WO2021075853A1 - Emp3 억제제를 포함하는 암 줄기세포 성장 억제용 조성물 및 그 용도 - Google Patents
Emp3 억제제를 포함하는 암 줄기세포 성장 억제용 조성물 및 그 용도 Download PDFInfo
- Publication number
- WO2021075853A1 WO2021075853A1 PCT/KR2020/014018 KR2020014018W WO2021075853A1 WO 2021075853 A1 WO2021075853 A1 WO 2021075853A1 KR 2020014018 W KR2020014018 W KR 2020014018W WO 2021075853 A1 WO2021075853 A1 WO 2021075853A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- emp3
- cancer stem
- cells
- composition
- Prior art date
Links
- 210000000130 stem cell Anatomy 0.000 title claims abstract description 145
- 230000002401 inhibitory effect Effects 0.000 title claims abstract description 44
- 239000003112 inhibitor Substances 0.000 title claims abstract description 42
- 239000000203 mixture Substances 0.000 title claims abstract description 32
- 230000005907 cancer growth Effects 0.000 title claims abstract description 15
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 226
- 201000011510 cancer Diseases 0.000 claims abstract description 225
- 102100030146 Epithelial membrane protein 3 Human genes 0.000 claims abstract description 164
- 230000005012 migration Effects 0.000 claims abstract description 12
- 238000013508 migration Methods 0.000 claims abstract description 12
- 101710143764 Epithelial membrane protein 3 Proteins 0.000 claims description 163
- 210000004027 cell Anatomy 0.000 claims description 93
- 238000011282 treatment Methods 0.000 claims description 42
- 238000000034 method Methods 0.000 claims description 41
- 230000000694 effects Effects 0.000 claims description 39
- 102000052030 Aldehyde Dehydrogenase 1 Family Human genes 0.000 claims description 36
- 101710196131 Aldehyde dehydrogenase 1 Proteins 0.000 claims description 36
- 230000005855 radiation Effects 0.000 claims description 35
- 230000014509 gene expression Effects 0.000 claims description 33
- 108091034117 Oligonucleotide Proteins 0.000 claims description 26
- 108090000623 proteins and genes Proteins 0.000 claims description 26
- 108020004459 Small interfering RNA Proteins 0.000 claims description 20
- 238000011394 anticancer treatment Methods 0.000 claims description 16
- 102000004169 proteins and genes Human genes 0.000 claims description 16
- 230000027455 binding Effects 0.000 claims description 15
- 108020004999 messenger RNA Proteins 0.000 claims description 14
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 12
- 239000004480 active ingredient Substances 0.000 claims description 12
- 201000005202 lung cancer Diseases 0.000 claims description 12
- 208000020816 lung neoplasm Diseases 0.000 claims description 12
- 239000008194 pharmaceutical composition Substances 0.000 claims description 12
- 230000010261 cell growth Effects 0.000 claims description 11
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 11
- 230000035945 sensitivity Effects 0.000 claims description 11
- 206010027476 Metastases Diseases 0.000 claims description 10
- 239000000074 antisense oligonucleotide Substances 0.000 claims description 10
- 238000012230 antisense oligonucleotides Methods 0.000 claims description 10
- 230000009401 metastasis Effects 0.000 claims description 10
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 9
- 108091023037 Aptamer Proteins 0.000 claims description 8
- 101150118826 Emp3 gene Proteins 0.000 claims description 8
- 108091027967 Small hairpin RNA Proteins 0.000 claims description 8
- 238000002512 chemotherapy Methods 0.000 claims description 8
- 239000003446 ligand Substances 0.000 claims description 8
- 229920001184 polypeptide Polymers 0.000 claims description 8
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 8
- 239000004055 small Interfering RNA Substances 0.000 claims description 8
- 208000003174 Brain Neoplasms Diseases 0.000 claims description 6
- 206010006187 Breast cancer Diseases 0.000 claims description 6
- 208000026310 Breast neoplasm Diseases 0.000 claims description 6
- 239000000427 antigen Substances 0.000 claims description 6
- 108091007433 antigens Proteins 0.000 claims description 6
- 102000036639 antigens Human genes 0.000 claims description 6
- 230000002708 enhancing effect Effects 0.000 claims description 6
- 230000002265 prevention Effects 0.000 claims description 6
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 5
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 5
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 5
- 206010038389 Renal cancer Diseases 0.000 claims description 5
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 5
- 239000012634 fragment Substances 0.000 claims description 5
- 206010017758 gastric cancer Diseases 0.000 claims description 5
- 201000010982 kidney cancer Diseases 0.000 claims description 5
- 201000007270 liver cancer Diseases 0.000 claims description 5
- 208000014018 liver neoplasm Diseases 0.000 claims description 5
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 5
- 201000002528 pancreatic cancer Diseases 0.000 claims description 5
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 5
- 201000011549 stomach cancer Diseases 0.000 claims description 5
- 239000002671 adjuvant Substances 0.000 claims description 3
- 230000002018 overexpression Effects 0.000 claims description 3
- 230000004952 protein activity Effects 0.000 claims description 2
- 239000002771 cell marker Substances 0.000 claims 1
- 238000011319 anticancer therapy Methods 0.000 abstract description 2
- 102100040069 Aldehyde dehydrogenase 1A1 Human genes 0.000 abstract 1
- 101710150756 Aldehyde dehydrogenase, mitochondrial Proteins 0.000 abstract 1
- 101001011788 Homo sapiens Epithelial membrane protein 3 Proteins 0.000 abstract 1
- 229940124650 anti-cancer therapies Drugs 0.000 abstract 1
- 230000009545 invasion Effects 0.000 description 14
- 238000012790 confirmation Methods 0.000 description 11
- 230000002829 reductive effect Effects 0.000 description 11
- 230000005764 inhibitory process Effects 0.000 description 9
- 239000002246 antineoplastic agent Substances 0.000 description 8
- 229940041181 antineoplastic drug Drugs 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 238000005755 formation reaction Methods 0.000 description 6
- 150000007523 nucleic acids Chemical class 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 108020004707 nucleic acids Proteins 0.000 description 5
- 102000039446 nucleic acids Human genes 0.000 description 5
- 108091023040 Transcription factor Proteins 0.000 description 4
- 102000040945 Transcription factor Human genes 0.000 description 4
- 230000001093 anti-cancer Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 230000008092 positive effect Effects 0.000 description 4
- 230000001172 regenerating effect Effects 0.000 description 4
- 230000008929 regeneration Effects 0.000 description 4
- 238000011069 regeneration method Methods 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 108020005544 Antisense RNA Proteins 0.000 description 3
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 230000005754 cellular signaling Effects 0.000 description 3
- 239000003184 complementary RNA Substances 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 230000009368 gene silencing by RNA Effects 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 238000003752 polymerase chain reaction Methods 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 230000002194 synthesizing effect Effects 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 2
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 2
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- 101150037203 Sox2 gene Proteins 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 210000002744 extracellular matrix Anatomy 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 239000012669 liquid formulation Substances 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 238000002493 microarray Methods 0.000 description 2
- 235000020777 polyunsaturated fatty acids Nutrition 0.000 description 2
- 238000010837 poor prognosis Methods 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000013589 supplement Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- WZFUQSJFWNHZHM-UHFFFAOYSA-N 2-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperazin-1-yl]-1-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)ethanone Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)N1CCN(CC1)CC(=O)N1CC2=C(CC1)NN=N2 WZFUQSJFWNHZHM-UHFFFAOYSA-N 0.000 description 1
- CONKBQPVFMXDOV-QHCPKHFHSA-N 6-[(5S)-5-[[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperazin-1-yl]methyl]-2-oxo-1,3-oxazolidin-3-yl]-3H-1,3-benzoxazol-2-one Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)N1CCN(CC1)C[C@H]1CN(C(O1)=O)C1=CC2=C(NC(O2)=O)C=C1 CONKBQPVFMXDOV-QHCPKHFHSA-N 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 108091032955 Bacterial small RNA Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000002101 Epithelial membrane protein EMP-3 Human genes 0.000 description 1
- 108050009426 Epithelial membrane protein EMP-3 Proteins 0.000 description 1
- 108010044091 Globulins Proteins 0.000 description 1
- 102000006395 Globulins Human genes 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 108010083674 Myelin Proteins Proteins 0.000 description 1
- 101710126211 POU domain, class 5, transcription factor 1 Proteins 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 102000017143 RNA Polymerase I Human genes 0.000 description 1
- 108010013845 RNA Polymerase I Proteins 0.000 description 1
- 239000012979 RPMI medium Substances 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 230000005757 colony formation Effects 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000011254 conventional chemotherapy Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 238000001647 drug administration Methods 0.000 description 1
- 238000007908 dry granulation Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000003197 gene knockdown Methods 0.000 description 1
- 230000030279 gene silencing Effects 0.000 description 1
- 238000012226 gene silencing method Methods 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 108010082117 matrigel Proteins 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 230000037230 mobility Effects 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 210000000441 neoplastic stem cell Anatomy 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000002534 radiation-sensitizing agent Substances 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 208000016691 refractory malignant neoplasm Diseases 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 238000005550 wet granulation Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1138—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K41/00—Medicinal preparations obtained by treating materials with wave energy or particle radiation ; Therapies using these preparations
- A61K41/0038—Radiosensitizing, i.e. administration of pharmaceutical agents that enhance the effect of radiotherapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1137—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
- A61N2005/1092—Details
- A61N2005/1098—Enhancing the effect of the particle by an injected agent or implanted device
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering N.A.
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/31—Combination therapy
Definitions
- the present invention relates to a composition for inhibiting the growth of cancer stem cells and a use thereof.
- cancer stem cells Similar to normal stem cells present in normal cells, about 1 to 2% of cancer stem cells exist in cancer tissues.
- the cancer stem cells were found to exist in leukemia by Dr. John E. Dick in 1997 (Nat Med, 1997), and since then, breast cancer (PNAS, 2003), brain tumor (Nature, 2004), prostate cancer (Cancer Res, 2005), colon cancer (Nature, 2007), and melanoma (Nature, 2008) have also reported the presence of cancer stem cells.
- These cancer stem cells have the ability to self-renewal, which is the characteristic of normal stem cells, so they can regenerate cancer by self-renewal of cancer-related cells that have been reduced or disappeared by chemotherapy, and have the ability to migrate and invade. Because of this, cancer metastasis can be triggered. Due to the above properties of cancer stem cells, cancer stem cells are becoming a major cause of cancer malignancies, resistance to chemotherapy, and cancer metastasis.
- cancer stem cells In the case of normal stem cells, cell growth and differentiation are regulated by a strictly controlled self-renewal mechanism, whereas cancer stem cells are affected by tumor microenvironmental factors around cancer cells, resulting in abnormal self-renewal and differentiation. Due to the same phenomenon, resistance to anti-cancer treatments such as chemotherapy and radiation therapy by anti-cancer drugs may be obtained, and metastasis and recurrence of cancer may be caused.
- the inventors of the present invention confirmed that the expression level of EMP3 (Epithelial membrane protein 3) and the characteristics of cancer stem cells are related while studying a technology for treating cancer with anticancer treatment-resistant cancer stem cell characteristics, and completed the present invention.
- EMP3 Epidermal membrane protein 3
- an object of the present invention is a composition for inhibiting cancer stem cell growth that can be used to remarkably improve the effect of cancer treatment through inhibition of self-renewal, inhibition of invasion, and inhibition of metastasis of cancer-related cells, a pharmaceutical composition for preventing or treating cancer. It is to provide a composition, and a composition for adjuvant radiation anticancer treatment.
- the present invention provides a composition for inhibiting cancer stem cell growth comprising an EMP3 (Epithelial membrane protein 3) inhibitor as an active ingredient.
