WO2021040336A1 - 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 - Google Patents

사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 Download PDF

Info

Publication number
WO2021040336A1
WO2021040336A1 PCT/KR2020/011193 KR2020011193W WO2021040336A1 WO 2021040336 A1 WO2021040336 A1 WO 2021040336A1 KR 2020011193 W KR2020011193 W KR 2020011193W WO 2021040336 A1 WO2021040336 A1 WO 2021040336A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
polypeptide
cancer
substituted
present
Prior art date
Application number
PCT/KR2020/011193
Other languages
English (en)
French (fr)
Inventor
김학성
손수민
서효덕
박진호
Original Assignee
한국과학기술원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한국과학기술원 filed Critical 한국과학기술원
Priority to US17/637,377 priority Critical patent/US20220315662A1/en
Publication of WO2021040336A1 publication Critical patent/WO2021040336A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2318/00—Antibody mimetics or scaffolds
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2318/00—Antibody mimetics or scaffolds
    • C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide

Definitions

  • the present invention relates to a novel polypeptide that selectively binds to human programmed cell death protein 1 (PD-1), and more specifically, the present invention binds to human programmed cell death protein 1
  • a polypeptide capable of functioning as an immuno-anticancer agent a polynucleotide encoding the polypeptide, a recombinant vector containing the polynucleotide, a recombinant microorganism into which the recombinant vector has been introduced, a method for producing the polypeptide using the recombinant microorganism, and the polypeptide It relates to a therapeutic pharmaceutical composition comprising.
  • first-generation chemotherapy and second-generation targeted anticancer drugs there is a problem that they can be administered only to patients with a high risk of drug resistance and side effects due to the toxicity of the anticancer drug.
  • An immune anticancer agent called a third-generation anticancer drug that overcomes this problem, acts on the signaling pathway of immune cells, activates immune cells, and attacks cancer cells to produce a therapeutic effect.
  • it is a method of treating cancer cells by activating the body's immune system. It can be applied to various types of cancer treatment, and side effects are also reported to be lower than those of existing anticancer drugs.
  • Programmed apoptosis protein 1 is an immune checkpoint receptor and can be an excellent target protein for immune anticancer drugs in the treatment of various cancers such as malignant melanoma, non-small cell lung cancer, and kidney cell cancer.
  • Programmed cell death protein 1 (PD-1) is a receptor present on the surface of T cells and belongs to the superfamily of immunoglobulins. PD-1 is involved when programmed apoptosis protein 1 is combined with programmed death ligand 1 (PD-L1) or programmed death ligand 2 (PD-L2), which is a ligand.
  • T cell proliferation, interferon gamma and interleukin 2 production, and signal transduction of T cell receptors are inhibited by activating T cell activation. It is known that various types of cancer cells express PD-1, which causes T cells to lose their function and acts as a mechanism by which cancer cells avoid attack of the immune system.
  • Drugs targeting PD-1 include monoclonal antibodies, Nivolumab and Pembrolizumab, and are used as treatments for malignant melanoma and non-small cell lung cancer. It is reported that accurate verification of the efficacy of the treatment and treatment is required. Therefore, there is an urgent need to develop a new concept of PD-1 target therapy that overcomes the limitations of existing drugs.
  • Repebody that can specifically bind to various proteins (Korean Patent Nos. 10-1356075, 10-1654890, 10--1587622, and 10-1624702. , 10-1624703, 10-1713944, 10-1751501, 10-1818152 and 10-1875809).
  • the lipid body refers to a polypeptide that is fused based on the similarity of the structure of the VLR with the N-terminus of internalin B having a structure of LRR (Leucin-rich repeat) and optimized by consensus design.
  • Lippibody has a size of 1/5 of the antibody and can be mass-produced in E. coli, thereby lowering the production cost, and has a great advantage for industrial use due to its excellent thermal and pH stability.
  • it has been proven that the binding power to the target substance can be increased very easily and the specificity to the target substance is very excellent.
  • a novel polypeptide having a specific binding power to PD-1 was prepared and selected based on a random mutant library constructed through overall structural analysis, and the lipid body selectively binds to PD-1 and is a ligand, PD- By inhibiting the interaction with L1 it was confirmed that the effect of activating immune cells and inhibiting the proliferation of cancer cells was confirmed, and the present invention was completed.
  • An object of the present invention is a repebody that specifically binds to human PD-1; A polynucleotide encoding the lipid body; A recombinant vector containing the polynucleotide; A recombinant microorganism into which the recombinant vector has been introduced; And it is to provide a method of producing the lipid body using the recombinant microorganism.
  • Another object of the present invention is to provide a method for preventing or treating cancer, comprising administering a composition for preventing or treating cancer containing the polypeptide and a composition for preventing or treating cancer containing the polypeptide.
  • the present invention is the N-terminus of the LRR (Leucine rich repeat) family protein having an alpha helical capping motif and the modified repeat module of the VLR (Variable Lymphocyte Receptor) protein, and the C of the VLR protein.
  • LRR Leucine rich repeat
  • VLR Veariable Lymphocyte Receptor
  • PD-1 programmed cell death protein 1
  • i) 91 isoleucine is substituted with asparagine in the amino acid sequence represented by SEQ ID NO: 2 ; ii) threonine at position 93 is substituted with tryptophan; iii) Glycine 94 is substituted with glutamic acid; iv) valine 115 is substituted for threonine; v) valine 117 is substituted with phenylalanine; vi) glutamic acid at position 118 is substituted with leucine; vii) Alanine 141 is substituted with lysine; And viii) provides a polypeptide that selectively binds to programmed apoptosis protein 1, characterized in that it contains one or more amino acid mutations selected from the group consisting of substitution of histidine 142 with phenylalanine.
  • the present invention also provides a polynucleotide encoding the polypeptide and a recombinant vector comprising the polynucleotide.
  • the present invention also provides a recombinant microorganism containing the recombinant vector.
  • the present invention also provides a method for producing a polypeptide comprising the step of culturing the recombinant microorganism to express the polypeptide and recovering the polypeptide from the cultured recombinant microorganism or culture.
  • the present invention also provides a composition for preventing or treating cancer containing the polypeptide as an active ingredient.
  • the present invention also provides a method for treating or preventing cancer comprising administering the polypeptide or a pharmaceutically acceptable salt thereof.
  • the present invention also provides the use of the polypeptide or a pharmaceutically acceptable salt thereof for the treatment or prevention of cancer.
  • the present invention also provides the use of the polypeptide or a pharmaceutically acceptable salt thereof for the manufacture of a medicament for the treatment or prevention of cancer.
  • FIG. 1 is a schematic diagram showing the overall structure of a repebody displaying amino acid residues for which a random library was constructed to select a polypeptide that specifically binds to PD-1.
  • Figure 2 is a phage library constructed in the present invention, after performing bio-panning of the phage display for PD-1, the binding force of the primarily selected Lipibody clones using an Isothermal Titration Calorimetry (ITC) It is a figure showing the measurement result.
  • ITC Isothermal Titration Calorimetry
  • FIG. 3 is an isothermal titration calorimeter
  • ITC isothermal Titration Calorimetry
  • FIG. 4 is a view confirming that the G9 Lipid body selected in the present invention specifically binds to human PD-1.
  • FIG. 5 is a view confirming the result of inhibiting the binding of PD-1 and PD-L1 by acting as a competitor for PD-L1 when the G9 Lipid Body selected in the present invention is treated by concentration.
  • MLR mixed lymphocyte reaction
  • MLR mixed lymphocyte reaction
  • Figure 8 shows the experimental results confirming that the proliferation of cancer cells is suppressed when the G9 Lipibody selected in the present invention is injected into an immunodeficient model mouse implanted with human peripheral blood mononuclear cells and NCI-H292 (lung cancer cell line) cells. It is a drawing showing.
  • FIG. 9 is a diagram showing the experimental results confirming that the tumor size at day 31 was significantly reduced in a model mouse experiment using the G9 lipid body selected in the present invention, where DPBS is a control group, r_off is an off-target wild-type lipid body control group and r_G9 refers to the experimental group treated with the Lipee body of the present invention.
  • a polypeptide that specifically binds to programmed cell death protein 1 (PD-1) was selected, and the effect of T cell activation was confirmed by inhibition of the PD-1 activity.
  • polypeptides that specifically bind a polypeptide included in a library for development of a lipid body through biopanning using a phagemid of PD-1 was performed, and a task of improving their binding ability was performed.
  • a polypeptide specific for PD-1 was prepared.
  • the N-terminus of the internallin B protein, a variable lymphocyte receptor (VLR) ), the LRR (Leucine-rich repeat) protein portion was fused, and a library containing randomly repeating modules of the polypeptide was constructed (FIG. 1).
  • the polypeptide contained in the library is encoded by the polynucleotide sequence of SEQ ID NO: 1 or 75%, preferably 85%, more preferably 90%, and more preferably 95% of the polynucleotide sequence of SEQ ID NO: 1 It may be encoded by a polynucleotide sequence having the above homology.
  • the library may be in the form of a phagemid containing the polynucleotide.
  • phagemid refers to a circular polynucleotide molecule derived from phage, a virus having E. coli as a host, and contains sequences of proteins and surface proteins necessary for reproduction and proliferation.
  • Recombinant phagemid can be prepared using gene recombination techniques well known in the art, and site-specific DNA cleavage and ligation can be performed using enzymes generally known in the art.
  • the phagemid may include a signal sequence or a leader sequence for secretion in addition to expression control elements such as a promoter, operator, start codon, stop codon, and enhancer, and mainly fuse the desired protein with the surface protein of the phage to label the phage surface.
  • the promoter of phagemid is primarily inducible and may contain selectable markers for selecting host cells.
  • the phagemid includes MalEss, DsbAss or PelBss, which are signal sequences or leader sequences for expressing and secreting the polynucleotide encoding the polypeptide constituting the library, and expressing the recombinant protein on the surface of the phage.
  • sequence described in the prior patent of the present inventor comprising a polynucleotide encoding a histidine-tag for identification and a gp3 domain, which is a kind of surface protein of M13 phage for expression on the phage surface It may be a polynucleotide of number 2, but is not particularly limited thereto.
  • CD279 cluster of differentiation 279
  • immune checkpoint a signaling protein called an immune checkpoint, which regulates the activation and function of T cells. It is known to play a role.
  • This protein is a membrane protein consisting of 268 amino acids, and consists of an extracellular IgV domain, a transmemebrane domain, and an intracellular tail exposed outside the cell.
  • PD-1 of T cells In the tumor microenvironment, the binding of PD-1 of T cells to PD-L1, a ligand expressed from cancer cells, activates the PD-1 signaling pathway, resulting in inactivation of T cells. It is found in a variety of cancers such as species, non-small cell lung cancer, and kidney cell cancer.
  • the present inventors use the phage display method using the library containing the phagemid, consisting of 91, 93, 94, 115, 117 and 118 in the amino acid sequence encoded by the DNA sequence of SEQ ID NO: 1.
  • a new polypeptide (SEQ ID NO: 3) in the form of a lipid body having excellent binding power to PD-1 was selected by mutating amino acids at one or two or more positions selected from the group (FIG. 2).
  • the present invention relates to the N-terminus of the LRR (Leucine rich repeat) family protein having an alpha helical capping motif and the modified repeat module of the VLR (Variable Lymphocyte Receptor) protein, and the C- It is a polypeptide that selectively binds to programmed cell death protein 1 (PD-1) in which the terminal is fused, and in the amino acid sequence represented by SEQ ID NO: 2 i) 91 isoleucine is substituted with asparagine; ii) threonine at position 93 is substituted with tryptophan; iii) Glycine 94 is substituted with glutamic acid; iv) valine 115 is substituted for threonine; v) valine 117 is substituted with phenylalanine; vi) glutamic acid at position 118 is substituted with leucine; vii) Alanine 141 is substituted with lysine; And viii) it relates to a polypeptide that selectively
  • the N-terminus of the LRR family protein having the alpha helical capping motif may be characterized in that the N-terminus of the internalin protein, and the internalin protein is preferably internalin A , Internalin B, internalin C, internalin H and internalin J may be characterized in that selected from the group consisting of, and more preferably characterized in that the internalin B protein.
