018-03-19 | 2019-09-27 | 한국생명공학연구원 | 신규한 h5n3형 조류인플루엔자 바이러스 및 이를 포함하는 백신 조성물 |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR101415836B1 (ko) * | 2012-07-13 | 2014-07-09 | 대한민국(관리부서 : 농림축산식품부 농림축산검역본부) | 면역원성이 향상된 인플루엔자 바이러스의 ha2 공통 에피톱의 제조 방법 |
-
2019
- 2019-11-08 KR KR1020190143003A patent/KR102259392B1/ko active IP Right Grant
-
2020
- 2020-11-06 WO PCT/KR2020/015451 patent/WO2021091279A1/ko active Application Filing
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20160073345A (ko) * | 2014-12-16 | 2016-06-24 | 서울대학교산학협력단 | 발육란 고증식성 무병원성 재조합 인플루엔자 바이러스 및 이의 용도 |
KR20180073067A (ko) * | 2016-12-22 | 2018-07-02 | 아이디바이오 주식회사 | 인플루엔자 바이러스의 h9 및 h5의 다중 아형에 대한 교차 면역반응을 형성하는 신규한 재조합 인플루엔자 바이러스 및 이를 포함하는 백신 |
KR20190109876A (ko) * | 2018-03-19 | 2019-09-27 | 한국생명공학연구원 | 신규한 h5n3형 조류인플루엔자 바이러스 및 이를 포함하는 백신 조성물 |
Non-Patent Citations (2)
Title |
---|
AN SE-HEE; LEE CHUNG-YOUNG; HONG SEUNG-MIN; CHOI JUN-GU; LEE YOUN-JEONG; JEONG JEI-HYUN; KIM JUN-BEOM; SONG CHANG-SEON; KIM JAE-HO: "Bioengineering a highly productive vaccine strain in embryonated chicken eggs and mammals from a non-pathogenic clade 2·3·4·4 H5N8 strain", VACCINE, ELSEVIER, AMSTERDAM, NL, vol. 37, no. 42, 5 September 2019 (2019-09-05), AMSTERDAM, NL, pages 6154 - 6161, XP085812418, ISSN: 0264-410X, DOI: 10.1016/j.vaccine.2019.08.074 * |
MINISTRY OF AGRICULTURE, FOOD AND RURAL AFFAIRS (SEE PAGES 27 AND 49-53): "Seoul National University. Final Report on Development of Programs and Exit Strategies for Highly Pathogenic AI Vaccination in Korea: Livestock Disease Technology Development Project R&D Report", 2018, pages 1 - 106, XP009528041 * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN113913395A (zh) * | 2021-10-19 | 2022-01-11 | 中国农业科学院哈尔滨兽医研究所(中国动物卫生与流行病学中心哈尔滨分中心) | 人工重组的h5n8流感病毒及其制备方法和应用 |
Also Published As
Publication number | Publication date |
---|---|
KR102259392B1 (ko) | 2021-06-01 |
KR20210056184A (ko) | 2021-05-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2021091279A1 (ko) | H5n8 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물 | |
CN105518129B (zh) | 减毒流感疫苗和其用途 | |
Li et al. | High frequency of reassortment after co-infection of chickens with the H4N6 and H9N2 influenza A viruses and the biological characteristics of the reassortants | |
Ruan et al. | Generation and evaluation of a vaccine candidate of attenuated and heat-resistant genotype VIII Newcastle disease virus | |
WO2021091280A1 (ko) | H9n2 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물 | |
US10323231B2 (en) | Attenuated influenza vaccines and uses thereof | |
Song et al. | Assessing the efficacy of a recombinant H9N2 avian influenza virus–inactivated vaccine | |
KR102614346B1 (ko) | H5n6 재조합 인플루엔자 바이러스, 이의 제조용 조성물, 및 이를 포함하는 백신 조성물 | |
KR101426407B1 (ko) | 고생산성, 고면역원성, 및 무병원성 인플루엔자 바이러스 제작용 재조합 발현 벡터 | |
KR101423695B1 (ko) | 발육계란 고증식성, 무병원성 인플루엔자 바이러스 제작용 재조합 발현 벡터 | |
KR101788234B1 (ko) | 발육란 고증식성 무병원성 재조합 인플루엔자 바이러스 및 이의 용도 | |
WO2020166908A2 (ko) | 이종 인플루엔자 a 바이러스에 대한 면역/치료반응을 형성하는 신규한 재조합 인플루엔자 바이러스 및 이를 포함하는 유전자 전달체 및 치료백신 | |
KR20200001418A (ko) | 재조합 인플루엔자 a 바이러스 h5n1주 및 이를 포함하는 고병원성 인플루엔자 a 바이러스 백신 조성물 | |
KR101788789B1 (ko) | 발육란 고증식성 및 무병원성 인플루엔자 바이러스 | |
KR101582490B1 (ko) | 인플루엔자 바이러스의 다중 아형에 대한 교차 면역반응을 형성하는 신규한 재조합 바이러스 백신 | |
Pizzorno | Mechanisms of resistance to neuraminidase inhibitors in influenza A viruses and evaluation of combined antiviral therapy | |
KR101788236B1 (ko) | 무병원성 및 고면역원성 인플루엔자 바이러스 | |
KR101361774B1 (ko) | 계태아 고증식성 저병원성 재조합 인플루엔자 바이러스 | |
KR101414225B1 (ko) | 발육계란 고증식성 인플루엔자 바이러스 제작용 재조합 발현 벡터 | |
Zhang et al. | Neurovirulence of avian influenza virus is dependent on the interaction of viral NP protein with host factor FMRP in the murine brain | |
van Wielink | Cell culture based production of avian influenza vaccines | |
KR20130055164A (ko) | 계태아 고증식성 저병원성 재조합 인플루엔자 바이러스 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20885766 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 20885766 Country of ref document: EP Kind code of ref document: A1 |