- EMP3 Epidermal membrane protein 3
- the present invention provides a pharmaceutical composition for preventing or treating cancer of ALDH1 overexpressing cancer stem cell characteristics comprising an EMP3 (Epithelial membrane protein 3) inhibitor as an active ingredient.
- EMP3 Epidermal membrane protein 3
- the present invention provides a radiation anticancer treatment auxiliary composition comprising an EMP3 (Epithelial membrane protein 3) inhibitor as an active ingredient.
- EMP3 Epidermal membrane protein 3
- the present invention comprises the step of inhibiting the expression or activity of an EMP3 (Epithelial membrane protein 3) inhibitor in an individual, a method for inhibiting the growth of cancer stem cells, a method for preventing or treating cancer having cancer stem cell characteristics, and/or It provides a method of enhancing the sensitivity of cancer cells to radiation.
- EMP3 Epidermal membrane protein 3
- the present invention is an EMP3 (Epithelial membrane protein 3) inhibitor for use in inhibiting the growth of cancer stem cells, EMP3 (Epithelial membrane protein 3) inhibitor for use in the prevention or treatment of cancer having cancer stem cell characteristics. And/or it provides an EMP3 (Epithelial membrane protein 3) inhibitor for use in enhancing the sensitivity of cancer cells to radiation.
- EMP3 Epidermal membrane protein 3
- composition of the present invention it is possible to inhibit the growth of cancer stem cells by reducing the self-renewal ability, invasion ability, and migration ability of cancer stem cells expressing ALDH1 by treatment with an EMP3 inhibitor, thereby inhibiting the growth of cancer stem cells. It can effectively treat cancer with stem cell characteristics that are resistant to cancer.
- FIG. 2 shows the ability to form a sphere after treatment with the EMP3 antibody on ALDH1-positive cells, where A is a result of observing the ability to form a sphere with a microscope, and B is a result of measuring the number of spheres.
- FIG. 3 is a view of the ability to form a sphere and the expression pattern of the gene after treatment with si-EMP3 on ALDH1-positive cells, where A is a photograph of observing the ability to form a sphere with a microscope and the result of measuring the number of spheres, and B is It shows the results of confirming the expression of a target gene of cancer stem cells and a transcription factor involved in the regeneration ability of cancer stem cells.
- 5 is a graph showing the results of microscopic observation and the number of transferred cells in order to confirm the ability of cancer stem cells to migrate after treatment with the EMP3 antibody on ALDH1-positive cells.
- 6 is a graph showing the results of microscopic observation and the number of transferred cells in order to confirm the invasion ability of cancer stem cells after treatment with the EMP3 antibody on ALDH1-positive cells.
- FIG. 7 is a graph showing the results of microscopic observation and the number of transferred cells in order to confirm the ability of cancer stem cells to migrate after treatment with si-EMP3 on ALDH1-positive cells.
- FIG. 8 is a graph showing the results of microscopic observation and the number of transferred cells in order to confirm the invasion ability of cancer stem cells after treatment with si-EMP3 on ALDH1-positive cells.
- 11 is a Kaplan-Meier curve showing the survival rate in the lung cancer patient group with high expression of EMP3.
- the present invention provides a composition for inhibiting cancer stem cell growth comprising an EMP3 (Epithelial membrane protein 3) inhibitor as an active ingredient.
- EMP3 Epidermal membrane protein 3
- cancer stem cell refers to an undifferentiated cell having the ability to differentiate into various cancer cells.
- Cancer stem cells are present in the malignant tumor tissue at 1 ⁇ 2%, and have the ability to self-replicating and pre-differentiate, which are the characteristics of normal stem cells, but have abnormal self-regulatory functions. Differentiates into Due to the characteristics of such cancer stem cells, general cancer cells are removed through anticancer treatment, but cancer stem cells survive, and it is known that cancer recurrence and metastasis are made by some of the surviving cancer stem cells.
- the cancer stem cells of the present invention may be cancer cells in which aldehyde dehydrogenase 1 (ALDH1) protein, which is one of the markers of cancer stem cells, is overexpressed or protein activity is positive.
- ADH1 aldehyde dehydrogenase 1
- EMP3 epidermal growth factor 3
- EMP3 can obtain an excellent anticancer effect by selectively inhibiting cancer stem cells expressing a specific marker, and killing a group of cancer cells containing cancer stem cells having high resistance to anticancer treatment in particular.
- cancer cells were classified into cancer stem cells and general cancer cells, and it was confirmed that EMP3 was expressed at a high level in the classified cancer stem cells.
- the term'EMP3 inhibitor' is used collectively for substances that reduce EMP3 expression or activity, and specifically, EMP3 expression in a manner such as acting directly on EMP3 or indirectly acting on its ligand. It may include any agent that reduces the expression level of EMP3 or its activity by reducing at the transcription level or interfering with its activity.
- the EMP inhibitor can be used without limitation in its form, such as a compound, nucleic acid, peptide, virus, or vector containing the nucleic acid that can target EMP3 and inhibit the expression or activity of EMP3.
- the EMP3 inhibitor is not limited thereto, but specifically, may be an oligonucleotide that inhibits the expression of EMP3 mRNA, or an antibody or antigen-binding fragment thereof that inhibits the activity of the EMP3 protein or a ligand protein for EMP3, and more specifically, the The oligonucleotide acting on EMP3 mRNA may be an antisense oligonucleotide, aptamer, shRNA or siRNA specific for EMP3 mRNA.
- the term "antisense oligonucleotide” is a DNA, RNA or derivative thereof containing a nucleic acid sequence that is complementary to a sequence of a specific mRNA, and inhibits translation of the mRNA into a protein by binding to a complementary sequence in the mRNA. It works.
- the antisense oligonucleotide sequence refers to a DNA or RNA sequence that is complementary to the EMP3 mRNA and capable of binding to the mRNA. This can inhibit the translation, translocation into the cytoplasm, maturation, or any other essential activity for the overall biological function of the EMP3 mRNA.
- the length of the antisense oligonucleotide may be 6 to 100 bases, preferably 8 to 60 bases, and more preferably 10 to 40 bases.
- the antisense oligonucleotide may be synthesized in vitro by a conventional method and administered in vivo, or the antisense oligonucleotide may be synthesized in vivo.
- One example of synthesizing antisense oligonucleotides in vitro is the use of RNA polymerase I.
- One example of allowing antisense RNA to be synthesized in vivo is to allow antisense RNA to be transcribed using a vector whose origin is in the opposite direction of the multicloning site (MCS).
- MCS multicloning site
- the antisense RNA has a translation stop codon in the sequence so that it is not translated into a peptide sequence.
- the design of the antisense oligonucleotide that can be used in the present invention can be prepared according to a method known in the art by referring to the base sequence of EMP3.
- the term "aptamer” is a single-stranded oligonucleotide, has a size of about 20 to 60 nucleotides, and refers to a nucleic acid molecule having binding activity to a predetermined target molecule. It has various three-dimensional structures depending on the sequence, and can have high affinity with a specific substance, such as an antigen-antibody reaction.
- the aptamer can inhibit the activity of a predetermined target molecule by binding to a predetermined target molecule.
- the aptamer of the present invention may be RNA, DNA, modified nucleic acid, or a mixture thereof, and may also be in a linear or cyclic form.
- the aptamer may play a role of inhibiting the activity of EMP3 by binding to EMP3.
- Such an aptamer can be prepared from the sequence of EMP3 by a method known to those skilled in the art.
- the terms "siRNA” and “shRNA” are nucleic acid molecules capable of mediating RNA interference or gene silencing, and because they can inhibit the expression of a target gene, an efficient gene knockdown method or gene It is used as a treatment method.
- the shRNA is a hairpin structure formed by binding between complementary sequences in a single-stranded oligonucleotide, and in vivo, the shRNA is a small RNA fragment having a size of 21 to 25 nucleotides while being cleaved by a dicer. It becomes siRNA, a double-stranded oligonucleotide, and can inhibit expression by specifically binding to mRNA having a complementary sequence.
- the EMP3 can be inhibited by specifically acting on EMP3 and cleaving the EMP3 mRNA molecule to induce RNA interference (RNAi).
- RNAi RNA interference
- siRNA can be synthesized chemically or enzymatically.
- the siRNA production method is not particularly limited, and a method known in the art may be used.
- a method of directly chemically synthesizing siRNA a method of synthesizing siRNA using in vitro transcription, a method of digesting long double-stranded RNA synthesized by in vitro transcription using an enzyme, Expression methods through intracellular delivery of shRNA expression plasmids or viral vectors, and expression methods through intracellular delivery of a polymerase chain reaction (PCR) induction siRNA expression cassette are not limited thereto.
- PCR polymerase chain reaction
- the siRNA for EMP3 of the present invention may be composed of a double strand of an oligonucleotide of SEQ ID NO: 2 and an oligonucleotide having a complementary sequence thereof, but is not limited thereto.
- the oligonucleotide of SEQ ID NO: 2 includes an oligonucleotide containing substantially the same nucleotide sequence as the oligonucleotide of SEQ ID NO: 2 or SEQ ID NO: 3.
- the oligonucleotide comprising the substantially identical nucleotide sequence includes a nucleotide sequence having 75% or more, 80% or more, 80% or more, 95% or more sequence homology with the nucleotide sequence of SEQ ID NO: 2 or 3, respectively. Means oligonucleotide.
- the term "antibody” refers to a substance that reacts when an external substance, which is an antigen, invades while circulating in blood or lymph in the immune system of a living body, and is a globulin-based protein formed in lymphatic tissues and is also called immunoglobulin.
- Antibodies are proteins that B cells produce and flow into body fluids. They specifically bind to antigens.
- One antibody molecule has two heavy chains and two light chains, each of which is a heavy chain. And light chains have a variable region at the end of their N-terminal.
- Each variable region consists of three complementarity determining regions (CDRs) and four framework regions (FRs), and the complementarity determining regions determine the antigen binding specificity of the antibody, and the structure of the variable region. It exists as a relatively short peptide sequence that is maintained at the forming sites.
- the antibody may be an antibody capable of inhibiting the activity of EMP3 by binding to EMP3 or a ligand protein of EMP3.
- ligand refers to a substance that forms a complex with a biomolecule to bring about a biological reaction
- a ligand protein for EMP3 or a “ligand protein for EMP3” binds to EMP3 to activate EMP3. It may be a protein that causes or increases its activity.
- the antibody against EMP3 of the present invention may be a polypeptide that binds to the amino acid sequence of SEQ ID NO: 4, but is not limited thereto.
- polypeptide binding to the amino acid sequence of SEQ ID NO: 4 includes a polypeptide having an amino acid sequence substantially the same as that of the polypeptide binding to the amino acid sequence of SEQ ID NO: 4, and a variant thereof or an active fragment thereof.
- the polypeptide comprising the substantially identical amino acid sequence refers to a polypeptide comprising an amino acid sequence having 75% or more, 80% or more, 90% or more, 95% or more sequence homology with the polypeptide that binds to the amino acid sequence of SEQ ID NO: 4, respectively. Means.
- the EMP3 inhibitors can inhibit the growth of cancer stem cells by reducing the self-renewal ability, invasion ability, and migration ability of cancer stem cells.
- the present invention provides a method for inhibiting the growth of cancer stem cells comprising the step of inhibiting the expression or activity of an EMP3 (Epithelial membrane protein 3) inhibitor in a subject.
- EMP3 Epidermal membrane protein 3
- the method for inhibiting the growth of cancer stem cells may be performed by administering an EMP3 inhibitor to an individual.
- The'subject' may include humans.
- the term'subject' may be a subject in need thereof, and the subject in need of the administration is an individual who has been diagnosed with a related disease and has related symptoms. It may include not only an expressed individual, but also an individual wishing to be administered for preventing the onset of a disease or symptom or improving health.