  • intranaline B protein refers to a kind of LRR family protein expressed in Listeria strains, which are different from other LRR family proteins in which different hydrophobic cores are uniformly distributed throughout the entire molecule. It is known to be stably expressed in microorganisms due to its N-terminal structure.
  • the N-terminus of the internallin protein is derived from microorganisms, as well as the form of the N-terminal region, which is most important for folding of the repeating module, contains a more stable structure including an alpha helix, so that the LRR family proteins in microorganisms It can be used effectively for stable expression.
  • N-terminal of the internalin protein refers to the N-terminus of the internalin protein required for water-soluble expression and folding of the protein, and includes an alpha helical capping motif and a repeating module of the internalin protein. it means.
  • the N-terminus of the internalin protein includes, without limitation, the N-terminus of the internalin protein required for water-soluble expression and folding of the protein. Examples include the alpha spiral capping motif "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" (SEQ ID NO: 7) and a repeating module. can do.
  • the repeating module pattern may include "LxxLxxLxLxxN" (SEQ ID NO: 8).
  • L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine, or tryptophan; N is asparagine, glutamine, serine, cysteine or threonine, and x is a hydrophilic amino acid.
  • the N-terminus of the internalin protein can be selected from the N-terminus with high structural similarity depending on the type of LRR family protein that can be fused, and the most stable amino acid is selected through calculation of binding energy, etc. Mutation is possible.
  • VLR Very Lymphocyte Receptor
  • the term "Variable Lymphocyte Receptor (VLR)" of the present invention refers to a type of LRR family protein expressed in black eel and seven-star eel. As a protein that performs immune function in black eel and seven-star eel, it is applied to various antigenic substances. It can be usefully used as a skeleton that can be bound.
  • the polypeptide in which the N-terminus of the internalin B protein and the VLR protein are fused has an increased water solubility and expression amount than the VLR protein in which the internalin B protein is not fused, so it can be used in the manufacture of a novel protein therapeutic agent based on this. have.
  • LRR Leucine rich repeat protein
  • the repeat module consists of 20 to 30 amino acids, (iii) the LRR repeat module has "LxxLxxLxLxxN" as a conservative pattern, where L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine and tryptophan.
  • a hydrophobic amino acid such as, N is asparagine, glutamine, serine, cysteine or threonine
  • x means all kinds of 20 amino acids
  • LRR family proteins have a three-dimensional structure like a horseshoe. It means a protein that has.
  • the LRR family protein of the present invention has a sequence unknown in nature through a design such as consensus design, as well as having already known its sequence or found using mRNA or cDNA newly induced in vivo. It can contain all variants with the skeletal structure of the module.
  • the term "Repebody” of the present invention is a polypeptide optimized by consensus design by fusion based on the similarity of the structure of the VLR with the N-terminus of the internalin having an LRR structure.
  • the lipid body protein can be divided into a concave region (Concave) and a convex region (Convex) in structure.
  • the concave region has high sequence diversity and is known as an important site for protein interaction.
  • the convex region plays a role in stably maintaining the entire structure of the protein based on the highly conserved sequence.
  • the lipid body protein may include all proteins belonging to the LRR family having a repeating module and all fusion LRR family proteins whose water-soluble expression and biophysical properties of the protein are improved by the above method.
  • polypeptide may be characterized in that it is represented by the amino acid sequence of SEQ ID NO: 3 or 4.
  • the polypeptide may be characterized in that it inhibits its activity by binding to the programmed cell death protein 1 (programmed cell death protein 1).
  • the present invention relates to a polynucleotide encoding the polypeptide.
  • the polynucleotide is not particularly limited thereto, but may be a polynucleotide encoding an amino acid sequence of any one of SEQ ID NOs: 3 to 4, and 70% or more, more preferably 80, with the polynucleotide. % Or more, more preferably 90% or more, but may be a polynucleotide having a nucleotide sequence having homology, but is not particularly limited thereto.
  • the present invention relates to a recombinant vector comprising the polynucleotide.
  • vector refers to a DNA preparation containing the base sequence of a polynucleotide encoding the protein of interest operably linked to a suitable control sequence so that the protein of interest can be expressed in a suitable host.
  • suitable control sequence include a promoter capable of initiating transcription, any operator sequence for regulating such transcription, a sequence encoding a suitable mRNA ribosome binding site, and a sequence regulating the termination of transcription and translation.
  • the vector After transformation into a suitable host, the vector can replicate or function independently of the host genome and can be integrated into the genome itself.
  • the vector used in the present invention is not particularly limited as long as it is capable of replicating in a host, and any vector known in the art may be used.
  • Examples of commonly used vectors include natural or recombinant plasmids, phagemids, cosmids, viruses and bacteriophages.
  • pWE15, M13, ⁇ MBL3, ⁇ MBL4, ⁇ IXII, ⁇ ASHII, ⁇ APII, ⁇ t10, ⁇ t11, Charon4A, and Charon21A can be used as a phage vector or cosmid vector, and as a plasmid vector, pBR system, pUC system, pBluescript II system , pGEM system, pTZ system, pCL system, pET system, etc. can be used.
  • the vector usable in the present invention is not particularly limited, and a known expression vector may be used.
  • pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a vectors, and the like may be used.
  • pET-21a and pET-32a vectors may be used.
  • the present invention relates to a recombinant microorganism into which the polynucleotide or a recombinant vector containing the polynucleotide is introduced.
  • the term "recombinant microorganism" of the present invention refers to a cell transfected by introducing a vector having a gene encoding one or more target proteins into a host cell to express the target protein, and all cells such as eukaryotic cells and prokaryotic cells It may be, but is not particularly limited thereto, bacteria cells such as Escherichia coli, Streptomyces, Salmonella typhimurium, etc.; Yeast cells; Fungal cells such as Pichia pastoris; Insect cells such as Drozophila and Spodoptera Sf9 cells; Animal cells such as CHO, COS, NSO, 293, and Bow melanoma cells; Or it could be a plant cell.
  • the host cell usable in the present invention is not particularly limited, but preferably E. coli may be used as the host cell. Most preferably, E. coli BL21 (DE3) and OrigamiB (DE3) may be used as host cells.
  • the term "transformation” means introducing a vector containing a polynucleotide encoding a target protein into a host cell so that the protein encoded by the polynucleotide can be expressed in the host cell.
  • Transformed polynucleotides include all of them, whether inserted into the chromosome of the host cell or located outside the chromosome, as long as they can be expressed in the host cell.
  • the polynucleotide includes DNA and RNA encoding the target protein. The polynucleotide may be introduced in any form as long as it can be introduced into a host cell and expressed.
  • the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct containing all elements necessary for self-expression.
  • the expression cassette usually includes a promoter operably linked to the polynucleotide, a transcription termination signal, a ribosome binding site, and a translation termination signal.
  • the expression cassette may be in the form of an expression vector capable of self-replicating.
  • the polynucleotide may be introduced into a host cell in its own form and operably linked to a sequence required for expression in the host cell.
  • the step of culturing the recombinant microorganism is not particularly limited thereto, but is preferably performed by a known batch culture method, a continuous culture method, a fed-batch culture method, etc., and the culture conditions are not particularly limited thereto,
  • a basic compound e.g. sodium hydroxide, potassium hydroxide, or ammonia
  • an acidic compound e.g. phosphoric acid or sulfuric acid
  • pH pH 5 to 9, preferably pH 6 to 8, most preferably pH 6.8.
  • the culture temperature can be maintained at 20 to 45 °C, preferably 25 to 40 °C, for about 10 to 160 hours It is desirable to cultivate it.
  • the polypeptide produced by the culture may be secreted into the medium or may remain in the cells.
  • the culture medium used is a carbon source such as sugars and carbohydrates (e.g. glucose, sucrose, lactose, fructose, maltose, molase, starch and cellulose), fats and fats (e.g., soybean oil, sunflower seeds). Oil, peanut oil and coconut oil), fatty acids (e.g. palmitic acid, stearic acid and linoleic acid), alcohols (e.g. glycerol and ethanol), and organic acids (e.g. acetic acid) can be used individually or in combination. ; Nitrogen sources include nitrogen-containing organic compounds (e.g. peptone, yeast extract, broth, malt extract, corn steep liquor, soybean meal and urea), or inorganic compounds (e.g.
  • ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate, and Ammonium nitrate) or the like may be used individually or in combination;
  • potassium dihydrogen phosphate, dipotassium hydrogen phosphate, corresponding sodium-containing salts and the like may be used individually or in combination;
  • Other metal salts such as magnesium sulfate or iron sulfate), amino acids, and essential growth-promoting substances such as vitamins may be included.
  • the method for recovering the polypeptide produced in the culturing step of the present invention is a method of recovering the polypeptide of interest from the culture medium using a suitable method known in the art according to a cultivation method, for example, a batch, continuous, or fed-batch cultivation method. Can be collected.
  • the present invention relates to a composition for preventing or treating cancer containing the polypeptide as an active ingredient.
  • the cancer prevention or treatment may be characterized in that the polypeptide is combined with the programmed apoptosis protein 1 of T cells.
  • the cancer prevention or treatment may be characterized in that the polypeptide is combined with the programmed apoptosis protein 1.
  • cancers or tumors in the present invention are any type that expresses PD-L1, but preferably non-Hodgkin lymphoma, non-Hodgkin lymphoma, acute myelogenous leukemia (acute- myeloid leukemia), acute-lymphoid leukemia, multiple myeloma, head and neck cancer, lung cancer, non-small cell lung cancer, glioblastoma, colon/rectal cancer, pancreatic cancer, breast cancer, It may be characterized in that it is selected from the group consisting of ovarian cancer, malignant melanoma, prostate cancer, kidney cancer, and mesothelioma, but is not limited thereto.
  • the present invention relates to a method for treating or preventing cancer comprising administering the polypeptide or a pharmaceutically acceptable salt thereof.
  • the present invention relates to the use of the polypeptide or a pharmaceutically acceptable salt thereof for the treatment or prevention of cancer.
  • the present invention relates to the use of the polypeptide or a pharmaceutically acceptable salt thereof for the manufacture of a medicament for the treatment or prevention of cancer.
  • the cancer prevention or treatment may be characterized in that the polypeptide is combined with the programmed apoptosis protein 1 of T cells.
  • the cancer prevention or treatment may be characterized in that the polypeptide is combined with the programmed apoptosis protein 1.
  • cancers or tumors in the present invention are any type that expresses PD-L1, but preferably non-Hodgkin lymphoma, non-Hodgkin lymphoma, acute myelogenous leukemia (acute- myeloid leukemia), acute-lymphoid leukemia, multiple myeloma, head and neck cancer, lung cancer, non-small cell lung cancer, glioblastoma, colon/rectal cancer, pancreatic cancer, breast cancer, It may be characterized in that it is selected from the group consisting of ovarian cancer, malignant melanoma, prostate cancer, kidney cancer, and mesothelioma, but is not limited thereto.
  • the term “treatment” means not only suppressing or alleviating cancer or one or more symptoms caused therefrom by administration of the composition, but also treating cancer or preventing the progression of cancer that reverses the symptoms of the disease.
  • the term “prevention” refers to any action that suppresses or delays the onset of cancer by administration of the composition.
  • the prevention or treatment of cancer is achieved by binding the polypeptide obtained in the present invention with the programmed apoptosis protein 1, and significantly inhibits its activity by binding to the programmed apoptosis protein 1 to prevent or treat cancer. It is to do.
  • composition for preventing or treating cancer containing the polypeptide of the present invention as an active ingredient may further include a pharmaceutically acceptable carrier, and may be formulated together with the carrier.