- the subject in need of the administration may be an individual who has developed resistance to an existing anticancer agent, or the like.
- the present invention provides an EMP3 (Epithelial membrane protein 3) inhibitor for use in inhibiting the growth of cancer stem cells.
- EMP3 Epidermal membrane protein 3
- the present invention provides a composition for preventing or treating cancer having cancer stem cell characteristics comprising an EMP3 (Epithelial membrane protein 3) inhibitor as an active ingredient.
- EMP3 Epidermal membrane protein 3
- Cancer with the characteristics of cancer stem cells shows resistance to existing anticancer treatments and has a poor prognosis. Therefore, different treatments from existing anticancer treatments must be applied. For example, even if the patient has the same carcinoma, if the carcinoma is the case in which the proportion of cancer stem cells is high, the patient will not be able to obtain a cancer treatment effect with previously known chemotherapy such as anticancer drug administration or radiation therapy. . Therefore, even with the same type of cancer, it is very important to apply a new treatment different from the existing anticancer treatment when the proportion of cancer stem cells is high in the cells of the cancer lesion site.
- 'cancer having cancer stem cell characteristics' means a cancer in which the proportion of cancer stem cells is high in the cell group constituting the cancer. Considering that the proportion of cancer stem cells among general cancer cells is about 1% or more and less than 5%, for example, the proportion of cancer stem cells in the cell group constituting cancer is 5% or more, 10% or more, 30% or more, 50%. Above, the case of more than 70% may be defined as'cancer having cancer stem cell characteristics', and as described above, it may be characterized by a poor anticancer treatment prognosis due to resistance to the existing anticancer treatment.
- the'cancer having cancer stem cell characteristics' may be a cancer that overexpresses ALDH1.
- the cancer that overexpresses ALDH1 may be a cancer in which the proportion of cancer stem cells expressing ALDH1 or having a positive activity thereof is relatively higher than that of general cancer.
- the'cancer overexpressing ALDH1' may be any one or more selected from the group consisting of lung cancer, breast cancer, liver cancer, kidney cancer, stomach cancer, pancreatic cancer, and brain cancer, but is not limited thereto.
- the present inventors differentiated and selected ALDH1 activating cells and ALDH1 inactive cells, and confirmed that the amount of EMP3 expression increased in ALDH1 activating cells.
- the present inventors believe that the regeneration, growth, invasion, and mobility of lung cancer stem cells decrease when the ALDH1-activated lung cancer cells are treated with an EMP3 inhibitor, so that cancer stem cells having ALDH1 activity are cancerous. It was confirmed that it is a major factor in growth.
- composition for preventing or treating cancer having cancer stem cell characteristics of the present invention the contents of EMP and EMP inhibitor are as described above.
- the prevention or treatment of cancer may be to prevent cancer chemical resistance, cancer recurrence, or cancer metastasis during or after cancer treatment by reducing the regenerative capacity, growth capacity, invasive capacity, or mobility of cancer stem cells. .
- the pharmaceutical composition may further include a pharmaceutically acceptable carrier or additive in addition to the EMP3 inhibitor.
- the pharmaceutical composition of the present invention may be administered alone or in admixture with any convenient carrier and the like, and such dosage form may be a single administration or repeated administration dosage form.
- the pharmaceutical composition may be a solid formulation or a liquid formulation.
- Solid preparations include, but are not limited to, powders, granules, tablets, capsules, and suppositories.
- the solid preparation may include a carrier, a flavoring agent, a binder, a preservative, a disintegrant, a lubricant, a filler, etc., but is not limited thereto.
- Liquid formulations include, but are not limited to, solutions such as water and propylene glycol solutions, suspensions, and emulsions, and may be prepared by adding suitable coloring agents, flavoring agents, stabilizers, and viscosifying agents.
- the powder can be prepared by simply mixing a tri-hydroxy derivative of polyunsaturated fatty acid, which is an active ingredient of the present invention, and a suitable pharmaceutically acceptable carrier such as lactose, starch, and microcrystalline cellulose.
- Granules are prepared by mixing the tri-hydroxy derivative of the polyunsaturated fatty acid of the present invention, a suitable pharmaceutically acceptable carrier, and a suitable pharmaceutically acceptable binder such as polyvinylpyrrolidone and hydroxypropylcellulose, and then water, It can be prepared using a wet granulation method using a solvent such as ethanol or isopropanol or a dry granulation method using a compressive force.
- tablets may be prepared by mixing the granules with a suitable pharmaceutically acceptable lubricant such as magnesium stearate, and then tableting them using a tablet press.
- the pharmaceutical composition may be oral, injection (e.g., intramuscular injection, intraperitoneal injection, intravenous injection, infusion, subcutaneous injection, implant), inhalant, nasal administration, It may be administered as a vaginal, rectal, sublingual, transdermal, topical, or the like, but is not limited thereto.
- injection e.g., intramuscular injection, intraperitoneal injection, intravenous injection, infusion, subcutaneous injection, implant
- inhalant nasal administration
- nasal administration It may be administered as a vaginal, rectal, sublingual, transdermal, topical, or the like, but is not limited thereto.
- it may be formulated in a suitable dosage unit dosage form comprising a pharmaceutically acceptable vehicle, excipient, vehicle, which is conventionally used and non-toxic.
- the pharmaceutical composition may be administered at a daily dose of about 0.0001 mg/kg to about 10 g/kg, and about 0.001 mg/kg to about 1 g/kg.
- the dosage may vary depending on the degree of purification of the mixture, the patient's condition (age, sex, weight, etc.), the severity of the condition being treated, and the like. If necessary, for convenience, the total daily dose may be divided and administered several times during the day.
- the present invention provides a method for preventing or treating cancer having cancer stem cell characteristics.
- the method of preventing or treating cancer may include the step of inhibiting the expression or activity of EMP3 (Epithelial membrane protein 3) in the subject, and for example, this may be performed by administering the above-described EMP3 inhibitor to the subject.
- EMP3 Epidermal membrane protein 3
- The'cancer having cancer stem cell characteristics' is a cell in which the proportion of cells expressing ALDH1 or having a positive activity thereof is high in the total cell group constituting the cancer, for example, cells expressing the ALDH1 in the total cell group constituting the cancer or having a positive activity thereof.
- the proportion of may be 5% or more, 10% or more, 30% or more, 50% or more, or 70% or more.
- the cancer may be any one selected from the group consisting of lung cancer, breast cancer, liver cancer, kidney cancer, gastric cancer, pancreatic cancer, and brain cancer, but is not limited thereto.
- the present invention provides an EMP3 (Epithelial membrane protein 3) inhibitor for use in the prevention or treatment of cancer having cancer stem cell characteristics.
- the present invention provides a composition for adjuvant radiation anticancer treatment comprising an EMP3 (Epithelial membrane protein 3) inhibitor as an active ingredient.
- EMP3 Epidermal membrane protein 3
- composition of the present invention contains an EMP3 inhibitor as an active ingredient for improving radiation sensitivity of cancer-related cells.
- EMP3 and EMP3 inhibitor are as described above.
- the cancer-related cells of the present invention are cells constituting cancer, and may have characteristics that are not uniform in shape compared to normal cells, proliferate indefinitely, and have weak binding strength with surrounding cells.
- the cancer-related cells may be cancer cells or cancer stem cells, and specifically cancer stem cells.
- the cancer stem cells may be undifferentiated cells having the ability to differentiate into various cancer cells, and specifically, may be cancer cells expressing ALDH1 or having positive activity.
- the cancer stem cells may have characteristics such that cell proliferation is not inhibited even by irradiation of radiation, self-renewal ability is not reduced, and migration and invasive ability are not inhibited.
- the cancer-related cells may have low sensitivity to radiation, that is, have high resistance to radiation treatment, and may not be able to treat anticancer treatment by irradiation because they have no sensitivity to radiation.
- the anticancer may be one that inhibits the proliferation of cancer-related cells, inhibits metastasis and invasion, and induces cell death through radiation irradiation, surgical surgery, and chemotherapy.
- the anticancer may be administered with the EMP3 inhibitor in combination with irradiation.
- the EMP3 inhibitor is administered in combination with irradiation as described above, so that the anticancer treatment effect by radiation can be maximized, and furthermore, cancer recurrence and metastasis can be prevented. Can be prevented.
- EMP3 Epidermal membrane protein 3
- the cancer cells may be cancer cells including cancer stem cells, for example, the proportion of cancer stem cells in the cell group constituting the cancer is 5% or more, 10% or more, 30% or more, 50% or more, 70% or more. I can.
- the present invention provides an EMP3 (Epithelial membrane protein 3) inhibitor for use in enhancing the sensitivity of cancer cells to radiation.
- EMP3 Epidermal membrane protein 3
- Human lung cancer cell line A549 obtained from ATCC (American type culture collection) was cultured in RPMI medium containing 10% fetal calf serum and streptomycin (100 g/ml) at 37° C. and humidified 5% CO 2 conditions. And the A549 cell line cultured as described above was re-cultivated in DMEM/F12 medium containing bFGF (20 ng/ml), bEGF (20 ng/ml) and B27 stem cell supplement (1X), thereby causing A549 to become cancerous. It was made into stem cells.
- A549 cells cultured in Preparation Example 1 were classified into ALDH1-positive cells (A549-ALDH1+) and ALDH1-negative cells (A549-ALDH1-) through the activity of ALDH1, a marker protein of lung cancer stem cells.
- the A549-ALDH1 + cells isolated in Example 1 were aliquoted into 25 T-Flask by 5 ⁇ 10 5 cells and sufficiently cultured.
- DMEM/F12 containing cancer stem cell culture medium bFGF (20 ng/ml), bEGF (20 ng/ml) and B27 stem cell supplement (1X)
- bFGF cancer stem cell culture medium
- bEGF bEGF
- the number and size of spherical formations were confirmed by using a microscope for the cells converted into cancer stem cells.
- siRNA is a 19-mer si-RNA of each of the forward primer 5'-CUG CUU UUC GUG GCC ACU U-3' and the reverse primer 5'-AAG UGG CCA CGA AAA GCA U-3' for EMP3 gene BIONEER The product ordered from the company was used.
- Fig. 3B it was confirmed that the expression of the target protein of the cancer stem cells was reduced. In addition, it was confirmed that sox2 and oct4, transcription factors involved in the regenerative ability of cancer stem cells, were reduced.
- EMP3 is involved in the formation of cancer stem cells and can inhibit the formation of cancer stem cells by regulating transcription factors involved in the regeneration ability of cancer stem cells.
- A549-ALDH1 + cells were dispensed one by one into a 96 well plate, and sufficiently cultured. 0.15 to A549-ALDH1 + cells cultured as above ⁇ g/mL of EMP3 antibody and IgG were treated, respectively, and incubated for 2 weeks.
- A549-ALDH1 + cancer stem cells treated with or without EMP3 antibody were subjected to a microscope to measure the number of cells present in the plate.
- A549-ALDH1 + cancer stem cells were isolated using trypsin, and 5 ⁇ 10 4 cells were each suspended in 200 ⁇ l nutrient medium, followed by 0.15 ⁇ g/mL of EMP3 antibody and IgG were placed in a transwell upper chamber having a pore size of 8 ⁇ m, and 800 ⁇ l of RPMI1640 medium containing 10% fetal calf serum was added to the lower chamber. Combined. Thereafter, the cancer stem cells were cultured in an incubator at 37° C. in 5% CO 2 conditions for 48 hours. Then, the membrane of the upper chamber was wiped with a cotton swab, stained with a crystal violet solution and observed under a microscope, and the number of cancer stem cells was measured to confirm the ability to move.
- EMP3 regulates the exercise capacity of cancer stem cells, and by inhibiting EMP3, the ability to move and invade cancer stem cells can be very effectively inhibited.
- EMP3 can control the radiation resistance ability of cancer cells, including cancer stem cells, and that EMP3 can be a target for radiation sensitizers used in radiation therapy.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Immunology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Mycology (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
본 발명은 암 줄기세포 성장 억제용 조성물 및 이의 용도에 관한 것으로, EMP3 억제제를 처리하여 ALDH1을 발현하는 암 줄기세포의 자가재생 능력, 침윤 능력 및 이동 능력을 감소시킴으로써 암 줄기세포의 성장을 억제할 수 있고, 그로 인해 기존의 항암 치료 방법에 내성이 있는 암 줄기세포 특성의 암을 효과적으로 치료할 수 있다.
Description
본 발명은 암 줄기세포 성장 억제용 조성물 및 이의 용도에 관한 것이다.
정상 세포에 존재하는 정상 줄기세포와 유사하게, 암 조직 내에도 1 내지 2% 정도의 암 줄기세포(cancer stem cell)가 존재 한다. 상기 암 줄기세포는 1997년 John E. Dick 박사에 의해 백혈병에서 존재가 밝혀졌으며(Nat Med, 1997), 그 이후로 유방암(PNAS, 2003), 뇌종양(Nature, 2004), 전립선암(Cancer Res, 2005), 대장암(Nature, 2007), 흑색종(Nature, 2008)에서도 암 줄기세포의 존재가 보고되었다. 이와 같은 암 줄기세포는 정상 줄기세포의 특성인 자가재생(Self-renewal) 능력을 갖고 있어 항암 치료에 의해 줄어들거나 사라진 암 관련 세포를 자가재생 시킴으로써 암을 재발시킬 수 있으며, 이동 및 침윤 능력을 갖기 때문에 암 전이가 유발되도록 할 수 있다. 암 줄기세포의 위와 같은 성질에 의해 암의 악성화, 항암 치료에 대한 저항성 및 암 전이의 주된 원인으로 암 줄기세포가 크게 부각되고 있다.
정상 줄기세포의 경우 엄격하게 조절되는 자가재생 기전에 의해 세포의 성장과 분화가 조절되는 반면, 암 줄기세포는 암 세포 주변의 종양미세환경 인자에 의해 영향을 받아 비정상적인 자가재생과 분화가 일어나며, 이와 같은 현상으로 인해 항암제에 의한 화학요법, 방사선 치료 등과 같은 항암 치료에 대한 저항성을 획득하고, 암의 전이 및 재발을 야기할 수 있다.
항암 치료를 위해서 암 줄기세포를 표적하여 치료할 필요성이 높음에도 불구하고, 현재 시판되고 있는 대부분의 항암제들은 암 세포에서 알려진 표적 유전자를 억제하거나 암 세포 내에서 암과 관련된 세포신호전달을 억제하는 기작으로 작동하는 것으로, 이와 같은 기작으로 작동하는 항암제는 암과 관련된 유전자 또는 단백질의 변이와 복잡한 세포신호전달로 인하여, 항암 치료에 적용되는데 어려움이 있다. 따라서, 암 환자의 치료효과 및 생존율을 높이기 위해서는 암 줄기세포를 표적으로 하는 치료방법이 필요하다.
본 발명자들은 항암 치료 저항성 암 줄기세포 특성의 암을 치료하는 기술을 연구하던 중, EMP3(Epithelial membrane protein 3)의 발현 정도와 암 줄기세포의 특성이 관련되어 있음을 확인하고 본 발명을 완성하였다
이에, 본 발명의 목적은 암 관련 세포의 자가재생 억제, 침윤 억제 및 전이 억제를 통해 암 치료 효과를 현저하게 향상시키는데 이용될 수 있는 암 줄기세포 성장 억제용 조성물, 암의 예방 또는 치료용 약학적 조성물, 및 방사선 항암 치료 보조용 조성물을 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 암 줄기세포 성장 억제용 조성물을 제공한다.
또한, 본 발명은 EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 ALDH1 과발현 암 줄기세포 특성의 암 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 본 발명은 EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 방사선 항암 치료 보조용 조성물을 제공한다.
또한, 본 발명은 개체에서 EMP3(Epithelial membrane protein 3) 억제제의 발현 또는 활성을 억제하는 단계를 포함하는, 암 줄기세포의 성장 억제 방법, 암 줄기세포 특성을 갖는 암의 예방 또는 치료방법 및/또는 암세포의 방사선에 대한 민감도 증진 방법을 제공한다.
또한, 본 발명은 암 줄기세포의 성장을 억제하는 용도로 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제, 암 줄기세포 특성을 갖는 암의 예방 또는 치료에 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제 및/또는 암세포의 방사선에 대한 민감도를 증진하는 용도로 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제를 제공한다.
본 발명의 조성물에 따르면, EMP3 억제제를 처리하여 ALDH1을 발현하는 암 줄기세포의 자가재생 능력, 침윤 능력 및 이동 능력을 감소시킴으로써 암 줄기세포의 성장을 억제할 수 있고, 그로 인해 기존의 항암 치료 방법에 내성이 있는 암 줄기세포 특성의 암을 효과적으로 치료할 수 있다.
또한, 기존의 항암제 또는 방사선 치료와 병행 처리함으로써 항암 활성을 보다 높일 수 있으며, 항암제 사용량을 획기적으로 줄일 수 있어서 항암제 사용에 따른 부작용을 경감시킬 수 있고, 종래 방사선 치료에 저항성이 존재하여 치료가 쉽지 않던 개체에 대한 방사선 항암 치료의 효과를 현저하게 향상시킬 수 있는 기술로, 기존의 항암 치료의 예후가 좋지 않은 암 줄기세포 특성의 암의 효과적인 치료에 유용하다.
도 1은 마이크로어레이를 이용하여 ALDH1 양성 세포와 ALDH1 음성 세포에서 EMP3의 발현의 차이를 확인한 결과를 나타낸 것이다.
도 2는 ALDH1 양성 세포에 EMP3 항체를 처리한 후 구형 형성 능력을 확인한 것으로, A는 구형 형성 능력을 현미경으로 관찰한 결과이고, B는 구형 형성 개수를 측정한 결과를 나타낸 것이다.
도 3은 ALDH1 양성 세포에 si-EMP3를 처리한 후 구형 형성 능력 및 유전자 발현 양상을 확인한 것으로, A는 구형 형성 능력을 현미경으로 관찰한 사진과 구형 형성 개수를 측정한 결과를 나타낸 것이고, B는 암 줄기세포의 표적 유전자와 암 줄기세포의 재생능력에 관여하는 전사 인자의 발현 여부를 확인한 결과를 나타낸 것이다.
도 4의 ALDH1 양성 세포에 EMP3 항체를 처리한 후 암 줄기세포의 자가재생능력을 확인한 것으로, A는 현미경 관찰 결과를 나타낸 것이고, B는 측정된 암 줄기세포의 개수를 그래프로 나타낸 것이다.
도 5는 ALDH1 양성 세포에 EMP3 항체를 처리한 후 암 줄기세포의 이동 능력을 확인하기 위하여 현미경 관찰 결과 및 이동된 세포 개수를 그래프로 나타낸 것이다.
도 6은 ALDH1 양성 세포에 EMP3 항체를 처리한 후 암 줄기세포의 침윤 능력을 확인하기 위하여 현미경 관찰 결과 및 이동된 세포 개수를 그래프로 나타낸 것이다.
도 7은 ALDH1 양성 세포에 si-EMP3를 처리한 후 암 줄기세포의 이동 능력을 확인하기 위하여 현미경 관찰 결과 및 이동된 세포 개수를 그래프로 나타낸 것이다.
도 8은 ALDH1 양성 세포에 si-EMP3를 처리한 후 암 줄기세포의 침윤 능력을 확인하기 위하여 현미경 관찰 결과 및 이동된 세포 개수를 그래프로 나타낸 것이다.
도 9는 ALDH1 양성 세포에 EMP3 항체를 처리한 후 암 줄기세포의 방사선에 대한 저항 능력을 확인한 결과를 나타낸 것이다.
도 10은 ALDH1 양성 세포에 si-EMP3를 처리한 후 암 줄기세포의 방사선에 대한 저항 능력을 확인한 결과를 나타낸 것이다.
도 11은 EMP3의 발현이 높은 폐암 환자군에서의 생존율을 Kaplan-Meier 곡선으로 나타낸 것이다.
이하, 본 발명을 상세히 설명한다.
일 측면에서 본 발명은 EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 암 줄기세포 성장 억제용 조성물을 제공한다.
본 발명에서 '암 줄기세포(cancer stem cell, CSC)'는 다양한 암 세포로 분화할 수 있는 능력을 가진 미분화 세포를 의미한다. 암 줄기세포는 악성종양 조직 내에 1~2% 정도로 존재하며 정상 줄기세포의 특성인 자가 복제 능력과 전 분화능을 가지고 있으나 자가조절 기능에 이상이 있어 세포분열 활성화로 세포 수가 증가하게 되고 스스로 악성 종양세포로 분화한다. 이와 같은 암 줄기세포의 특징에 의하여 항암 치료를 통하여 일반 암세포는 제거되지만 암 줄기세포는 살아남으며, 살아남은 일부의 암 줄기세포에 의하여 암의 재발 및 전이가 이루어진다고 알려져 있다.
구체적으로, 본 발명의 암 줄기세포는 암 줄기세포의 마커 중 하나인 ALDH1(aldehyde dehydrogenase 1) 단백질이 과발현되거나 단백질 활성이 양성인 암 세포 일 수 있다.
본 명세서에서 'EMP3(Epithelial membrane protein 3)'는 말초 미엘린(myelin) 유전자 패밀리의 하나로 세포 간 상호 작용 및 세포 증식에 참여하는 막 관통 단백질이다. EMP3의 세부적인 기능과 메커니즘은 알려져 있지 않다.
본 발명에서는 EMP3가 특정 마커를 발현하는 암 줄기세포를 선택적으로 억제하고, 특히 항암 치료 저항성이 높은 암 줄기세포가 포함된 암세포군을 사멸시킴으로써 우수한 항암 효과를 얻을 수 있음을 확인하였다.
예시적인 일 구현예에서, 암 세포들을 암 줄기세포와 일반 암세포로 분류하고, 분류된 암 줄기세포에서 EMP3가 높은 수준으로 발현함을 확인하였다.
예시적인 일 구현예에서, EMP3 억제에 의한 암 줄기세포의 세포외기질에 대한 부착능 변화와의 상관관계를 확인하기 위하여 EMP3를 억제하였을 때 세포외기질에 대한 부착능이 현저히 감소됨을 확인하였다.
예시적인 일 구현예에서, EMP3 억제에 의한 암 줄기세포의 재생능의 변화와의 상관관계를 확인하기 위해 EMP3를 억제하였을 때 암 줄기세포의 형성능이 감소하였으며, 암 줄기세포의 재생능에 관여하는 sox2 및 oct4가 감소됨을 확인하였다.
예시적인 일 구현예에서, EMP3 억제에 의한 세포의 전이 변화, 즉 이동 및 침윤 능력 변화와의 상관관계를 확인하기 위해 EMP3를 억제하였을 때 침윤능 및 이동능이 현저히 감소됨을 확인하였다.
예시적인 일 구현예에서, EMP3 억제에 의한 방사선 치료 저항력과의 상관관계를 확인하기 위해 EMP3를 억제하였을 때 방사선 조사 후 살아남은 세포의 군집이 적게 형성됨을 확인하였다.