  • the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not stimulate an organism and does not inhibit the biological activity and properties of the administered compound.
  • Acceptable pharmaceutical carriers for compositions formulated as liquid solutions are sterilized and biocompatible, and include saline, sterile water, Ringer's solution, buffered saline, albumin injection solution, dextrose solution, maltodextrin solution, glycerol, ethanol, and One or more of these components may be mixed and used, and other conventional additives such as antioxidants, buffers, and bacteriostatic agents may be added as necessary.
  • diluents such as aqueous solutions, suspensions, emulsions, etc., pills, capsules, granules, or tablets.
  • composition for preventing or treating cancer comprising the polypeptide and a pharmaceutically acceptable carrier of the present invention can be applied in any formulation containing it as an active ingredient, and can be prepared in an oral or parenteral formulation.
  • the pharmaceutical formulation of the present invention is oral, rectal, nasal, topical (including cheek and sublingual), subcutaneous, vaginal or parenteral; intramuscular, subcutaneous And those suitable for administration, including intravenous) or forms suitable for administration by inhalation or insufflation.
  • Formulations for oral administration comprising the composition of the present invention as an active ingredient include, for example, tablets, troches, lozenges, water-soluble or oily suspensions, powders or granules, emulsions, hard or soft capsules, syrup or elixirs. can do.
  • binders such as lactose, saccharose, sorbitol, mannitol, starch, amylopectin, cellulose or gelatin, excipients such as dicalcium phosphate, disintegrants such as corn starch or sweet potato starch, and masne stearate
  • Excipients such as dicalcium phosphate, disintegrants such as corn starch or sweet potato starch, and masne stearate
  • Lubricating oils such as calcium, calcium stearate, sodium stearyl fumarate, or polyethylene glycol wax may be included, and in the case of capsule formulation, a liquid carrier such as fatty oil may be further included in addition to the above-mentioned substances.
  • Formulations for parenteral administration containing the composition of the present invention as an active ingredient include injection forms such as subcutaneous injection, intravenous injection, or intramuscular injection, suppository injection, or spray such as an aerosol that enables inhalation through the respiratory tract. It can be formulated as.
  • the composition of the present invention may be prepared as a solution or suspension by mixing in water together with a stabilizer or buffer, and it may be formulated for unit administration in ampoules or vials.
  • inject as a suppository it may be formulated into a composition for rectal administration such as a suppository containing a conventional suppository base such as cocoa butter or other glycerides or an enema.
  • a propellant or the like may be blended together with an additive so that the water-dispersed concentrate or wet powder is dispersed.
  • the present invention relates to a method for preventing or treating cancer, comprising administering a composition for preventing or treating cancer containing the polypeptide as an active ingredient.
  • the term "administration" means introducing the pharmaceutical composition of the present invention to a patient by any suitable method.
  • the route of administration of the composition of the present invention may be administered through various routes, either oral or parenteral, as long as it can reach the target tissue, and specifically, oral, rectal, topical, intravenous, intraperitoneal, intramuscular, intraarterial, It can be administered in a conventional manner via transdermal, intranasal, inhalation, intraocular or intradermal routes.
  • the treatment method of the present invention includes administering the composition for preventing or treating cancer of the present invention in a pharmaceutically effective amount. It is obvious to those skilled in the art that the appropriate total daily use amount can be determined by the treating physician within the range of correct medical judgment.
  • a specific therapeutically effective amount for a particular patient is the type and extent of the reaction to be achieved, the specific composition, including whether or not other agents are used in some cases, the patient's age, weight, general health status, sex and diet, administration time, It is preferable to apply differently according to various factors including the route of administration and the secretion rate of the composition, the treatment period, drugs used with or concurrently with the specific composition, and similar factors well known in the medical field. Therefore, it is preferable to determine the effective amount of the composition for preventing or treating cancer suitable for the purposes of the present invention in consideration of the above-described matters.
  • the treatment method of the present invention can be applied to any animal that can cause diseases such as tumor development and angiogenesis due to excessive activity of the programmed apoptosis protein 1, and the animal is not only humans and primates, but also cattle, Includes livestock such as pigs, sheep, horses, dogs and cats.
  • Example 1 Protein structure-based lipid body library construction
  • the repeater body is a concave area due to the curvature of the shape of the whole structure and modularity that maintains the entire protein structure by successively connecting repeat units with conserved leucine sequences. region) and a convex region.
  • a hypervariable region is located like a complementarity determining region (CDR) of an antibody to mediate protein-protein interactions.
  • CDR complementarity determining region
  • the convex region plays an important role in maintaining the overall structure of the LRR based on the well-preserved sequence.
  • a random library was designed in the following manner by analyzing the protein structure of the Lipibody.
  • a random mutation library was constructed by selecting six amino acid residues 91, 93, 94, 115, 117, 118 located in the concave regions of two consecutive modules (LRRV2, LRRV3 modules) located in the direction of the amine group end. was done (Fig. 1).
  • a mutagenic primer for library construction was synthesized to replace the selected amino acid with an NNK degenerate codon.
  • the primer sequence is as follows.
  • SEQ ID NO: 5 M1 CTG CCG AAT GGC GTC TTT GAT AAA CTG ACG AAC CTG AAA GAA CTG NNK CTG NNK NNK AAT CAA CTG CAG TCT CTG CCG GAC
  • SEQ ID NO: 6 M2 CGT CAG TTT ATC AAA GAC GCC ATT CGG CAG GCT CTG CAG TTG GTT MNN MNN CAG MNN CAG ATA CGT CAG ATT GGT CAG TTC
  • the obtained library was introduced into E. coli TG-1 by electroporation to obtain a transformant, thereby constructing a library having a diversity of 2.0x108 level.
  • Example 2 Selection of a polypeptide that specifically binds to PD-1 through a random phage library
  • Example 2-1 Selection of a polypeptide that binds to PD-1 through panning of a Lipibody library
  • a polypeptide capable of binding to PD-1 was selected and purified.
  • biotinylated PD-1 was added to streptavidin-conjugated magnetic beads at a concentration of 10 ⁇ g/ml, and 30 at room temperature. After binding reaction for a minute, it was washed 3 times with PBS. The PD-1-conjugated magnetic beads and magnetic beads for negative selection were blocked with PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20 for 1 hour at room temperature.
  • TPBSA PBS solution
  • the purified phage was first added to the magnetic beads for negative selection at a concentration of 1012 cfu/ml, reacted at room temperature for 1 hour, and then the phage randomly bound to the magnetic beads was removed. After that, only the phage present in the supernatant was added to the magnetic beads to which the PD-1 was bound, and reacted at room temperature for 1 hour. After the reaction was completed, it was washed 5 times each for a total of 1 minute with a PBS solution (TPBS) containing 0.05% Tween 20, and then washed once with PBS.
  • TPBS PBS solution
  • Example 2-2 Confirmation of specific binding to PD-1 of the selected Lipibody and sequence analysis
  • the phage selected through the method of Example 2-1 was subjected to an enzyme-linked immunosorbent assay (ELISA) using a 96-well plate coated with PD-1 and BSA.
  • ELISA enzyme-linked immunosorbent assay
  • isoleucine amino acid 91 is substituted with asparagine, threonine 93 is substituted with tryptophan, glycine 94 is substituted with glutamic acid, valine 115 is substituted with threonine, and valine 117 is substituted with phenylalanine. It was substituted, and it was confirmed that glutamic acid at No. 118 was substituted with leucine. As a result of measuring the dissociation constant of the selected A1 lipid body with respect to PD-1 by isothermal calorimetry (ITC), it was confirmed that it had a binding force of 617 nM (FIG. 2).
  • ITC isothermal calorimetry
  • Example 3 Performing Increased Cohesion of Lipee Body to PD-1 Using a Module-Based Method
  • the module-based affinity increasing method described in the present invention was performed according to the prior patent (KR2012-0019927).
  • This method is a technology that can be used universally for a protein having a repeat module, and has been successfully reproduced in this patent, enabling the design of a protein having a high level of affinity.
  • Example 3-1 Constructing an additional library using a module and confirming the increase in avidity and confirming the presence of cross-linking to other proteins
  • the library for module-based affinity enhancement is a mutation of amino acids 137, 139, 141 and 142, a total of 4 amino acid residues of the LRRV4 module.
  • a body G9 clone was obtained (SEQ ID NO: 4).
  • G9 lipid body was added to determine the degree of binding by performing enzyme-linked immunoprecipitation (ELISA). It was confirmed that it specifically binds only to PD-1 (Fig. 4).
  • the present inventors have successfully secured a lipid body having high binding power to human PD-1, and it has been confirmed that this is a polypeptide having specific binding power to PD-1.
  • the anti-PD-1 monoclonal antibody binds to the site and prevents PD-1 from interacting with the PD-1 receptor, thereby effectively inhibiting the activity of PD-1 and exhibiting high therapeutic efficacy.
  • a competitive enzyme-linked immunoprecipitation method (competitive ELISA) was performed to determine whether the finally obtained G9 lipid body can inhibit the interaction between PD-1 and PD-L1. Specifically, by simultaneously adding a lipid body and a soluble PD-L1 (soluble PD-L1) to a plate coated with PD-1, it was determined whether the amount of PD-L1 bound to PD-1 decreased due to the competitive binding of the lipid body. I wanted to confirm.
  • Example 5 Analysis of the possibility of inhibiting PD-1 signal transduction of the selected Lipibody
  • PD-1 bound to PD-L1 is known to block a signaling pathway that activates T cells by attracting a phosphatase called SHP2 while being phosphorylated.
  • SHP2 a phosphatase
  • the selected G9 lipid body not only specifically binds to PD-1, but also blocks PD-1 signaling by blocking the interaction of PD-L1, and as a result, must play a role of activating T cells.
  • T cells obtained from human blood and allogeneic dendritic cells were mixed to induce an immune response, and then the T cells activated by the treated G9 lipid body were cytokine Interleukin-2 (IL-2). )) and interferon-gamma (Interferon-gamma (IFN- ⁇ )) was produced and secreted.
  • IL-2 cytokine Interleukin-2
  • IFN- ⁇ interferon-gamma
  • PBMC Peripheral blood mononuclear cells
  • mononuclear cells are isolated using a kit (Monocyte Isolation Kit II, Miltenyi Biotec, Germany) that separates peripheral blood mononuclear cells from blood obtained from other blood donors in the same manner as above and specifically separates monocytes from them. I did.
  • the isolated monocytes were treated with cytokines such as granulocyte macrophage colony stimulating factor (GM-CSF), interleukin-4, and tumor necrosis factor-alpha (TNF- ⁇ ) to induce differentiation into dendritic cells.
  • GM-CSF granulocyte macrophage colony stimulating factor
  • interleukin-4 interleukin-4
  • TNF- ⁇ tumor necrosis factor-alpha
  • T cells 1 ⁇ 10 5 and allogeneic dendritic cells 1 ⁇ 10 4 were mixed and cultured in a 96-well cell culture plate to perform a mixed lymphocyte reaction (MLR) experiment. Each well was treated with a lipid body by concentration, and the amount of cytokines present in the supernatant was measured by enzyme-linked immunoprecipitation after incubation for 5 days.
  • MLR mixed lymphocyte reaction
  • Example 6 Confirmation of the ability of the selected Lipibody to inhibit cancer cell growth in a mouse model
  • NCI-H292 cancer cell line Korea Cell Line Bank 2 ⁇ 106 cells and 5 ⁇ 105 human peripheral blood mononuclear cells were mixed with BD Matrigel Matrix to prepare a total volume of 100 ⁇ l, and then 6-8 weeks old female NOD/ShiLtJ-Rag2em1AMC Il2rgem1AMC (NRGA) It was injected by subcutaneous injection into the right flank of a mouse (medium baby bio). From one day after transplantation, Lipibody was injected intraperitoneally at a dose of 10 mg/kg.
  • Lippibody was administered 4 times on the 1st, 3rd, 7th, and 10th days after transplantation, and the off-target Lipibody injection group and the DPBS-only group were set as controls.
  • the tumor size of the mouse was measured with a caliper once every 3-4 days from one week after transplantation.
  • the tumor volume was calculated by the following formula.
  • Tumor volume (V) (Tumor area (W)2 ⁇ Tumor length (L))/2 (mm3).
  • novel polypeptide that binds to PD-1 of the present invention not only specifically binds to PD-1, but also inhibits its activity to induce the activity of immune T cells. It is useful for the development of therapeutic agents.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Microbiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