본 발명에서 용어 'EMP3 억제제'는 EMP3 발현 또는 활성을 감소시키는 물질을 모두 통칭하는 의미로 사용되며, 구체적으로는 EMP3에 직접적으로 작용하거나 그의 리간드에 간접적으로 작용하는 등의 방식으로, EMP3의 발현을 전사 수준에서 감소시키거나 그 활성을 방해함으로써 EMP3의 발현 수준 또는 그 활성을 감소시키는 모든 제제를 포함할 수 있다.
상기 EMP의 억제제는 EMP3을 표적으로 하여 EMP3의 발현 또는 활성을 억제할 수 있는 화합물, 핵산, 펩타이드, 바이러스 또는 상기 핵산을 포함하는 벡터 등 그 형태에 제한 없이 사용 가능하다. 상기 EMP3 억제제는 이에 제한되지는 않으나, 구체적으로 EMP3 mRNA의 발현을 억제하는 올리고 뉴클레오티드, 또는 EMP3 단백질 또는 EMP3에 대한 리간드 단백질의 활성을 억제하는 항체 또는 그의 항원 결합 단편일 수 있고, 보다 구체적으로 상기 EMP3 mRNA에 작용하는 올리고 뉴클레오티드는 EMP3 mRNA에 특이적인 안티센스 올리고 뉴클레오티드, 앱타머 (aptamer), shRNA 또는 siRNA가 될 수 있다.
본 발명에서 용어, "안티센스 올리고 뉴클레오티드"는 특정 mRNA의 서열에 상보적인 핵산 서열을 함유하고 있는 DNA, RNA 또는 이들의 유도체로서, mRNA 내의 상보적인 서열에 결합하여 mRNA의 단백질로의 번역을 저해하는 작용을 한다. 안티센스 올리고 뉴클레오티드 서열은 상기 EMP3 mRNA에 상보적이고 상기 mRNA에 결합할 수 있는 DNA 또는 RNA 서열을 의미한다. 이는 상기 EMP3 mRNA의 번역, 세포질 내로의 전위 (translocation), 성숙 (maturation) 또는 다른 모든 전체적인 생물학적 기능에 대한 필수적인 활성을 저해할 수 있다. 안티센스 올리고 뉴클레오티드의 길이는 6 내지 100 염기, 바람직하게는 8 내지 60 염기, 보다 바람직하게는 10 내지 40 염기일 수 있다. 상기 안티센스 올리고 뉴클레오티드는 통상의 방법으로 시험관 내에서 합성되어 생체 내로 투여하거나 생체 내에서 안티센스 올리고 뉴클레오티드가 합성되도록 할 수 있다. 시험관 내에서 안티센스 올리고 뉴클레오티드를 합성하는 한 가지 예는 RNA 중합효소 I을 이용하는 것이다. 생체 내에서 안티센스 RNA가 합성되도록 하는 한 가지 예는 다중클로닝부위 (MCS)의 기원이 반대 방향에 있는 벡터를 사용하여 안티센스 RNA가 전사되도록 하는 것이다. 상기 안티센스 RNA는 서열 내에 번역 중지 코돈이 존재하도록 하여 펩타이드 서열로 번역되지 않도록 하는 것이 바람직하다. 본 발명에서 이용될 수 있는 안티센스 올리고 뉴클레오티드의 디자인은 EMP3의 염기서열을 참조하여 당업계에 공지된 방법에 따라 제작할 수 있다.
본 발명에서 용어, "앱타머 (aptamer)"는 단일가닥 올리고 뉴클레오티드로서, 20 내지 60 뉴클레오티드 정도의 크기이며, 소정의 표적 분자에 대한 결합 활성을 갖는 핵산 분자를 말한다. 서열에 따라 다양한 3 차원 구조를 가지며, 항원-항체 반응처럼 특정 물질과 높은 친화력을 가질 수 있다. 앱타머는 소정의 표적 분자에 대하여 결합함으로써, 소정의 표적 분자의 활성을 저해할 수 있다. 본 발명의 앱타머는 RNA, DNA, 변형된 (modified) 핵산 또는 이들의 혼합물일 수 있으며, 또한 직쇄상 또는 환상의 형태일 수 있다. 바람직하게 상기 앱타머는 EMP3에 결합하여 EMP3의 활성을 저해하는 역할을 할 수 있다. 이와 같은 앱타머는 EMP3의 서열로부터 당업자가 공지의 방법에 의해 제조할 수 있다.
본 발명에서 용어, "siRNA" 및 "shRNA"는 RNA 방해 또는 유전자 사일런싱 (silencing)을 매개할 수 있는 핵산 분자로서, 표적 유전자의 발현을 억제할 수 있기 때문에 효율적인 유전자 녹다운 (knockdown) 방법 또는 유전자 치료 방법으로 사용된다. shRNA는 단일 가닥의 올리고 뉴클레오티드 내에서 상보적인 서열간의 결합에 의해 헤어핀 (hairpin) 구조를 형성한 것이고, 생체 내에서 상기 shRNA는 다이서 (dicer)에 의해 절단되면서 21 내지 25 뉴클레오티드 크기의 작은 RNA 조각으로 이중 가닥의 올리고 뉴클레오티드인 siRNA가 되며, 상보적인 서열을 갖는 mRNA에 특이적으로 결합하여 발현을 억제할 수 있다. 따라서 shRNA 및 siRNA 중 어느 수단을 이용할지는 당업자의 선택에 의해 결정될 수 있으며 이들이 표적으로 하는 mRNA 서열이 동일한 경우라면 유사한 발현 감소 효과를 기대할 수 있다. 본 발명의 목적상 EMP3에 특이적으로 작용하여 EMP3 mRNA 분자를 절단하여 RNA 간섭 (RNAi, RNA interference) 현상을 유도함으로써, 상기 EMP3을 억제할 수 있다. siRNA는 화학적으로 또는 효소학적으로 합성될 수 있다. siRNA의 제조방법으로는 특별히 한정되지 않으며, 당업계에 공지된 방법을 사용할 수 있다. 예를 들면, siRNA를 직접 화학적으로 합성하는 방법, 시험관 내 (in vitro) 전사를 이용한 siRNA의 합성법, 시험관 내 (in vitro) 전사에 의해 합성된 긴 이중 가닥 RNA를 효소를 이용하여 절단하는 방법, shRNA 발현 플라스미드나 바이러스성 벡터의 세포 내 전달을 통한 발현법 및 PCR (polymerase chain reaction) 유도 siRNA 발현 카세트 (cassette)의 세포 내 전달을 통한 발현법 등이 있으나 이에 한정되는 것은 아니다.
구체적으로, 본 발명의 EMP3에 대한 siRNA는 서열번호 2의 올리고뉴클레오티드 및 이의 상보적인 서열을 가지는 올리고 뉴클레오티드의 이중 가닥으로 이루어지는 것일 수 있으나, 이에 제한되지 않는다.
또한, 상기 서열번호 2의 올리고뉴클레오티드는 상기 서열번호 2 또는 서열번호 3의 올리고뉴클레오티드와 실질적으로 동일한 염기서열을 포함하는 올리고뉴클레오티드를 포함한다. 상기 실질적으로 동일한 염기서열을 포함하는 올리고뉴클레오티드란 상기 서열번호 2 또는 서열번호 3의 염기서열과 각각 75% 이상, 80% 이상, 80% 이상, 95% 이상의 서열 상동성을 가지는 염기 서열을 포함하는 올리고뉴클레오티드를 의미한다.
| 유전자 | 방향 | siRNA 서열 정보 (5'->3') |
서열번호 |
| EMP3 | 정방향 | CUG CUU UUC GUG GCC ACU U | 2 |
| 역방향 | AAG UGG CCA CGA AAA GCA G | 3 |
본 발명에서 용어, "항체"는 생체의 면역계에서 혈액이나 림프를 순환하면서 외부 물질인 항원이 침입한 경우 이에 반응하는 물질을 말하며, 림프조직에서 형성되는 글로불린계 단백질로 면역글로불린이라고도 불린다. 항체는 B세포가 생산해서 체액으로 흘려 보내는 단백질로 항원과 특이적으로 결합하며, 하나의 항체 분자에는 두 개의 중사슬 (heavy chain)과 두 개의 경사슬 (light chain)이 있으며, 각각의 중사슬과 경사슬은 그의 N-터미널 말단에 가변영역을 갖고 있다. 각각의 가변영역은 3 개의 상보성 결정부위 (Complementarity determining region: CDR)와 4 개의 구조 형성부위 (framework regions: FRs)로 구성되는데, 상보성 결정 부위들은 항체의 항원 결합 특이성을 결정하고, 가변영역의 구조형성 부위들로 유지되는 비교적 짧은 펩티드 서열로 존재한다.
본 발명의 목적상 상기 항체는 EMP3 또는 EMP3의 리간드 단백질과 결합하여 EMP3의 활성을 억제할 수 있는 항체일 수 있다.
본 발명에서 용어 "리간드"는 생분자 (biomolecule)와 복합체를 형성하여 생물학적 반응을 가져오는 물질을 의미하며, "EMP3의 리간드 단백질" 또는 "EMP3에 대한 리간드 단백질"은 EMP3과 결합하여 EMP3을 활성화 시키거나 활성을 증가시키는 단백질일 수 있다.
구체적으로, 본 발명의 EMP3에 대한 항체는 서열번호 4의 아미노산 서열에 결합하는 폴리펩티드 일 수 있으나, 이에 제한되지 않는다.
또한, 상기 서열번호 4의 아미노산 서열에 결합하는 폴리펩티드는 상기 서열번호 4의 아미노산 서열에 결합하는 폴리펩티드와 실질적으로 동일한 아미노산 서열을 갖는 폴리펩티드 및 이의 변이체 또는 이의 활성 단편을 포함한다. 상기 실질적으로 동일한 아미노산 서열을 포함하는 폴리펩티드란 상기 서열번호 4의 아미노산 서열에 결합하는 폴리펩티드와 각각 75% 이상, 80% 이상, 90% 이상, 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함하는 폴리펩티드를 의미한다.
| 단백질 명 | EMP3 Immunogen Sequence | 서열번호 |
| EMP3 | DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKA | 4 |
상술한 바와 같이, 상기 EMP3 억제제들은 암 줄기세포의 자가재생 능력, 침윤 능력 및 이주 능력을 감소시킴으로써 암 줄기세포의 성장을 억제할 수 있다.
또한, 본 발명은 개체(subject)에서 EMP3(Epithelial membrane protein 3) 억제제의 발현 또는 활성을 억제하는 단계를 포함하는 암 줄기세포의 성장 억제 방법을 제공한다.
구체적으로, 상기 암 줄기세포의 성장 억제 방법은 EMP3 억제제를 개체에 투여함으로써 수행될 수 있다.
상기‘개체(subject)'는 인간을 포함하는 것일 수 있다. 또한 용어 '개체(subject)'는 본원의 EMP3 억제제의 투여를 필요로 하는 개체(subject in need thereof)일 수 있으며, 상기 투여를 필요로 하는 개체는 관련 질환에 대해 진단을 받은 개체, 관련 증상이 발현된 개체뿐만 아니라 질환이나 증상의 발현을 예방하거나 건강 개선을 위해 투여를 희망하는 개체를 포함하는 것일 수 있다. 예를 들어, 상기 투여를 필요로 하는 개체는 기존 항암제에 내성이 생긴 개체 등 일 수 있다.
또한, 본 발명은 암 줄기세포의 성장을 억제하는 용도로 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제를 제공한다.
다른 측면에서, 본 발명은 EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 암 줄기세포 특성을 갖는 암의 예방 또는 치료용 조성물을 제공한다.
암 줄기세포의 특성을 갖는 암은 기존의 항암 치료에 대하여 저항성을 보여서 그 예후가 좋지 않기 때문에 기존의 항암 치료와는 다른 치료가 적용되어야 한다. 예컨대, 동일한 암종의 환자라고 하여도, 그 암종이 암 줄기세포의 비율이 높은 경우에 해당된다면, 이 환자는 항암제 투여 또는 방사선 치료와 같은 기존에 알려진 항암 치료로는 암 치료 효과를 얻을 수 없게 된다. 따라서, 동일한 종류의 암이라고 하더라도 암병변 부위의 세포에서 암 줄기세포의 비율이 높은 경우에는, 기존의 항암 치료와 다른 새로운 치료법을 적용하는 것이 매우 중요하다.
본 발명에서 '암 줄기세포 특성을 갖는 암'은 암을 구성하는 세포군에서 암 줄기세포의 비율이 높은 암을 의미한다. 일반적인 암 세포 중의 암 줄기세포의 비율이 약 1%이상 5% 미만 정도인 것을 고려할 때, 예컨대 암을 구성하는 세포군에서 암 줄기세포의 비율이 5% 이상, 10% 이상, 30% 이상, 50% 이상, 70% 이상인 경우를 '암 줄기세포 특성을 갖는 암'이라고 정의할 수 있으며, 상술한 바와 같이 기존의 항암 치료에 대하여 저항성을 나타내어 항암 치료 예후가 좋지 않은 것을 특징으로 할 수 있다.
구체적으로, 본 발명에서 상기 '암 줄기세포 특성을 갖는 암'은 ALDH1을 과발현하는 암 일 수 있다. 상기 ALDH1을 과발현 하는 암은 ALDH1를 발현하거나 그 활성이 양성인 암 줄기세포의 비율이 일반적인 암 보다 상대적으로 높은 암 일 수 있다.
구체적으로, 상기 'ALDH1을 과발현 하는 암'은 폐암, 유방암, 간암, 신장암, 위암, 췌장암 및 뇌암으로 구성된 군으로부터 선택되는 어느 하나 이상인 것일 수 있으나, 이에 제한되지 않는다.
예시적인 일 구현예에서, 본 발명자들은 ALDH1 활성 세포와 ALDH1 비활성 세포를 구별 및 선별하고, ALDH1 활성 세포에서 EMP3 발현량이 증가함을 확인하였다. 또한, 예시적인 일 구현예에서 본 발명자들은 ALDH1 활성 폐암 세포에 EMP3 억제제를 처리하였을 때 폐암 줄기세포의 재생능, 성장능, 침윤능 및 이동능이 감소하는 것으로부터 ALDH1 활성을 갖는 암 줄기세포가 암 성장의 주요 요인임을 확인하였다.
본 발명의 암 줄기세포 특성을 갖는 암의 예방 또는 치료용 조성물에 있어서, EMP, EMP 억제제에 대한 내용은 상술한 바와 같다.
상기 암의 예방 또는 치료는 암 줄기세포의 재생능, 성장능, 침윤능 또는 이동능을 감소시키는 것을 통해 암 치료 도중 또는 암 치료 후의 암 화학 내성, 암 재발, 또는 암 전이를 예방하는 것일 수 있다.
본원의 암 예방 또는 치료용 조성물이 약학적 조성물로 사용될 경우, 상기 약학적 조성물은 EMP3 억제제 이외에, 약학적으로 허용 가능한 담체(carrier) 또는 첨가제를 더 포함할 수 있다.
상기 '약학적으로 허용 가능한'의 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 것이며, 상기 '담체'는 세포 또는 조직 내로의 화합물의 부가를 용이하게 하는 화합물로 정의된다.
본 발명의 상기 약학적 조성물은 단독으로 또는 어떤 편리한 담체 등과 함께 혼합하여 투여될 수 있고, 그러한 투여 제형은 단회 투여 또는 반복 투여 제형일 수 있다. 상기 약학 조성물은 고형 제제 또는 액상 제제일 수 있다. 고형 제제는 산제, 과립제, 정제, 캅셀제, 좌제 등이 있으나, 이에 한정되는 것은 아니다. 고형 제제에는 담체, 착향제, 결합제, 방부제, 붕해제, 활택제, 충진제 등이 포함될 수 있으나 이에 제한되는 것은 아니다. 액상 제제로는 물, 프로필렌 글리콜 용액 같은 용액제, 현탁액제, 유제 등이 있으나, 이에 한정되는 것은 아니며, 적당한 착색제, 착향제, 안정화제, 점성화제 등을 첨가하여 제조할 수 있다. 예를 들어, 산제는 본 발명의 유효 성분인 다중불포화지방산의 트리-하이드록시 유도체와 유당, 전분, 미결정셀룰로오스 등 약제학적으로 허용 가능한 적당한 담체를 단순 혼합함으로써 제조될 수 있다. 과립제는 본 발명의 상기 다중불포화지방산의 트리-하이드록시 유도체, 약학적으로 허용 가능한 적당한 담체 및 폴리비닐피롤리돈, 히드록시프로필셀룰로오스 등의 약학적으로 허용가능한 적당한 결합제를 혼합한 후, 물, 에탄올, 이소프로판올 등의 용매를 이용한 습식 과립법 또는 압축력을 이용한 건식 과립법을 이용하여 제조될 수 있다. 또한 정제는 상기 과립제를 마그네슘스테아레이트 등의 약학적으로 허용 가능한 적당한 활택제와 혼합한 후, 타정기를 이용하여 타정함으로써 제조될 수 있다.
상기 약학적 조성물은 치료해야 할 질환 및 개체의 상태에 따라 경구제, 주사제(예를 들어, 근육주사, 복강주사, 정맥주사, 주입(infusion), 피하주사, 임플란트), 흡입제, 비강투여제, 질제, 직장투여제, 설하제, 트랜스더말제, 토피칼제 등으로 투여될 수 있으나, 이에 제한되는 것은 아니다. 투여 경로에 따라 통상적으로 사용되고 비독성인, 약학적으로 허용 가능한 운반체, 첨가제, 비히클을 포함하는 적당한 투여 유닛 제형으로 제제화될 수 있다.
상기 약학 조성물은 매일 약 0.0001 mg/kg 내지 약 10 g/kg이 투여될 수 있으며, 약 0.001 mg/kg 내지 약 1 g/kg의 1일 투여 용량으로 투여될 수 있다. 그러나 상기 투여량은 상기 혼합물의 정제 정도, 환자의 상태(연령, 성별, 체중 등), 치료하고 있는 상태의 심각성 등에 따라 다양할 수 있다. 필요에 따라 편리성을 위하여 1일 총 투여량을 하루 동안 여러 번 나누어 투여될 수 있다.
또한, 본 발명은 암 줄기세포 특성을 갖는 암의 예방 또는 치료 방법을 제공한다.
상기 암의 예방 또는 치료 방법은 개체에서 EMP3(Epithelial membrane protein 3)의 발현이나 활성을 억제하는 단계를 포함할 수 있고, 일 예로 이는 상술한 EMP3 억제제를 개체에 투여함으로써 수행될 수 있다.
상기 '암 줄기세포 특성을 갖는 암'은 ALDH1를 발현하거나 그 활성이 양성인 세포의 비중이 암을 구성하는 전체 세포군에서 높은, 예컨대 암을 구성하는 전체 세포군에서 상기 ALDH1를 발현하거나 그 활성이 양성인 세포의 비중이 5% 이상, 10% 이상, 30% 이상, 50% 이상, 또는 70% 이상인 것일 수 있다.
상기 암은 폐암, 유방암, 간암, 신장암, 위암, 췌장암 및 뇌암으로 구성된 군으로부터 선택되는 어느 하나일 수 있으나, 이에 제한되지 않는다.
또한, 본 발명은 암 줄기세포 특성을 갖는 암의 예방 또는 치료에 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제를 제공한다.
또 다른 측면에서, 본 발명은 EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 방사선 항암 치료 보조용 조성물을 제공한다.
본 발명의 상기 조성물은 EMP3 억제제를 암 관련 세포의 방사선 민감성 향상을 위한 유효성분으로 포함한다. EMP3 및 EMP3 억제제에 대한 내용은 상술한 바와 같다.
본 발명의 상기 암 관련 세포는 암을 구성하고 있는 세포로, 정상 세포에 비해 모양이 일정하지 않고, 무한정 증식을 하며, 주변 세포와의 결속력이 약한 특징을 가진 것일 수 있다. 구체적으로, 상기 암 관련 세포는 암 세포 또는 암 줄기세포일 수 있고, 구체적으로 암 줄기세포 일 수 있다.
상기 암 줄기세포는 다양한 암 세포로 분화할 수 있는 능력을 가진 미분화 세포일 수 있고, 구체적으로 ALDH1을 발현하거나 활성이 양성인 암 세포일 수 있다. 본 발명에서 상기 암 줄기세포는 방사선 조사에 의해서도 세포 증식이 억제되지 않고, 자가재생능력이 저하되지 않으며 이동 및 침윤 능력이 억제되지 않는 특징을 가진 것일 수 있다.
또한 상기 암 관련 세포는 방사선에 대한 민감성이 낮은 것, 즉 방사선 치료에 대한 저항성이 높은 것일 수 있고, 실질적으로 방사선에 대한 민감성이 없어서 방사선 조사에 의한 항암 치료가 불가능한 것일 수 있다.
상기 항암은 방사선 조사, 외과적 수술 및 화학 요법 등을 통해 암 관련 세포의 증식 억제, 전이 및 침윤 억제, 세포의 사멸을 유도하는 것일 수 있다. 본 발명에서 상기 항암은 방사선 조사와 함께 병용하여 상기 EMP3 억제제를 투여하는 것일 수 있다. 이와 같이 EMP3 억제제를 방사선 조사와 함께 병용하여 투여하는 경우, 상기 EMP3 억제제에 의해 암 관련 세포의 방사선 민감성이 향상되어, 방사선 조사에 의한 항암 치료 효과를 극대화시킬 수 있고, 나아가 암의 재발 및 전이를 막을 수 있다.
또한, 개체에서 EMP3(Epithelial membrane protein 3)의 발현 또는 활성을 억제하는 단계를 포함하는 암세포의 방사선에 대한 민감도 증진 방법을 제공한다.
상기 암세포는 암 줄기세포를 포함하는 암 세포일 수 있고, 예를 들어 암을 구성하는 세포군에서 암 줄기세포의 비율이 5% 이상, 10% 이상, 30% 이상, 50% 이상, 70% 이상인 것일 수 있다.
또한, 본 발명은 암세포의 방사선에 대한 민감도를 증진하는 용도로 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제를 제공한다.
이하, 본 발명을 실시예 및 실험예에 의하여 상세히 설명한다.
단, 하기 실시예 및 실험예는 본 발명을 구체적으로 예시하는 것이며, 본 발명의 내용이 하기 실시예 및 실험예에 의해 한정되지 아니한다.
[제조예 1]
세포 배양 및 암줄기세포의 제작
ATCC(american type culture collection)로부터 입수한 인간폐암세포주 A549를 10% 우태아 혈청 및 스트렙토 마이신(100g/ml)이 포함된 RPMI 배지로, 37℃, 가습된 5% CO2 조건에서 배양하였다. 그리고 상기와 같이 배양된 A549 세포주를 bFGF(20ng/ml), bEGF(20ng/ml) 및 B27 줄기세포 서플리먼트(stem cell supplement)(1X)를 포함하는 DMEM/F12 배지에서 다시 배양하여, A549를 암 줄기세포화시켰다.
[실시예 1]
ALDH1 과발현 암 줄기세포의 분리 및 EMP3 과발현 확인
제조예 1에서 배양한 A549 세포를 폐암 줄기세포의 마커 단백질인 ALDH1 활성을 통해 ALDH1 양성 세포(A549-ALDH1+)와 ALDH1 음성 세포(A549-ALDH1-)로 분류하였다.