본 발명은 프로그램된 세포사멸 단백질 1과 특이적으로 결합 가능한 신규한 폴리펩타이드, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드, 상기 폴리뉴클레오타이드를 포함하는 벡터, 상기 발현벡터가 도입된 재조합 미생물, 상기 재조합 미생물 이용한 상기 폴리펩타이드의 제조방법, 상기 폴리펩타이드를 포함하는 암 예방 또는 치료용 조성물 및 상기 폴리펩타이드를 포함하는 암 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 암을 예방 또는 치료하는 방법에 관한 것이다. 본 발명의 폴리펩타이드는 프로그램된 세포사멸 단백질 1에 결합하여 그의 활성을 억제할 수 있으므로, 프로그램된 세포사멸 단백질 1과 연관된 다양한 질환의 예방 또는 치료용 제제로 널리 활용될 수 있다.

Description

사람의 프로그램된 세포사멸 단백질(PD-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
본 발명은 사람의 프로그램된 세포사멸 단백질 1(programmed cell death protein 1; PD-1)에 선택적으로 결합하는 신규한 폴리펩티드에 관한 것으로, 보다 구체적으로 본 발명은 사람의 프로그램된 세포사멸 단백질 1에 결합함으로써 면역항암제의 역할을 할 수 있는 폴리펩티드, 상기 폴리펩티드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터, 상기 재조합 벡터가 도입된 재조합 미생물, 상기 재조합 미생물을 이용한 상기 폴리펩티드 생산방법 및 상기 폴리펩티드를 포함하는 치료용 의약 조성물에 관한 것이다.
현재 널리 사용되고 있는 1세대 화학항암제, 2세대 표적항암제의 경우, 항암제의 독성으로 인한 부작용과 약물의 내성위험이 높고 특정 유전자 변이가 있는 환자에게만 투여할 수 있는 문제점이 있다. 이러한 문제점을 극복한 제3세대 항암제로 불리는 면역 항암제는 면역세포의 신호전달 경로에 작용하여 면역세포를 활성화시켜 암세포를 공격하여 치료효과를 낸다. 기존의 항암제와 달리 우리 몸의 면역체계를 활성화시켜 암세포를 치료하는 방법으로 다양한 종류의 암 치료에 적용할 수 있으며 부작용 또한 기존 항암제보다 낮은 것으로 보고되고 있다.
프로그램된 세포사멸 단백질 1은 면역 체크 포인트 수용체로 악성 흑색종, 비소세포폐암, 신장 세포 암 등 다양한 암의 치료에서 면역 항암제의 훌륭한 표적 단백질이 될 수 있다. 프로그램된 세포사멸 단백질 1 (programmed cell death protein 1; PD-1)은 T 세포의 표면에 존재하는 수용체로서 면역 글로불린 슈퍼 패밀리에 속한다. 프로그램된 세포사멸 단백질 1이 리간드인 프로그램된 세포사멸 리간드 1 (Programmed death ligand 1; PD-L1)이나 프로그램된 세포사멸 리간드 2 (Programmed death ligand 2; PD-L2)와 결합하면 PD-1이 관여하는 신호 전달이 활성화되어 T 세포의 증식, 인터페론 감마와 인터류킨 2의 생산 및 T 세포 수용체의 신호 전달이 억제되어 T 세포의 활성화가 억제된다. 다양한 종류의 암세포들이 PD-1을 발현하는 것으로 알려져 있으며, 이는 T 세포가 기능을 잃는 결과를 초래하여 암세포가 면역체계의 공격을 피해가는 기작으로 작용한다.
PD-1을 표적으로 하는 약물로는 단일 클론 항체인 니볼루맙 (Nivolumab), 펨브롤리주맙 (Pembrolizumab)이 있으며 악성 흑색종과 비소세포폐암의 치료제로 사용되고 있으나 생산 단가가 높아 환자의 경제적 부담이 크다는 것과 치료 효능에 대한 정확한 검증이 필요한 것으로 보고되고 있다. 따라서 기존 약물이 가진 한계를 극복한 새로운 개념의 PD-1 표적 치료제의 개발이 절실히 요구되고 있는 실정이다.
본 발명자들은 다양한 단백질에 대헤 특이적으로 결합가능한 리피바디(Repebody)라는 폴리펩티드를 개발한 바 있다(대한민국 특허 제10-1356075호, 제10-1654890호, 제10-1587622호, 제10-1624702호, 제10-1624703호, 제10-1713944호, 제10-1751501호, 제10-1818152호 및 제10-1875809호).
상기 리피바디는 LRR (Leucin-rich repeat)의 구조를 갖는 인터날린 B의 N-말단과 VLR의 구조의 유사성을 바탕으로 융합하여 컨센시스 디자인으로 최적화시킨 폴리펩티드를 의미한다. 리피바디는 크기가 항체의 1/5 수준이고 대장균에서 대량생산이 가능하여 생산 단가를 낮출 수 있고, 열 및 pH 안정성이 매우 우수하여 산업적인 사용에 큰 장점을 가지고 있다. 또한 표적 물질에 대한 결합력을 매우 용이하게 증대시킬 수 있으며 표적 물질에 대한 특이성이 매우 탁월함을 입증한 바가 있다.
이러한 배경 하에서, 본 발명자들은 상기 리피바디 골격을 이용하여 다양한 암 치료의 중요한 표적 단백질인 PD-1에 특이적으로 결합하는 단백질을 성공적으로 확보하기 위해 예의 노력한 결과, 리피바디의 구조적 특징인 모듈성과 전체구조분석을 통해 구축한 무작위한 돌연변이 라이브러리를 바탕으로 PD-1에 대해 특이적인 결합력을 갖는 신규한 폴리펩타이드를 제조 및 선별하였으며, 상기 리피바디가 PD-1에 선택적으로 결합하여 리간드인 PD-L1과의 상호작용을 저해함으로써 면역세포를 활성화시키며 암세포의 증식을 억제하는 효과가 있음을 확인하고 본 발명을 완성하였다.
발명의 요약
본 발명의 목적은 사람의 PD-1에 특이적으로 결합하는 리피바디(Repebody); 상기 리피바디를 코딩하는 폴리뉴클레오티드; 상기 폴리뉴클레오티드를 포함하는 재조합 벡터; 상기 재조합 벡터가 도입된 재조합 미생물; 및 상기 재조합 미생물를 이용해 상기 리피바디를 생산하는 방법을 제공하는데 있다.
본 발명의 다른 목적은 상기 폴리펩타이드를 함유하는 암 예방 또는 치료용 조성물 및 상기 폴리펩타이드를 함유하는 암 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 암을 예방 또는 치료하는 방법을 제공하는 것이다.
상기 목적을 달성하기 위해, 본 발명은 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 프로그램된 세포사멸 단백질 1(programmed cell death protein 1, PD-1)에 선택적으로 결합하는 폴리펩타이드로, 서열번호 2로 표시되는 아미노산 서열에서 i) 91번 이소류신이 아스파라긴으로 치환; ii) 93번 트레오닌이 트립토판으로 치환; iii) 94번 글라이신이 글루탐산으로 치환; iv) 115번 발린이 트레오닌으로 치환; v) 117번 발린이 페닐알라닌으로 치환; vi) 118번 글루탐산이 류신으로 치환; vii) 141번 알라닌이 리신으로 치환; 및 viii) 142번 히스티딘이 페닐알라닌으로 치환으로 구성된 군에서 선택되는 하나 또는 둘 이상의 아미노산 변이를 포함하는 것을 특징으로 하는, 프로그램된 세포사멸 단백질 1에 선택적으로 결합하는 폴리펩타이드를 제공한다.
본 발명은 또한, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드 및 상기 폴리뉴클레오티드를 포함하는 재조합 벡터를 제공한다.
본 발명은 또한, 상기 재조합 벡터가 포함되어 있는 재조합 미생물을 제공한다.
본 발명은 또한, 상기 재조합 미생물을 배양하여 상기 폴리펩타이드를 발현시키는 단계 및 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 폴리펩타이드의 제조방법을 제공한다.
본 발명은 또한, 상기 폴리펩타이드를 유효성분으로 함유하는 암 예방 또는 암 치료용 조성물을 제공한다.
본 발명은 또한, 상기 폴리펩타이드 또는 이의 약학적으로 허용가능한 염을 투여하는 단계를 포함하는 암의 치료 또는 예방 방법을 제공한다.
본 발명은 또한, 암의 치료 또는 예방을 위한 상기 폴리펩타이드 또는 이의 약학적으로 허용가능한 염의 용도를 제공한다.
본 발명은 또한, 암의 치료 또는 예방용 약제 제조를 위한 상기 폴리펩타이드 또는 이의 약학적으로 허용가능한 염의 사용을 제공한다.
도 1은 PD-1과 특이적으로 결합하는 폴리펩타이드를 선별하기 위하여 무작위적인 라이브러리를 구축한 아미노산 잔기들을 표시한 리피바디(repebody)의 전체 구조를 나타내는 개략도이다.
도 2는 본 발명에서 구축한 파지 라이브러리를 이용하여, PD-1에 대한 파지 디스플레이의 바이오 패닝을 수행 후 일차적으로 선별된 리피바디 클론의 결합력을 등온 적정 열량계 (Isothermal Titration Calorimetry, ITC)를 이용하여 측정한 결과를 나타내는 도면이다.
도 3는 일차적으로 선별된 리피바디 클론으로부터 결합력 증대를 위해 구축한 파지 라이브러리를 이용하여, PD-1에 대한 파지 디스플레이의 바이오 패닝을 수행 후 최종적으로 선별된 리피바디 클론의 결합력을 등온 적정 열량계 (Isothermal Titration Calorimetry, ITC)를 이용하여 측정한 결과를 나타내는 도면이다.
도 4은 본 발명에서 선별된 G9 리피바디가 사람의 PD-1에 대해 특이적으로 결합하는 것을 확인한 도면이다.
도 5는 본 발명에서 선별된 G9 리피바디를 농도별로 처리하였을 때 PD-L1에 대한 경쟁자로 작용하여 PD-1과 PD-L1의 결합을 저해하는 결과를 확인한 도면이다.
도 6은 본 발명에서 선별된 G9 리피바디를 사람의 말초 혈액 단핵세포로부터 분리한 T 세포와 동종이형 수지상세포에 농도별로 처리하여 혼합 림프구 반응 (Mixed Lymphocyte Reaction (MLR)) 시험을 진행하였을 때, T 세포 활성화의 지표로 사용되는 사이토카인인 인터류킨-2 (Interleukin-2 (IL-2))가 생성됨을 확인한 실험 결과를 나타내는 도면이다.
도 7은 본 발명에서 선별된 G9 리피바디를 사람의 말초 혈액 단핵세포로부터 분리한 T 세포와 동종이형 수지상세포에 농도별로 처리하여 혼합 림프구 반응 (Mixed Lymphocyte Reaction (MLR)) 시험을 진행하였을 때, T 세포 활성화의 지표로 사용되는 사이토카인인 인터페론 감마 (Interferon-γ (IFN-γ))가 생성됨을 확인한 실험 결과를 나타내는 도면이다.
도 8은 본 발명에서 선별된 G9 리피바디를 사람의 말초 혈액 단핵세포와 NCI-H292 (폐암 세포주) 세포를 심은 면역 결핍된 모델 마우스에 주사하였을 때, 암세포의 증식이 억제되는 것을 확인한 실험 결과를 나타내는 도면이다.
도 9는 본 발명에서 선별된 G9 리피바디를 이용한 모델 마우스 실험에서 31일차의 종양 크기가 유의미하게 감소하는 것을 확인한 실험 결과를 나타내는 도면으로서, DPBS는 대조군, r_off는 오프 타겟 와일드 타입 리피바디 대조군 및 r_G9은 본 발명의 리피바디를 처리한 실험군을 의미한다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는 프로그램된 세포사멸 단백질 1 (programmed cell death protein 1, PD-1)에 특이적으로 결합하는 폴리펩티드를 선별하고, 상기 PD-1의 활성 억제에 의하 T세포 활성화 효과를 확인하고자 하였다.
본 발명에서는, 리피바디 개발을 위한 라이브러리에 포함된 폴리펩티드를 PD-1의 파지미드를 이용한 바이오패닝을 통해 특이적으로 결합하는 폴리펩티드의 선별을 수행하고, 이들의 결합력을 개선하는 작업을 수행하였다. 그 결과 PD-1에 특이적인 폴리펩티드를 제조하였다.
즉, 본 발명의 일 실시예에서는 PD-1에 특이적으로 결합할 수 있는 신규한 폴리펩티드를 개발하기 위하여, 인터날린 B (Internalin B) 단백질의 Ｎ-말단, 가변 림프구 수용체(Variable Lymphocyte Receptor, VLR) 의 LRR (Leucine-rich repeat) 단백질 부분이 융합된, 폴리펩티드의 반복 모듈을 무작위적으로 포함하는 라이브러리를 구축하였다(도 1). 상기 라이브러리에 포함된 폴리펩타이드는 서열번호 1의 폴리뉴클레오티드 서열에 의하여 코딩되거나 또는 서열번호 1의 폴리뉴클레오티드 서열과 75%, 바람직하게는 85%, 보다 바람직하게는 90%, 더욱 바람직하게는 95% 이상의 상동성을 갖는 폴리뉴클레오티드 서열에 의하여 코딩될 수 있다.
또한, 상기 라이브러리는 상기 폴리뉴클레오티드를 포함하는 파지미드의 형태가 될 수 있다. 본 발명의 용어 "파지미드"란, 대장균을 숙주로 하는 바이러스인 파지로부터 유래된 원형의 폴리뉴클레오티드 분자를 의미하는데, 번식과 증식에 필요한 단백질 및 표면 단백질들의 서열이 포함되어 있다. 재조합 파지미드는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 수행될 수 있다. 상기 파지미드는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 인핸서 같은 발현 조절 요소 외에도 분비를 위한 신호 서열 또는 리더 서열을 포함할 수 있고, 주로 원하는 단백질을 파지의 표면 단백질과 융합하여 파지 표면에 표지하기 위한 방법에 사용될 수 있다. 파지미드의 프로모터는 주로 유도성이며, 숙주 세포를 선택하기 위한 선택성 마커를 포함할 수도 있다. 본 발명의 목적상 상기 파지미드는 상기 라이브러리를 구성하는 폴리펩티드를 코딩하는 폴리뉴클레오티드를 발현 및 분비하기 위한 신호 서열 또는 리더 서열인 MalEss, DsbAss 또는 PelBss를 포함하고, 파지의 표면에 재조합 단백질의 발현을 확인하기 위한 히스티딘-태그와 파지 표면으로의 발현을 위한 M13 파지의 표면 단백질의 일종인 gp3 도메인을 인코딩하는 폴리뉴클레오티드를 포함하는 본 발명자의 선행 특허 (제10-2012-0019927호)에 기술된 서열번호 2의 폴리뉴클레오티드가 될 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명의 용어 “프로그램된 세포사멸 단백질 1 (programmed cell death protein 1)”은 CD279 (cluster of differentiation 279)로도 명명되며, 면역 체크포인트라 불리는 신호 전달 단백질로, T 세포의 활성화 및 기능을 조절하는 역할을 하는 것으로 알려져 있다. 본 단백질은 268개의 아미노산으로 이루어진 막단백질로서, 세포 밖으로 노출되어 있는 IgV 도메인 (extracellular IgV domain)과 막관통 도메인 (transmemebrane domain), 세포내 후부(intracellular tail)로 이루어져 있다. 종양 미세 환경 내에서 T 세포의 PD-1과 암세포로부터 발현되는 리간드인 PD-L1의 결합은 PD-1 신호전달 경로를 활성화 시켜 결과적으로는 T 세포의 불활성화를 유도하며, 이러한 현상은 악성 흑색종, 비소세포폐암, 신장 세포 암 등 다양한 암에서 발견되고 있다.
본 발명자들은 상기 파지미드를 포함하는 라이브러리를 이용한 파지 디스플레이 방법을 사용하여, 서열번호 1의 DNA 서열로 코딩되는 아미노산 서열에서 91번, 93번, 94번, 115번, 117번 및 118번으로 이루어진 군으로부터 선택되는 하나 또는 둘 이상의 위치의 아미노산이 변이되어, PD-1에 대한 결합력이 우수한 리피바디 형태의 신규한 폴리펩타이드(서열번호 3)를 선별하였다(도 2).
이후, 충분한 결합력을 갖기 위한 결합력 증대 실험을 위해 상기 선별된 폴리펩타이드들에 돌연변이를 가하여 PD-1에 대한 결합력이 향상된 변이 폴리펩타이드를 제작하고자 하였다. 이를 위하여 서열번호 1의 DNA 서열로 코딩되는 아미노산 서열에서 137번, 139번, 141번 및 142번을 돌연변이 시킨 두 번째 라이브러리를 구축하고, 상기 두 번째 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 PD-1에 대한 결합력이 우수한 신규한 폴리펩타이드(서열번호 4)를 2차 선별하였다(도 3).
따라서, 본 발명은 일 관점에서, 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 프로그램된 세포사멸 단백질 1(programmed cell death protein 1, PD-1)에 선택적으로 결합하는 폴리펩타이드로, 서열번호 2로 표시되는 아미노산 서열에서 i) 91번 이소류신이 아스파라긴으로 치환; ii) 93번 트레오닌이 트립토판으로 치환; iii) 94번 글라이신이 글루탐산으로 치환; iv) 115번 발린이 트레오닌으로 치환; v) 117번 발린이 페닐알라닌으로 치환; vi) 118번 글루탐산이 류신으로 치환; vii) 141번 알라닌이 리신으로 치환; 및 viii) 142번 히스티딘이 페닐알라닌으로 치환으로 구성된 군에서 선택되는 하나 또는 둘 이상의 아미노산 변이를 포함하는 것을 특징으로 하는, 프로그램된 세포사멸 단백질 1에 선택적으로 결합하는 폴리펩타이드에 관한 것이다.
본 발명에 있어서, 상기 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR 패밀리 단백질의 N-말단은 인터날린 단백질의 N-말단인 것을 특징으로 할 수 있고, 상기 인터날린 단백질은 바람직하게는 인터날린 A, 인터날린 B, 인터날린 C, 인터날린 H 및 인터날린 J로 이루어진 군에서 선택되는 것을 특징으로 할 수 있으며, 더욱 바람직하게는 인터날린 B 단백질인 것을 특징으로 할 수 있다.
본 발명의 용어 "인터날린 B 단백질"이란, 리스테리아 (Listeria) 균주에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 다른 소수성 코어가 전 분자에 걸쳐서 일정하게 분포되어 있는 다른 LRR 패밀리 단백질들과는 다른 유형의 N-말단 구조 때문에 미생물에서도 안정적으로 발현되는 것으로 알려져 있다. 이러한 인터날린 단백질의 N-말단은 반복 모듈의 접힘 (Folding)에 가장 중요한 N-말단 부위가 미생물 유래일 뿐 아니라 그 형태가 알파 나선을 포함하는 더욱 안정적인 구조를 포함하므로, 미생물에서 LRR 패밀리 단백질들의 안정적인 발현을 위하여 효과적으로 사용될 수 있다.
본 발명의 용어, "인터날린 단백질의 N-말단"은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 의미하며 알파 나선형 캡핑 모티프 (capping motif) 및 인터날린 단백질의 반복 모듈을 의미한다. 인터날린 단백질의 N-말단은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단은 제한 없이 포함되나, 그 예로 알파 나선형 캡핑 모티프인 "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE"(서열번호 7) 및 반복 모듈을 포함할 수 있다. 바람직하게 반복 모듈 패턴은 "LxxLxxLxLxxN" (서열번호 8)을 포함할 수 있다. 상기 반복 모듈 패턴 중 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌, x는 친수성 아미노산을 의미한다. 인터날린 단백질의 N-말단은 융합될 수 있는 LRR 패밀리 단백질의 종류에 따라 높은 구조 유사도를 갖는 N-말단이 선택될 수 있으며 결합 에너지 등의 계산을 통해 가장 안정적인 아미노산을 선택하여 해당 모듈의 아미노산의 변이가 가능하다.
본 발명의 용어 "가변 림프구 수용체 (Variable Lymphocyte Receptor, VLR)"란, 먹장어와 칠성 장어에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 먹장어와 칠성 장어에서 면역 기능을 수행하는 단백질로서 다양한 항원 물질에 결합할 수 있는 골격으로 유용하게 사용될 수 있다. 상기 인터날린 B 단백질의 N-말단 및 VLR 단백질이 융합된 폴리펩타이드는 인터날린 B 단백질이 융합되지 않은 VLR 단백질보다 수용성 및 발현양이 증가하므로, 이를 기반으로 한 신규한 단백질 치료제의 제조에 사용될 수 있다.
본 발명의 용어 "LRR (Leucine rich repeat) 단백질"이란, 루이신이 일정한 위치에 반복되는 모듈의 조합으로 이루어진 단백질을 의미하는 것으로, (i) 하나 이상의 LRR 반복 모듈을 갖고 있고, (ii) 상기 LRR 반복 모듈은 20 내지 30개의 아미노산으로 이루어져 있고, (iii) LRR 반복 모듈은 보존 패턴으로 "LxxLxxLxLxxN"을 갖고 있으며, 여기서 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 및 트립토판과 같은 소수성 아미노산을, N은 아스파라진, 글루타민, 세린, 시스테인 또는 쓰레오닌을, x는 모든 종류의 20가지의 아미노산을 의미하며, (iv) LRR 패밀리 단백질은 말발굽과 같은 삼차원 구조를 갖는 구조를 갖고 있는 단백질을 의미한다. 본 발명의 LRR 패밀리 단백질은 이미 그 서열이 알려져 있거나, 생체에서 새로 유도된 mRNA나 cDNA를 이용하여 찾아낸 것뿐 아니라, 컨센서스 디자인 (Consensus design) 등의 설계를 통하여 자연계에 알려지지 않은 서열을 가지면서 반복모듈의 골격 구조가 있는 변이체를 모두 포함할 수 있다.
본 발명의 용어 "리피바디 (Repebody)"란, LRR 구조를 갖는 상기 인터날린의 N-말단과 상기 VLR의 구조의 유사성을 바탕으로 융합하여 컨센서스 디자인으로 최적화시킨 폴리 폴리펩타이드이다. 리피바디 단백질은 구조상 오목한 지역 (Concave) 와 볼록한 지역 (Convex) 으로 나누어 질 수 있다. 여기서 오목한 지역은 서열의 다양성이 높으며 단백질 상호작용에 중요한 부위로 알려져 있다. 이와 반대로 볼록한 지역은 보존성이 높은 서열을 바탕으로 단백질의 전체구조를 안정하게 유지하는 역할을 수행한다. 리피바디 단백질은 반복 모듈을 갖는 LRR 패밀리에 속하는 모든 단백질을 상기 방법으로 수용성 발현 및 단백질의 생물리화학적 성질을 향상 시킨 모든 융합 LRR 패밀리 단백질을 모두 포함할 수 있다.
본 발명에 있어서, 상기 폴리펩타이드는 서열번호 3 또는 4의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 폴리펩타이드는 프로그램된 세포사멸 단백질 1 (programmed cell death protein 1)에 결합하여 그의 활성을 저해하는 것을 특징으로 할 수 있다.
본 발명은 다른 관점에서, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드에 관한 것이다.
본 발명에서 있어서, 상기 폴리뉴클레오타이드는 특별히 이에 제한되지 않으나, 상기 서열번호 3 내지 4 중 어느 하나의 아미노산 서열을 코딩하는 폴리뉴클레오타이드가 될 수 있고, 상기 폴리뉴클레오타이드와 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상의 상동성을 가지는 염기 서열을 가지는 폴리뉴클레오타이드일 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명은 또다른 관점에서, 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터에 관한 것이다.
본 발명의 용어 "벡터"는 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절 서열에 작동 가능하게 연결된 상기 목적 단백질을 암호화하는 폴리뉴클레오타이드의 염기서열을 함유하는 DNA 제조물을 의미한다. 상기 조절 서열은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 및 전사 및 해독의 종결을 조절하는 서열을 포함한다. 벡터는 적당한 숙주 내로 형질 전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 발명에서 사용되는 벡터는 숙주 중에서 복제 가능한 것이면 특별히 한정되지 않으며 당 업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 파지미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, λMBL3, λMBL4, λIXII, λASHII, λAPII, λt10, λt11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 본 발명에서 사용 가능한 벡터는 특별히 제한되는 것이 아니며 공지된 발현 벡터를 사용할 수 있다. 바람직하게는 pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a 벡터 등을 사용할 수 있다. 가장 바람직하게는 pET-21a, pET-32a 벡터를 사용할 수 있다.
본 발명은 다른 관점에서, 상기 폴리뉴클레오타이드 또는 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터가 도입되어 있는 재조합 미생물에 관한 것이다.
본 발명의 용어 "재조합 미생물"이란, 하나 이상의 목적 단백질을 암호화하는 유전자를 갖는 벡터가 숙주세포에 도입되어 목적 단백질을 발현시키도록 형질이 감염된 세포를 의미하며, 진핵세포, 원핵세포 등의 모든 세포가 될 수 있는데, 특별히 이에 제한되지 않으나, 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류 세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO, COS, NSO, 293, 보우 멜라노마 세포 등의 동물 세포; 또는 식물 세포가 될 수 있다. 본 발명에서 사용 가능한 숙주세포는 특별히 제한되는 것이 아니나, 바람직하게는 대장균을 숙주 세포로 사용할 수 있다. 가장 바람직하게는 대장균 BL21(DE3), OrigamiB(DE3)를 숙주 세포로 사용할 수 있다.