다음으로, 마이크로어레이를 이용한 유전자 분석을 수행하여 ALDH1 양성 세포와 ALDH1 음성 세포의 유전자 차이를 비교 분석하였다(도 1).
그 결과 ALDH1 양성 세포에서의 EMP3 유전자의 발현량이 ALDH1 비음성 세포에 비하여 약 15배가량 증폭되어 있음을 확인하였다.
이는 EMP3 유전자와 ALDH1 양성 폐암 줄기세포가 관련성이 있음을 의미한다. 이를 확인하고자 아래의 실험들을 진행하였다.
[실시예 2]
암 줄기세포의 구형 형성(sphere formation) 능력의 억제 효과 확인
<2-1> EMP3 항체 처리에 의한 암 줄기세포의 구형 형성 능력 억제 효과 확인
상기 실시예 1에서 분리한 A549-ALDH1+ 세포를 25 T-Flask에 5×105 개씩 분주하고 충분히 배양하였다. 상기와 같이 배양된 A549-ALDH1+ 세포에 암 줄기세포 배양 배지(bFGF(20ng/ml), bEGF(20ng/ml) 및 B27 줄기세포 서플리먼트(stem cell supplement)(1X)를 포함하는 DMEM/F12)로 교체하고, 0.15 μg/mL의 EMP3 항체 및 IgG를 각각 처리 후, 9일 동안 배양하여 그 결과를 확인하였다. EMP3에 대한 항체는 ab236671(Abcam, USA)를 구매하여 사용하였다.
상기와 같이 암 줄기세포화된 세포들을 대상으로 현미경을 이용하여 구형 형성의 개수 및 크기를 확인하였다.
그 결과, 도 2에 도시된 바와 같이, EMP3 항체를 처리한 경우, EMP3 항체를 처리하지 않은 경우에 비해 구형 형성의 개수 및 크기가 현저하게 감소하는 것을 확인하였다.
상기와 같은 결과로부터, 암 줄기세포의 세포막에 존재하는 EMP3의 억제를 통해 암 줄기세포의 구형 형성 능력을 효과적으로 억제할 수 있음을 알 수 있다.
<2-2> siRNA 처리에 의한 암 줄기세포의 구형 형성 능력 억제 효과 확인
EMP3를 타겟으로 하는 siRNA를 사용하여 직접적인 유전자 억제를 이용한 실험을 진행하고자 하였다. 이에, EMP 항체 대신 siRNA를 A549-ALDH1+세포에 처리한 것을 제외하고는 실시예 <2-1>과 동일한 방법으로 암 줄기세포의 구형 형성의 개수 및 크기를 확인하였다. siRNA는 EMP3 유전자에 대한 정방향 프라이머 5'-CUG CUU UUC GUG GCC ACU U-3'과 역방향 프라이머 5'-AAG UGG CCA CGA AAA GCA U-3'의 각각 19머(mer)인 si-RNA를 BIONEER사에 제작 주문한 것을 사용하였다.
또한, si-RNA를 처리 하였을 때 A549-ALDH1+세포에서 EMP3 및 암 줄기세포의 재생능력에 관여하는 전사인자의 발현 변화를 PCR을 이용하여 확인하였다.
그 결과, 도 3A에 도시된 바와 같이, si-EMP3를 처리한 군에서 대조군 대비 구형 형성의 개수 및 크기가 현저하게 감소하는 것을 확인하였다.
또한, 도 3B에 나타난 바와 같이, 암 줄기세포의 표적단백질의 발현이 감소되는 것을 확인하였다. 또한 암줄기세포의 재생능력에 관여하는 전사인자인 sox2와 oct4가 감소되어 있음을 확인하였다.
이 결과들을 종합하였을 때, EMP3는 암 줄기세포의 형성에 관여하고, 암 줄기세포의 재생 능력에 관여하는 전사 인자를 조절함으로써 암 줄기세포의 형성을 억제할 수 있음을 알 수 있다.
[실시예 3]
암 줄기세포의 자가재생(self-renewal) 능력 억제 효과 확인
A549-ALDH1+ 세포를 96 웰 플레이트에 1개씩 분주하고, 충분히 배양하였다. 상기와 같이 배양된 A549-ALDH1+ 세포에 0.15 μg/mL의 EMP3 항체 및 IgG를 각각 처리하고 2주 동안 배양하였다.
EMP3 항체가 처리되거나 처리되지 않은 A549-ALDH1+ 암 줄기세포를 대상으로 현미경을 이용하여 플레이트 내에 존재하는 세포의 개수를 측정하였다.
그 결과, 도 4에 도시된 바와 같이, EMP3 항체를 처리한 경우에, 암 줄기세포의 개수가 현저하게 감소되는 것을 확인하였다.
상기와 같은 결과로부터, EMP3 억제를 통해 암 줄기세포가 가지는 고유의 성질인 자가재생 능력을 매우 효과적으로 억제할 수 있음을 알 수 있다.
[실시예 4]
암 줄기세포의 침윤(invasion) 및 이동(migration) 능력 억제 효과 확인
<4-1> EMP3 항체 처리에 의한 침윤 및 이동 능력 억제 효과 확인
A549-ALDH1+ 암줄기세포를 트립신을 이용하여 분리하고, 5×104개의 세포를 200㎕ 영양 배지에 각각 현탁 후, 0.15 μg/mL의 EMP3 항체 및 IgG 함께 8㎛ 포어 크기를 가지는 트랜스웰 상부 챔버(Transwell upper chamber)에 넣고, 하부(lower)챔버에는 10% 우태아혈청이 포함된 RPMI1640 배지 800㎕를 넣어 두 챔버를 결합시켰다. 이후, 상기 암 줄기세포를 37 ℃ 배양기에 5% CO2 조건에서 48시간 동안 배양시켰다. 그런 다음, 상부 챔버의 멤브레인을 면봉을 이용하여 닦고, 크리스탈 바이올렛 용액으로 염색하여 현미경으로 관찰한 뒤, 암 줄기세포의 수를 측정하여 이동 능력을 확인하였다.
또한, 10mg/ml의 성장인자가 감소된 마트리겔(BD Biosciences, 미국)이 코팅 된 트렌스웰 상부 챔버를 이용하는 것을 제외한 나머지는 모두 상기 이동 능력을 확인하는 과정과 동일한 과정으로 침윤 분석을 수행하였다.
그 결과, 도 5 및 도 6에 도시된 바와 같이, EMP3 항체를 처리한 경우 EMP3 항체를 처리하지 않은 경우에 비해, 이동 및 침윤이 일어난 암 줄기세포의 수가 현저하게 감소되는 것을 확인하였다.
<4-2> siRNA 처리에 의한 침윤 및 이동 능력 억제 효과 확인
EMP3 항체 대신 si-EMP3를 사용한 것 이외에 실시예 4-1과 동일한 방법으로 EMP3 억제제 처리에 의한 암 줄기세포의 침윤 및 이동 능력 억제 효과를 확인하였다.
그 결과, 도 7 및 도 8에 도시된 바와 같이 si-EMP3를 처리하였을 때 암 줄기세포의 특징인 세포의 이동 능력과 침윤 능력이 현저하게 감소되는 것을 확인하였다.
상기와 같은 결과로부터, EMP3에 의해 암 줄기세포의 운동능력이 조절되고 있으며, EMP3를 억제함으로써 암 줄기세포의 이동 및 침윤 능력을 매우 효과적으로 억제할 수 있음을 알 수 있다.
[실시예 5]
암 줄기세포의 방사선에 대한 저항력 억제 효과 확인
<5-1> EMP3 항체 처리에 의한 암 줄기세포의 방사선에 대한 저항력 억제 효과 확인
A549-ALDH1+ 암 줄기세포를 35 mm 디쉬에 5×102 개씩 도포하고 1일 후 0.15 μg/mL의 EMP3 항체 및 IgG를 각각 처리한 뒤 10Gy의 선량으로 방사선을 조사 하였다. 방사선을 조사한 처리군을 실험군으로 정하고, 방사선을 조사하지 않은 군을 대조군으로 정하여, 실험군과 대조군 세포들을 대상으로, 0.5%의 크리스탈 바이올렛(crystal Violet) 시약으로 10분 동안 염색하고, PBS로 수 차례 세척한 뒤, 콜로니의 수를 측정하여 집락 형성 정도를 분석하였다.
그 결과, 도 9에 도시된 바와 같이 EMP3 항체 처리 없이 방사선을 조사한 후 살아남은 세포의 군집보다 EMP3 항체를 처리한 후 방사선을 조사한 군에서 살아남은 세포의 군집이 적게 형성되는 것을 확인하였다.
<5-2> siRNA 처리에 의한 암 줄기세포의 방사선에 대한 저항력 억제 효과 확인
EMP3 항체 대신 si-EMP3를 사용한 것 이외에 실시예 5-1과 동일한 방법으로 EMP3 억제제 처리에 의한 암 줄기세포의 방사선에 대한 저항력 억제 효과를 확인하였다.
그 결과, 도 10에 도시된 바와 같이 si-EMP3를 이용하여 EMP3를 억제하였을 때, 방사선 조사 이후 형성된 군집이 거의 보이지 않을 정도로 사라졌음을 확인하였다.
상기와 같은 결과로부터, EMP3가 암 줄기세포를 포함하는 암 세포의 방사선 저항능력을 조절할 수 있으며, EMP3가 방사선 치료에 사용되는 방사선 민감제 등의 표적이 될 수 있음을 알 수 있다.
[실시예 6]
EMP3 유전자 발현에 따른 생존 분석
EMP3가 암줄기세포 형성에 중요한 인자임을 확인하기 위하여 데이터분석 프로그램 (Scientific Reports, 2018;8:9227)을 이용하여 EMP3가 암 환자에게 미치는 영향에 관하여 확인하였다.
그 결과, 도 11에 도시된 바와 같이 EMP의 발현이 높은 폐암 환자군에서 생존율이 급격히 낮아져 있음을 확인하였다. 이로부터 EMP3가 발현되면 암 치료가 어려워 질 수 있음을 알 수 있다.
이상에서 본 발명은 기재된 실시예에 대해서만 상세히 설명되었지만 본 발명의 기술사상 범위 내에서 다양한 변형 및 수정이 가능함은 당업자에게 있어서 명백한 것이며, 이러한 변형 및 수정이 첨부된 청구범위에 속함은 당연한 것이다.
Claims (24)
- EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 암 줄기세포 성장 억제용 조성물.
- 청구항 1에 있어서,상기 EMP3 억제제는 EMP3 유전자의 발현을 억제하는 올리고 뉴클레오티드; 또는EMP3 단백질 또는 EMP3에 대한 리간드 단백질의 활성을 억제하는 항체, 또는 그의 항원 결합 단편;인 것인, 암 줄기세포 성장 억제용 조성물.
- 청구항 2에 있어서,상기 EMP3 유전자의 발현을 억제하는 올리고 뉴클레오티드는 EMP3 mRNA에 특이적인 안티센스 올리고뉴클레오티드, 앱타머, shRNA 또는 siRNA인 것인, 암 줄기세포 성장 억제용 조성물.
- 청구항 1에 있어서,상기 암 줄기세포는 암 줄기세포 마커인 ALDH1(aldehyde dehydrogenase 1) 단백질이 과발현되거나 단백질 활성이 양성인 암세포인, 암 줄기세포 성장 억제용 조성물.
- 청구항 1에 있어서,암 줄기세포의 자가재생 능력, 침윤 능력, 이동 능력 억제 활성을 갖는 것인, 암 줄기세포 성장 억제용 조성물.