본 발명에서 용어 "형질전환"이란, 표적 단백질을 암호화하는 폴리뉴클레오타이드를 포함하는 벡터를 숙주 세포 내에 도입하여 숙주 세포 내에서 상기 폴리뉴클레오타이드가 암호화하는 단백질이 발현할 수 있도록 하는 것을 의미한다. 형질 전환된 폴리뉴클레오타이드는 숙주 세포 내에 발현될 수 있기만 한다면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하든지 상관없이 이들 모두를 포함한다. 또한, 상기 폴리뉴클레오타이드는 표적 단백질을 암호화하는 DNA 및 RNA를 포함한다. 상기 폴리뉴클레오타이드는 숙주세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로 도입되는 것이든 상관없다. 예를 들면, 상기 폴리뉴클레오타이드는, 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트 (Expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오타이드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결 신호, 리보좀 결합부위 및 번역 종결신호를 포함한다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오타이드는 그 자체의 형태로 숙주세포에 도입되어, 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있다.
본 발명은 또 다른 관점에서, (i) 상기 재조합 미생물을 배양하여 상기 폴리펩타이드를 발현시키는 단계; 및 (ii) 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 폴리펩타이드의 제조방법에 관한 것이다.
본 발명에 있어서, 상기 재조합 미생물을 배양하는 단계는 특별히 이에 제한되지 않으나, 공지된 회분식 배양방법, 연속식 배양방법, 유가식 배양방법 등에 의해 수행됨이 바람직하고, 배양조건은 특별히 이에 제한되지 않으나, 염기성 화합물(예: 수산화나트륨, 수산화칼륨 또는 암모니아) 또는 산성 화합물(예: 인산 또는 황산)을 사용하여 적정 pH(pH 5 내지 9, 바람직하게는 pH 6 내지 8, 가장 바람직하게는 pH 6.8)를 조절할 수 있고, 산소 또는 산소-함유 가스 혼합물을 배양물에 도입시켜 호기성 조건을 유지할 수 있으며, 배양온도는 20 내지 45℃, 바람직하게는 25 내지 40℃를 유지할 수 있고, 약 10 내지 160 시간동안 배양함이 바람직하다. 상기 배양에 의하여 생산된 상기 폴리펩타이드는 배지중으로 분비되거나 세포내에 잔류할 수 있다.
아울러, 사용되는 배양용 배지는 탄소 공급원으로는 당 및 탄수화물(예: 글루코오스, 슈크로오스, 락토오스, 프럭토오스, 말토오스, 몰라세, 전분 및 셀룰로오스), 유지 및 지방(예: 대두유, 해바라기씨유, 땅콩유 및 코코넛유), 지방산(예: 팔미트산, 스테아르산 및 리놀레산), 알콜(예: 글리세롤 및 에탄올) 및 유기산(예: 아세트산) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 질소 공급원으로는 질소-함유 유기 화합물(예: 펩톤, 효모 추출액, 육즙, 맥아 추출액, 옥수수 침지액, 대두 박분 및 우레아), 또는 무기 화합물(예: 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있으며; 인 공급원으로서 인산 이수소칼륨, 인산수소이칼륨, 이에 상응하는 나트륨 함유 염 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 기타 금속염(예: 황산마그네슘 또는 황산철), 아미노산 및 비타민과 같은 필수성장-촉진 물질을 포함할 수 있다.
본 발명의 상기 배양 단계에서 생산된 폴리펩타이드를 회수하는 방법은 배양방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 분야에 공지된 적합한 방법을 이용하여 배양액으로부터 목적하는 폴리펩타이드를 수집할 수 있다.
본 발명은 또 다른 관점에서, 상기 폴리펩타이드를 유효성분으로 함유하는 암 예방 또는 치료용 조성물에 관한 것이다.
본 발명에 있어서, 상기 암 예방 또는 치료는 상기 폴리펩타이드가 T 세포의 프로그램된 세포사멸 단백질 1과 결합하여 이루어지는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 암 예방 또는 치료는 상기 폴리펩타이드가 프로그램된 세포사멸 단백질 1과 결합하여 이루어지는 것을 특징으로 할 수 있다.
본 발명에서 용어 "암" 또는 "종양"은 신체 조직의 자율적인 과잉 성장에 의해 비정상적으로 자라난 덩어리를 의미하는 것이다. 본 발명에서의 암 또는 종양은, PD-L1을 발현하는 종류이면 모두 해당되나, 바람직하게는 비호지킨 림프종 (non-Hodgkin lymphoma), 호지킨 림프종 (non-Hodgkin lymphoma), 급성 골수성 백혈병 (acute-myeloid leukemia), 급성 림프구성 백혈병 (acute-lymphoid leukemia), 다발성 골수종 (multiple myeloma), 경부암 (head and neck cancer), 폐암, 비소세포폐암, 교모세포종 (glioblastoma), 대장/직장암, 췌장암, 유방암, 난소암, 악성 흑색종 (melanoma), 전립선암, 신장암 및 중피종 (mesothelioma)으로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 한정되는 것은 아니다.
본 발명은 또 다른 관점에서, 상기 폴리펩타이드 또는 이의 약학적으로 허용가능한 염을 투여하는 단계를 포함하는 암의 치료 또는 예방 방법에 관한 것이다.
본 발명은 또 다른 관점에서, 암의 치료 또는 예방을 위한 상기 폴리펩타이드 또는 이의 약학적으로 허용가능한 염의 용도에 관한 것이다.
본 발명은 또 다른 관점에서, 암의 치료 또는 예방용 약제 제조를 위한 상기 폴리펩타이드 또는 이의 약학적으로 허용가능한 염의 사용에 관한 것이다.
본 발명에 있어서, 상기 암 예방 또는 치료는 상기 폴리펩타이드가 T 세포의 프로그램된 세포사멸 단백질 1과 결합하여 이루어지는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 암 예방 또는 치료는 상기 폴리펩타이드가 프로그램된 세포사멸 단백질 1과 결합하여 이루어지는 것을 특징으로 할 수 있다.
본 발명에서 용어 "암" 또는 "종양"은 신체 조직의 자율적인 과잉 성장에 의해 비정상적으로 자라난 덩어리를 의미하는 것이다. 본 발명에서의 암 또는 종양은, PD-L1을 발현하는 종류이면 모두 해당되나, 바람직하게는 비호지킨 림프종 (non-Hodgkin lymphoma), 호지킨 림프종 (non-Hodgkin lymphoma), 급성 골수성 백혈병 (acute-myeloid leukemia), 급성 림프구성 백혈병 (acute-lymphoid leukemia), 다발성 골수종 (multiple myeloma), 경부암 (head and neck cancer), 폐암, 비소세포폐암, 교모세포종 (glioblastoma), 대장/직장암, 췌장암, 유방암, 난소암, 악성 흑색종 (melanoma), 전립선암, 신장암 및 중피종 (mesothelioma)으로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 한정되는 것은 아니다.
본 발명에서 용어 "치료"란 조성물의 투여로 암이나 그로부터 야기된 하나 또는 그 이상의 증상을 억제하거나 완화하는 것뿐만 아니라 질환의 증상을 반전시키는 암의 치료 또는 암의 진행을 방지하는 것을 의미한다. 본 발명에서 용어 "예방"이란 조성물의 투여로 암을 억제시키거나 발병을 지연시키는 모든 행위를 의미한다. 본 발명에서 암의 예방 또는 치료는 본 발명에서 확보한 폴리펩타이드가 프로그램된 세포사멸 단백질 1과 결합하여 이루어지는 것으로, 프로그램된 세포사멸 단백질 1에 결합하여 그의 활성을 유의하게 억제하여 암을 예방 또는 치료하는 것이다.
본 발명의 상기 폴리펩타이드를 유효성분으로 함유하는 암 예방 또는 치료용 조성물은 약학적으로 허용 가능한 담체를 추가로 포함할 수 있으며, 담체와 함께 제제화될 수 있다.
본 발명에서 용어, "약학적으로 허용 가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 허용되는 약제학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다.
본 발명의 상기 폴리펩타이드 및 약학적으로 허용 가능한 담체를 포함하는 암 예방 또는 치료용 조성물은 이를 유효성분으로 포함하는 어떠한 제형으로도 적용가능하며, 경구용 또는 비경구용 제형으로 제조할 수 있다. 본 발명의 약학적 제형은 구강(oral), 직장(rectal), 비강(nasal), 국소(topical; 볼 및 혀 밑을 포함), 피하, 질(vaginal) 또는 비경구(parenteral; 근육내, 피하 및 정맥내를 포함) 투여에 적당한 것 또는 흡입 (inhalation) 또는 주입(insufflation)에 의한 투여에 적당한 형태를 포함한다.
본 발명의 조성물을 유효성분으로 포함하는 경구 투여용 제형으로는, 예를 들어 정제, 트로키제, 로렌지, 수용성 또는 유성현탁액, 조제분말 또는 과립, 에멀젼, 하드 또는 소프트 캡슐, 시럽 또는 엘릭시르제로 제제화할 수 있다. 정제 및 캡슐 등의 제형으로 제제화하기 위해, 락토오스, 사카로오스, 솔비톨, 만니톨, 전분, 아밀로펙틴, 셀룰로오스 또는 젤라틴과 같은 결합제, 디칼슘 포스페이트와 같은 부형제, 옥수수 전분 또는 고구마 전분과 같은 붕괴제, 스테아르산 마스네슘, 스테아르산 칼슘, 스테아릴푸마르산 나트륨 또는 폴리에틸렌글리콜 왁스와 같은 윤활유를 포함할 수 있으며, 캡슐제형의 경우 상기 언급한 물질 외에도 지방유와 같은 액체 담체를 더 함유할 수 있다.
본 발명의 조성물을 유효성분으로 포함하는 비경구 투여용 제형으로는, 피하주사, 정맥주사 또는 근육내 주사 등의 주사용 형태, 좌제 주입방식 또는 호흡기를 통하여 흡입이 가능하도록 하는 에어로졸제 등 스프레이용으로 제제화할 수 있다. 주사용 제형으로 제제화하기 위해서는 본 발명의 조성물을 안정제 또는 완충제와 함께 물에서 혼합하여 용액 또는 현탁액으로 제조하고, 이를 앰플 또는 바이알의 단위 투여용으로 제제화할 수 있다. 좌제로 주입하기 위해서는, 코코아버터 또는 다른 글리세라이드 등 통상의 좌약 베이스를 포함하는 좌약 또는 관장제와 같은 직장투여용 조성물로 제제화할 수 있다. 에어로졸제 등의 스프레이용으로 제형화하는 경우, 수분산된 농축물 또는 습윤 분말이 분산되도록 추진제 등이 첨가제와 함께 배합될 수 있다.
본 발명은 또다른 관점에서, 상기 폴리펩타이드를 유효성분으로 함유하는 암 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 암을 예방 또는 치료하는 방법에 관한 것이다.
본 발명에서 용어, "투여"는 어떠한 적절한 방법으로 환자에게 본 발명의 약제학적 조성물을 도입하는 것을 의미한다. 본 발명의 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 경구 또는 비경구의 다양한 경로를 통하여 투여될 수 있으며, 구체적으로, 구강, 직장, 국소, 정맥내, 복강내, 근육내, 동맥내, 경피, 비측내, 흡입, 안구 내 또는 피내경로를 통해 통상적인 방식으로 투여될 수 있다.
본 발명의 치료방법은 본 발명의 암 예방 또는 치료용 조성물을 약학적 유효량으로 투여하는 것을 포함한다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있다는 것은 당업자에게 자명한 일이다. 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다. 따라서 본 발명의 목적에 적합한 암의 예방 또는 치료용 조성물의 유효량은 전술한 사항을 고려하여 결정하는 것이 바람직하다.
또한, 본 발명의 치료 방법은 프로그램된 세포사멸 단백질 1의 과도한 활성으로 인하여 종양 발달과 신생혈관생성 등의 질병이 발생할 수 있는 임의의 동물에 적용가능하며, 동물은 인간 및 영장류뿐만 아니라, 소, 돼지, 양, 말, 개 및 고양이 등의 가축을 포함한다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시 예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 범위가 이들 실시 예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1: 단백질 구조 기반의 리피바디 라이브러리 구축
리피바디는 자연계에 존재하는 LRR 단백질들과 마찬가지로 보존된 루이신 서열을 갖는 반복 단위체 (Repeat unit)가 연속적으로 연결되어 전체 단백질 구조를 유지하는 모듈성과 전체 구조의 모양의 곡률로 인한 오목한 지역 (concave region)과 볼록한 지역 (convex region)으로 구별되는 구조적 특징을 갖는다. 상기 오목한 지역에는 항체의 상보결정지역 (complementarity determining region; CDR)처럼 초가변영역 (hypervariable region)이 위치하여, 단백질-단백질 상호작용을 매개한다. 또한, 볼록한 지역은 잘 보존되어 있는 서열을 바탕으로 LRR의 전체 구조를 유지하는데 중요한 역할을 한다. 이러한 리피바디의 단백질 구조를 분석하여 하기와 같은 방식으로 무작위적인 라이브러리를 설계하였다.
구체적으로, 아민기말단 방향에 위치한 연속적인 두 개의 모듈 (LRRV2, LRRV3 module)의 오목한 지역에 위치하는 여섯 아미노산 잔기 91, 93, 94, 115, 117, 118번을 선택하여 무작위적인 돌연변이 라이브러리를 구축하였다(도 1).
그런 다음, 상기 선택한 아미노산을 NNK 동의코돈 (degenerate codon)으로 치환하도록, 라이브러리 구축을 위한 돌연변이 유발 프라이머 (mutagenic primer)를 합성하였다. 프라이머 서열은 아래와 같다.
서열번호 5 M1: CTG CCG AAT GGC GTC TTT GAT AAA CTG ACG AAC CTG AAA GAA CTG NNK CTG NNK NNK AAT CAA CTG CAG TCT CTG CCG GAC
서열번호 6 M2: CGT CAG TTT ATC AAA GAC GCC ATT CGG CAG GCT CTG CAG TTG GTT MNN MNN CAG MNN CAG ATA CGT CAG ATT GGT CAG TTC
이어, 상기 프라이머들을 이용하여 두 모듈에 대한 겹침 중합효소 연쇄 반응 (overlap PCR)을 수행하며 라이브러리 DNA를 수득하고, 본 발명자의 선행 특허 (대한민국 등록특허 제1,356,075호)에 기술된 서열번호 2의 파지미드 pBEL118M에 삽입하여 최종적인 라이브러리 파지미드를 확보하였다.
상기 확보된 라이브러리를 전기천공법 (electroporation)으로 대장균 TG-1에 도입하여 형질전환체를 수득함으로써, 2.0x108 수준의 다양성을 갖는 라이브러리를 구축하였다.
실시예 2: 무작위적인 파지 라이브러리를 통한 PD-1과 특이적으로 결합하는 폴리펩타이드 선별
실시예 2-1: 리피바디 라이브러리의 패닝 과정을 통한 PD-1과 결합하는 폴리펩타이드 선별
실시예 1에서 구축한 라이브러리를 사용하여 PD-1에 결합할 수 있는 폴리펩타이드를 선별하여 정제하였다. PD-1과 결합할 수 있는 후보를 선별하기 위하여, 바이오틴화된 PD-1을 스트렙타비딘-컨주게이트 된 마그네틱 비드 (streptavidin-conjugated magnetic beads)에 10 ㎍/㎖의 농도로 가하고, 상온에서 30분 동안 결합 반응시킨 후 PBS로 3회 세척시켰다. 상기 PD-1이 결합 된 마그네틱 비드 및 음성 선택 (negative selection) 용 마그네틱 비드를 1% BSA와 0.05% Tween 20을 포함하는 PBS 용액 (TPBSA)으로 상온에서 1시간동안 블로킹 (Blocking) 하였다. 그런 다음, 상기 정제된 파지를 1012 cfu/ml의 농도로 먼저 음성 선택용 마그네틱 비드에 가하여 상온에서 1시간 반응시킨 후 마그네틱 비드에 무작위적으로 결합하는 파지를 제거하였다. 이 후 상층액에 존재하는 파지만을 상기 PD-1이 결합 된 마그네틱 비드에 가해 상온에서 1시간 반응시켰다. 반응이 종료된 후, 0.05% Tween 20을 포함하는 PBS 용액 (TPBS)으로 총 1분간 5번씩 및 세척 후 PBS로 1번 세척하였다. 마지막으로, 1 ml의 0.2M Glycine-HCl (pH 2.2)를 상기 면역튜브에 가하고, 상온에서 10분간 반응시킴으로써, PD-1과 결합할 수 있는 리피바디 후보를 표면에 발현시킨 파지를 용출시켰다. 상기 용출액에 100 ㎕의 1.0M Tris-HCl (pH 9.0)를 가하여 중화시키고, 숙주세포인 8.9 ml 대장균 TG-1 용액 (OD600 = 0.5)에 가한 다음, 2xYT 플레이트에 도말하는 바이오패닝 (Bio-panning) 과정을 동일하게 5회 반복하여 수행하였다. 그 결과, 각 패닝 과정을 통해 PD-1과 특이적으로 결합하는 파지가 농축됨을 확인하였다. 상기 결과는 PD-1과 결합하는 라이브러리 파지가 특이적으로 증가함을 의미하는 것으로 분석되었다.
실시예 2-2: 선별된 리피바디의 PD-1에 대한 특이적인 결합여부 확인 및 서열 분석
상기 실시예 2-1의 방법을 통하여 선별된 파지를 PD-1과 BSA가 코팅된 96-웰 플레이트를 이용하여 효소결합 면역침강법 (Enzyme-linked immunosorbent assay, ELISA)을 수행하였다. BSA 대비 PD-1의 흡광도(OD450)가 4.9배 이상 높은 10개의 리피바디 후보들을 선별하고, 이들 각각의 아미노산 서열을 확인한 결과, 상기 선별된 파지에서 얻어진 리피바디 클론들이 모두 동일한 서열을 가진 것을 확인하였다(서열번호 3). 선별된 A1 리피바디는 91번 아미노산인 이소류신이 아스파라긴으로 치환되고, 93번 트레오닌이 트립토판으로 치환되며, 94번 글라이신이 글루탐산으로 치환되고, 115번 발린이 트레오닌으로 치환되며, 117번 발린이 페닐알라닌으로 치환되고, 118번 글루탐산은 류신으로 치환되었음을 확인하였다. 상기 선별된 A1 리피바디의 PD-1에 대한 해리상수를 등온열량측정법 (ITC)을 통해 측정한 결과 617 nM 수준의 결합력을 가지는 것을 확인하였다(도 2).
실시예 3: 모듈 기반 방법을 이용한 리피바디의 PD-1에 대한 결합력 증대 수행
본 발명에서 기술된 모듈 기반 친화력 증대 방식은 선행특허(KR2012-0019927)에 따라 수행하였다. 해당 방법은 반복 모듈을 갖는 단백질에 대해 보편적으로 사용할 수 있는 기술로써, 본 특허에서 성공적으로 재현되어 높은 수준의 친화력을 갖는 단백질 설계를 가능하게 하였다.
실시예 3-1: 모듈을 이용한 추가적인 라이브러리 구축 및 결합력 증가 확인 및 다른 단백질에 대한 교차결합여부 확인
상기 선행특허(KR2012-0019927)에서 사용한 모듈을 이용한 추가적인 라이브러리 구축방법을 이용하여 결합력이 향상된 돌연변이체를 개발하고자 하였다.
구체적으로 모듈 기반 친화력 증대를 위한 라이브러리는 LRRV4 모듈의 총 4개 아미노산 잔기인 137번, 139번, 141번 및 142번 아미노산을 돌연변이 시킨 것으로 이 라이브러리로부터 총 3번의 패닝과정을 거쳐서 결합력이 증대된 리피바디 G9 클론을 확보하였다(서열번호 4).
G9 클론은 서열번호 1의 DNA로부터 코딩되는 아미노산에서 91번 아미노산인 이소류신이 아스파라긴으로 치환되고, 93번 트레오닌이 트립토판으로 치환되며, 94번 글라이신이 글루탐산으로 치환되고, 115번 발린이 트레오닌으로 치환되며, 117번 발린이 페닐알라닌으로 치환되고, 118번 글루탐산은 류신으로 치환되고, 141번 알라닌이 리신으로, 142번 히스티딘이 페닐알라닌으로 치환되었음을 확인하였다.
선별된 G9 리피바디의 해리상수를 등온열량측정법을 통해 측정한 결과, 17 nM 수준의 높은 결합력을 지니는 것을 확인하였다(도 3).
상기 선별된 G9 리티바디가 특이적으로 사람의 PD-1에만 강한 결합력을 보이는지 확인하기 위해 사람의 PD-1과 유사한 서열 및 구조를 지닌 다른 단백질과 교차결합 여부를 확인하는 실험을 수행하였다. 교차 결합 여부를 확인하기 위한 다른 단백질로는 사람의 PD-1과 구조적으로 동일하고 60% 이상의 아미노산 서열 상동성을 가지는 쥐의 PD-1 단백질 및 사람과 쥐의 PD-1의 수용체 (PD-L1)을 각각 사용하였다.
사람과 쥐의 PD-1, PD-L1 단백질을 96-웰 플레이트에 코팅 후 G9 리피바디를 가하여 결합 정도를 효소결합 면역침강법 (ELISA)을 수행하여 확인한 결과, 선별된 G9 리피바디는 사람의 PD-1 에만 특이적으로 결합하는 것을 확인할 수 있었다(도 4).
이러한 결과를 통해 본 발명자들은, 사람의 PD-1에 높은 결합력을 갖는 리피바디를 성공적으로 확보하였으며, 이는 PD-1에 특이적인 결합력을 갖는 폴리펩타이드임을 확인하였다.
실시예 4: 선별된 리피바디의 항원결정부위 확인
PD-1에 결합하는 리피바디 중 PD-1이 PD-1 수용체인 PD-L1과 상호작용하는 부위에 결합하는 리피바디를 선별하는 것은 매우 중요하다. 현재 항 PD-1 단클론항체는 상기 부위에 결합하여 PD-1이 PD-1 수용체와 상호작용하지 못하게 함으로써 PD-1의 활성을 효과적으로 억제하여 높은 치료 효능을 나타내고 있다.
이러한 배경 하에, 상기 최종적으로 확보된 G9 리피바디가 PD-1과 PD-L1의 상호작용을 억제할 수 있는지를 경쟁적 효소결합 면역침강법 (competitive ELISA)를 수행하였다. 구체적으로, PD-1을 코팅한 플레이트에 리피바디와 수용성 PD-L1(soluble PD-L1)을 동시에 첨가하여 리피바디의 경쟁적 결합으로 인해 PD-1에 결합한 PD-L1의 양이 감소하는지 여부를 확인하고자 하였다.
그 결과, 선별된 G9 리피바디를 처리한 경우에만 PD-L1의 신호가 감소하는 것을 확인하여, G9 리피바디의 항원결정부위가 PD-1이 PD-1 수용체와 상호작용하는 부위임을 확인할 수 있었다(도 5).
실시예 5: 선별된 리피바디의 PD-1 신호 전달 억제 가능성 분석
PD-L1과 결합한 PD-1은 인산화되면서 SHP2라는 포스파타아제를 끌어들여 T 세포를 활성화시키는 신호 전달 경로를 차단하는 것으로 알려져 있다. 선별한 G9 리피바디는 PD-1과 단순히 특이적으로 결합할 뿐만 아니라 PD-L1의 상호작용을 막아 PD-1 신호 전달을 차단함으로써, 결과적으로는 T 세포를 활성화시키는 역할을 수행해야 한다.
이를 확인하기 위해 사람의 혈액으로부터 얻어진 T 세포와 동종이계 수지상세포를 섞어 면역반응을 유도한 뒤에 처리한 G9 리피바디에 의해 활성화된 T 세포가 사이토카인인 인터류킨-2 (Interleukin-2 (IL-2))와 인터페론-감마(Interferon-gamma (IFN-γ))를 생성 및 분비하는지 실험하였다.
구체적으로 실험을 위해 건강한 사람의 혈액을 제공받아 (KAIST 생명윤리심의위원회의 허가를 얻어 피험자를 모집 후 카이스트 클리닉에서 채혈을 통해 직접 공여받음) 혈액으로부터 말초 혈액 단핵세포 (peripheral blood mononuclear cell, PBMC)를 분리하였다. 말초 혈액 단핵세포는 피콜 (Ficoll)과 원심분리를 이용하여 분리하였다. 말초 혈액 단핵세포에서 T 세포만을 특이적으로 분리해 주는 키트(Dynabeads CD4 positive isolation kit, Invitrogen, 미국)를 사용하여 T 세포만을 따로 얻었다.
한편으로는 다른 혈액 공여자로부터 얻은 혈액에서 상기와 동일한 방법으로 말초 혈액 단핵세포를 분리하여 이로부터 단핵구를 특이적으로 분리해 주는 키트 (Monocyte isolation kit Ⅱ, Miltenyi Biotec, 독일)를 사용하여 단핵구를 분리하였다. 분리한 단핵구에 과립구 대식구 집락 자극인자 (GM-CSF), 인터류킨-4, 종양 괴사 인자 알파 (tumor necrosis factor-alpha, TNF-α)와 같은 사이토카인을 처리하여 수지상세포로의 분화를 유도하였다.
수득한 T 세포 1×105 개와 동종이계 수지상세포 1×104개를 96-웰 세포 배양용 플레이트에 혼합 배양하여 혼합 림프구 반응 (Mixed lymphocyte reaction (MLR)) 실험을 수행하였다. 각각의 웰 (well)에는 리피바디를 농도별로 처리하여, 5일간 배양 후 상층액에 존재하는 사이토카인의 양을 효소결합 면역침강법으로 측정하였다.
그 결과, G9 리피바디를 함께 처리하였을 때 T 세포 활성화의 지표가 되는 인터류킨-2와 인터페론 감마의 양이 처리한 G9 리피바디의 농도에 비례하여 증가함을 확인할 수 있었다(도 6, 도 7).
실시예 6: 선별된 리피바디의 마우스 모델에서의 암세포 성장 억제 능력 확인
선별한 리피바디가 몸 안에서 T 세포의 PD-1에 결합하여 T 세포를 활성화시켜 실제로 암세포를 죽이도록 하는지 확인하기 위해 면역이 결핍된 마우스 모델을 이용하여 in vivo 실험을 수행하였다. NCI-H292 암 세포주(한국 세포주 은행) 2×106 개와 사람의 말초 혈액 단핵세포 5×105개를 BD Matrigel Matrix와 혼합하여 총 100μl 부피로 준비한 후, 6-8주령의 암컷 NOD/ShiLtJ-Rag2em1AMC Il2rgem1AMC (NRGA) 마우스(중아 바이오)의 오른쪽 옆구리 부위에 피하주사로 주입하였다. 이식 후 하루가 지난 후부터 리피바디를 10 mg/kg 용량으로 복강주사 하였다. 리피바디는 이식 후 1일차, 3일차, 7일차, 10일차에 총 4회 투여하였고 대조군으로 오프타겟 리피바디를 주입한 그룹과 DPBS만 주입한 그룹을 설정하였다. 마우스의 종양 크기를 이식 후 일주일 후부터 3-4일에 한 번씩 캘리퍼스로 측정하였다. 종양의 부피는 다음과 같은 공식으로 계산하였다.
종양의 부피 (V) = (종양 넓이(W)2 × 종양 길이 (L))/2 (mm3).
그 결과, G9 리피바디를 투여한 마우스 그룹에서 종양이 자라는 것이 억제됨을 확인하였다. 또한 이 효과가 31일까지 유지되는 것을 확인할 수 있었다(도 8, 도 9)
본 발명의 PD-1에 결합하는 신규한 폴리펩타이드는 PD-1에 특이적으로 결합할 뿐만 아니라, 그의 활성을 억제하여 면역 T 세포의 활성을 유도할 수 있으므로 PD-1과 연관된 다양한 질환의 면역 치료제의 개발에 유용하다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
전자파일 첨부하였음.