- 청구항 1에 있어서,상기 EMP3는 서열번호 1로 기재되는 아미노산 서열을 갖는 것인, 암 줄기세포 성장 억제용 조성물.
- 청구항 2 있어서,상기 항체는 서열번호 4로 기재되는 아미노산 서열에 결합하는 폴리펩티드인, 암 줄기세포 성장 억제용 조성물.
- 청구항 3에 있어서,상기 siRNA는 서열번호 2 또는 서열번호 3으로 기재되는 올리고뉴클레오티드인, 암 줄기세포 성장 억제용 조성물.
- 청구항 1 내지 청구항 8 중 어느 한 항에 있어서,상기 암은 폐암, 유방암, 간암, 신장암, 위암, 췌장암 및 뇌암으로 구성된 군으로부터 선택되는 어느 하나 이상인 것인, 암 줄기세포 성장 억제용 조성물.
- EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 ALDH1 과발현 암 줄기세포 특성을 갖는 암 예방 또는 치료용 조성물.
- 청구항 10에 있어서,상기 암 줄기세포 특성의 암은, 암을 구성하는 세포군에서 암 줄기세포의 비율이 10% 이상인, 암의 예방 또는 치료용 조성물.
- 청구항 11에 있어서,상기 EMP3 억제제는 EMP3 유전자의 발현을 억제하는 올리고 뉴클레오티드; 또는EMP3 단백질 또는 EMP3에 대한 리간드 단백질의 활성을 억제하는 항체, 또는 그의 항원 결합 단편;인 것인, 암의 예방 또는 치료용 약학적 조성물.
- 청구항 10에 있어서,상기 EMP3 유전자의 발현을 억제하는 올리고 뉴클레오티드는 EMP3 mRNA에 특이적인 안티센스 올리고뉴클레오티드, 앱타머, shRNA 또는 siRNA인 것인, 암의 예방 또는 치료용 약학적 조성물.
- 청구항 10에 있어서,상기 암의 예방 또는 치료는 암 치료 도중 또는 암 치료 후의 암 화학내성, 암 재발, 또는 암 전이를 예방하는 것인, 암의 예방 또는 치료용 약학적 조성물.
- 청구항 10 내지 청구항14 중 어느 한 항에 있어서,상기 암은 폐암, 유방암, 간암, 신장암, 위암, 췌장암 및 뇌암으로 구성된 군으로부터 선택되는 어느 하나 이상인 것인, 암의 예방 또는 치료용 약학적 조성물.
- EMP3(Epithelial membrane protein 3) 억제제를 유효성분으로 포함하는 방사선 항암 치료 보조용 조성물.
- 청구항 16에 있어서,상기 EMP3 억제제는 암 줄기세포를 포함하는 암세포들의 방사선에 대한 민감도를 증진시키는 것인, 방사선 항암 치료 보조용 조성물.
- 청구항 16 또는 청구항 17에 있어서,상기 암은 폐암, 유방암, 간암, 신장암, 위암, 췌장암 및 뇌암으로 구성된 군으로부터 선택되는 어느 하나 이상인 것인, 방사선 항암 치료 보조용 조성물.
- 개체에서 EMP3(Epithelial membrane protein 3)의 발현 또는 활성을 억제하는 단계;를 포함하는 암 줄기세포의 성장 억제 방법.
- 개체에서 EMP3(Epithelial membrane protein 3)의 발현 또는 활성을 억제하는 단계;를 포함하는 암 줄기세포 특성을 갖는 암의 예방 또는 치료방법.
- 개체에서 EMP3(Epithelial membrane protein 3)의 발현 또는 활성을 억제하는 단계;를 포함하는 암세포의 방사선에 대한 민감도 증진 방법.
- 암 줄기세포의 성장을 억제하는 용도로 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제.
- ALDH1 과발현 암 줄기세포 특성을 갖는 암의 예방 또는 치료에 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제.
- 암세포의 방사선에 대한 민감도를 증진하는 용도로 사용하기 위한 EMP3(Epithelial membrane protein 3) 억제제.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/768,906 US20240102019A1 (en) | 2019-10-14 | 2020-10-14 | Composition comprising emp3 inhibitor for inhibiting growth of cancer stemcell and use thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020190127054A KR102249757B1 (ko) | 2019-10-14 | 2019-10-14 | Emp3 억제제를 포함하는 암 줄기세포 성장 억제용 조성물 및 그 용도 |
| KR10-2019-0127054 | 2019-10-14 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021075853A1 true WO2021075853A1 (ko) | 2021-04-22 |
Family
ID=75538745
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2020/014018 WO2021075853A1 (ko) | 2019-10-14 | 2020-10-14 | Emp3 억제제를 포함하는 암 줄기세포 성장 억제용 조성물 및 그 용도 |
Country Status (3)
| Country | Link |
|---|---|
| US (1) | US20240102019A1 (ko) |
| KR (1) | KR102249757B1 (ko) |
| WO (1) | WO2021075853A1 (ko) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11999956B2 (en) * | 2022-09-07 | 2024-06-04 | National Cheng Kung University | Targeted therapy composition and its use for suppressing breast cancer cell proliferation, migration or invasion |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20160026624A (ko) * | 2014-08-28 | 2016-03-09 | 경북대학교 산학협력단 | 유방암 줄기세포 표적 치료방법 |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20180011707A (ko) * | 2016-07-25 | 2018-02-02 | 연세대학교 산학협력단 | 내성암, 재발암 또는 전이암의 예방 또는 치료용 약학 조성물 |
-
2019
- 2019-10-14 KR KR1020190127054A patent/KR102249757B1/ko active IP Right Grant
-
2020
- 2020-10-14 WO PCT/KR2020/014018 patent/WO2021075853A1/ko active Application Filing
- 2020-10-14 US US17/768,906 patent/US20240102019A1/en active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20160026624A (ko) * | 2014-08-28 | 2016-03-09 | 경북대학교 산학협력단 | 유방암 줄기세포 표적 치료방법 |
Non-Patent Citations (4)
| Title |
|---|
| AKBAR, M. W.: "Characterization of chemosensitivity profiles of breast cancer cell lines, with and without stem cell like features.", MASTER'S THESIS, BILKENT UNIVERSITY, 1 August 2014 (2014-08-01), pages 1 - 123, XP055801060, [retrieved on 20210504] * |
| HONG XIAO CHUN, FEN YUAN JIAN, YAN GUO CHUN, HONG HONG, YAN CAO HONG, BING LI WEI, ZHONG YU HAI: "Epithelial membrane protein 3 functions as an oncogene and is regulated by microRNA-765 in primary breast carcinoma", MOLECULAR MEDICINE REPORTS, SPANDIDOS PUBLICATIONS, GR, vol. 12, no. 5, 1 November 2015 (2015-11-01), GR, pages 6445 - 6450, XP055801062, ISSN: 1791-2997, DOI: 10.3892/mmr.2015.4326 * |
| KRAUSE MECHTHILD; DUBROVSKA ANNA; LINGE ANNETT; BAUMANN MICHAEL: "Cancer stem cells: Radioresistance, prediction of radiotherapy outcome and specific targets for combined treatments", ADVANCED DRUG DELIVERY REVIEWS, ELSEVIER, AMSTERDAM , NL, vol. 109, 12 February 2016 (2016-02-12), Amsterdam , NL, pages 63 - 73, XP029914271, ISSN: 0169-409X, DOI: 10.1016/j.addr.2016.02.002 * |
| TOMOHIKO SAKABE, JUNYA AZUMI , YOSHIHISA UMEKITA, KAN TORIGUCHI , ETSURO HATANO, YASUAKI HIROOKA, GOSHI SHIOTA: "Expression of Cancer Stem Cell-associated DKK1 mRNA Serves as Prognostic Marker for Hepatocellular Carcinoma", ANTICANCER RESEARCH, INTERNATIONAL INSTITUTE OF ANTICANCER RESEARCH, GR, vol. 37, no. 9, 6 September 2017 (2017-09-06), GR, pages 4881 - 4888, XP055801064, ISSN: 0250-7005, DOI: 10.21873/anticanres.11897 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11999956B2 (en) * | 2022-09-07 | 2024-06-04 | National Cheng Kung University | Targeted therapy composition and its use for suppressing breast cancer cell proliferation, migration or invasion |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240102019A1 (en) | 2024-03-28 |
| KR102249757B1 (ko) | 2021-05-10 |
| KR20210044013A (ko) | 2021-04-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Liu et al. | Cancer-associated fibroblasts promote hepatocellular carcinoma metastasis through chemokine-activated hedgehog and TGF-β pathways | |
| EP3500307B1 (en) | Use of vcp inhibitor and oncolytic virus in the preparation of an anti-tumor drug | |
| CN107083433B (zh) | lncRNA在肝癌诊疗中的应用 | |
| WO2012064146A9 (ko) | Ｇｋｎ １을 함유하는 항암용 조성물 | |
| Ding et al. | Toll-like Receptor 9 pathway mediates Schlafen+-MDSC polarization during Helicobacter-induced gastric metaplasias | |
| CN111073979A (zh) | 阻断ccl28趋化通路的胃癌治疗方法 | |
| CN106929577B (zh) | 一种与肺腺癌相关的lncRNA生物标志物 | |
| Geng et al. | CD137 signaling induces macrophage M2 polarization in atherosclerosis through STAT6/PPARδ pathway | |
| WO2021137506A1 (ko) | Wdr34 억제제를 포함하는 암줄기세포 성장 억제용 조성물 및 그 용도 | |
| WO2021075853A1 (ko) | Emp3 억제제를 포함하는 암 줄기세포 성장 억제용 조성물 및 그 용도 | |
| KR101775356B1 (ko) | Parp 및 탄키라제 동시 저해제에 대한 감수성 결정 방법 | |
| WO2013165061A1 (ko) | Ｓｃｆ 또는 이의 수용체를 억제하는 물질을 포함하는 혈관 투과성 관련 질환의 치료 또는 예방용 조성물 | |
| WO2017043779A1 (ko) | 유방암 관련 stk32c 유전자 및 이의 용도 | |
| KR101547297B1 (ko) | 면역내성암의 재발 및 암전이 예방 또는 치료용 조성물 | |
| WO2018105921A2 (ko) | 지방간의 진단 또는 치료를 위한 류신 지퍼 단백질의 용도 | |
| CN106729756B (zh) | 生物标志物作为靶标在肺腺癌诊治中的应用 | |
| WO2011087343A2 (ko) | Ｈｐｖ 감염과 관련된 암의 치료용 조성물 | |
| CN113512587B (zh) | 癌细胞耐药性的标志物、逆转癌细胞耐药性的制剂组合及其应用 | |
| WO2023075122A1 (ko) | 대장암의 치료 및 전이 억제용 약학적 조성물 및 이의 용도 | |
| WO2023075123A1 (ko) | miRNA를 포함하는 대장암의 치료 및 전이 억제용 약학적 조성물 및 이의 용도 | |
| WO2021201657A1 (ko) | Epha10 억제제를 포함하는 암 진단, 예방 또는 치료용 조성물 및 이의 용도 | |
| WO2019054744A1 (ko) | 종양 억제 유전자 ｐｉｐ４ｋ２ａ 및 그의 용도 | |
| WO2023059040A1 (ko) | Cdk 억제제 및 id2 활성화제를 포함하는 방광암의 예방 또는 치료용 약학 조성물 | |
| WO2024096354A1 (ko) | Ifitm3 억제제를 포함하는 신장암 예방 또는 치료용 약학적 조성물 | |
| WO2023068820A1 (ko) | 암 치료 또는 예방용 조성물 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20876790 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 17768906 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 20876790 Country of ref document: EP Kind code of ref document: A1 |