Claims (13)

  1. 알파 나선형 캡핑 모티프(capping mofit)를 가지는 LRR(Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 프로그램된 세포사멸 단백질 1(programmed cell death protein 1, PD-1)에 선택적으로 결합하는 폴리펩타이드로, 서열번호 2로 표시되는 아미노산 서열에서 하기의 군으로부터 선택되는 하나 또는 둘 이상의 아미노산 변이를 포함하는 것을 특징으로 하는, 프로그램된 세포사멸 단백질 1에 선택적으로 결합하는 폴리펩타이드:
    i) 91번 이소류신이 아스파라긴으로 치환;
    ii) 93번 트레오닌이 트립토판으로 치환;
    iii) 94번 글라이신이 글루탐산으로 치환;
    iv) 115번 발린이 트레오닌으로 치환;
    v) 117번 발린이 페닐알라닌으로 치환;
    vi) 118번 글루탐산이 류신으로 치환;
    vii) 141번 알라닌이 리신으로 치환; 및
    viii) 142번 히스티딘이 페닐알라닌으로 치환.
  2. 제1항에 있어서, 상기 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR 패밀리 단백질의 N-말단은 인터날린 단백질의 N-말단인 것을 특징으로 하는, 프로그램된 세포사멸 단백질 1에 선택적으로 결합하는 폴리펩타이드.
  3. 제2항에 있어서, 상기 인터날린 단백질은 인터날린 A, 인터날린 B, 인터날린 C, 인터날린 H 및 인터날린 J로 이루어진 군에서 선택되는 것을 특징으로 하는, 프로그램된 세포사멸 단백질 1에 선택적으로 결합하는 폴리펩타이드.
  4. 제3항에 있어서, 상기 인터날린 단백질은 인터날린 B 단백질인 것을 특징으로 하는, 프로그램된 세포사멸 단백질 1에 선택적으로 결합하는 폴리펩타이드.
  5. 제1항에 있어서, 상기 VLR 단백질의 변형된 반복모듈은 하기의 반복 모듈 패턴을 포함하는 것을 특징으로 하는, 프로그램된 세포사멸 단백질 1에 선택적으로 결합하는 폴리펩타이드:
    LxxLxxLxLxxN
    상기 패턴에서,
    L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판이고;
    N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌이며 및
    x는 모든 종류의 20개의 아미노산이다.
  6. 제1항에 있어서, 상기 폴리펩타이드는 서열번호 3 또는 4의 아미노산 서열로 표시되는 것을 특징으로 하는, 프로그램된 세포사멸 단백질 1에 선택적으로 결합하는 폴리펩타이드.
  7. 제1항에 있어서, 상기 폴리펩타이드는 프로그램된 세포사멸 단백질 1에 결합하여 그의 활성을 저해하는 것을 특징으로 하는 폴리펩타이드.
  8. 제1항의 폴리펩타이드를 코딩하는 폴리뉴클레오타이드.
  9. 제8항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
  10. 제9항의 재조합 벡터가 도입되어 있는 재조합 미생물.
  11. 다음의 단계를 포함하는 프로그램된 세포사멸 단백질 1에 특이적으로 결합하는 폴리펩타이드의 제조방법:
    (i) 제10항의 재조합 미생물을 배양하여 제1항의 폴리펩타이드를 발현시키는 단계; 및
    (ii) 상기 배양된 재조합 미생물 또는 배양물로부터 제1항의 폴리펩타이드를 회수하는 단계.
  12. 제1항 내지 제7항의 폴리펩타이드를 유효성분으로 함유하는 암 예방 또는 암 치료용 조성물.
  13. 제12항에 있어서, 상기 암은 비호지킨 림프종 (non-Hodgkin lymphoma), 호지킨 림프종 (non-Hodgkin lymphoma), 급성 골수성 백혈병 (acute-myeloid leukemia), 급성 림프구성 백혈병 (acute-lymphoid leukemia), 다발성 골수종 (multiple myeloma), 경부암 (head and neck cancer), 폐암, 비소세포폐암, 교모세포종 (glioblastoma), 대장/직장암, 췌장암, 유방암, 난소암, 악성 흑색종 (melanoma), 전립선암, 신장암 및 중피종 (mesothelioma)으로 구성된 군에서 선택되는 것을 특징으로 하는 암 예방 또는 치료용 조성물.
PCT/KR2020/011193 2019-08-23 2020-08-21 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 WO2021040336A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/637,377 US20220315662A1 (en) 2019-08-23 2020-08-21 Novel polypeptide selectively binding to human programmed cell death protein (pd-1) and use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020190103737A KR102231974B1 (ko) 2019-08-23 2019-08-23 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
KR10-2019-0103737 2019-08-23

Publications (1)

Publication Number Publication Date
WO2021040336A1 true WO2021040336A1 (ko) 2021-03-04

Family

ID=74683838

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2020/011193 WO2021040336A1 (ko) 2019-08-23 2020-08-21 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도

Country Status (3)

Country Link
US (1) US20220315662A1 (ko)
KR (1) KR102231974B1 (ko)
WO (1) WO2021040336A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20130098089A (ko) * 2012-02-27 2013-09-04 한국과학기술원 인터루킨-6와 결합할 수 있는 신규한 폴리펩타이드
US20140088292A1 (en) * 2011-03-22 2014-03-27 Korea Advanced Institute Of Science And Technology Water-Soluble Polypeptides Comprised of Repeat Modules, Method for Preparing the Same and Method for a Target-Specific Polypeptide and Analysis of Biological Activity Thereof
KR20150135700A (ko) * 2014-05-23 2015-12-03 한국과학기술원 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드
KR20170069996A (ko) * 2014-08-05 2017-06-21 맵퀘스트 에스아 Pd-1 에 결합하는 면역학적 시약

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140088292A1 (en) * 2011-03-22 2014-03-27 Korea Advanced Institute Of Science And Technology Water-Soluble Polypeptides Comprised of Repeat Modules, Method for Preparing the Same and Method for a Target-Specific Polypeptide and Analysis of Biological Activity Thereof
KR20130098089A (ko) * 2012-02-27 2013-09-04 한국과학기술원 인터루킨-6와 결합할 수 있는 신규한 폴리펩타이드
KR20150135700A (ko) * 2014-05-23 2015-12-03 한국과학기술원 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드
KR20170069996A (ko) * 2014-08-05 2017-06-21 맵퀘스트 에스아 Pd-1 에 결합하는 면역학적 시약

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
SUMIN SON, HYO-DEOK SEO, HAK-SUNG KIM: "Development of Human PD‐1 Specific Repebody for Cancer Immunotherapy", 2019 KSBB SPRING MEETING; APRIL 10-12, 2019, April 2019 (2019-04-01), pages 407, XP009526446 *

Also Published As

Publication number Publication date
US20220315662A1 (en) 2022-10-06
KR20210023485A (ko) 2021-03-04
KR102231974B1 (ko) 2021-03-25

Similar Documents

Publication Publication Date Title
AU2018372167B2 (en) Partial agonists of interleukin-2
AU676891B2 (en) Pharmaceutical containing the P40 subunit of interleukin 12
JP7359700B2 (ja) Ｃｄ３８抗体薬物コンジュゲート
EA013614B1 (ru) Изолированное антитело к фактору роста нервов (ngf) и способы его применения
CN109021069A (zh) 调节γ-C-细胞因子活性的组合物及方法
KR102640463B1 (ko) 피리미딘 화합물 또는 그 염
KR20210118764A (ko) 암의 예방 또는 치료용 약학적 조성물
WO2015178689A1 (ko) 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드
JP2001503265A (ja) 新規なｆｌｔ３受容体アゴニスト
WO2013129852A1 (ko) 신규한 인터루킨-6에 대한 리피바디 및 그 용도
WO2021040336A1 (ko) 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
WO2020085766A1 (ko) 인간 혈장 알부민에 특이적으로 결합하는 신규한 폴리펩티드 및 이의 용도
WO2016027990A1 (ko) Ｄｕｓｐ５를 유효성분으로 모두 포함하는 골대사성 질환의 예방 또는 치료용 약학적 조성물
KR101517196B1 (ko) 신규한 인터루킨-6 결합 폴리펩타이드 및 이의 용도
WO2016204341A1 (ko) 신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도
JPH07503128A (ja) ヒト毛様体ニューロン親和性因子の先端欠失型および突然変異タンパク質型の合成と精製
WO2021158092A2 (ko) 보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도
WO2019164358A1 (ko) 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
KR101950035B1 (ko) 세포투과성을 갖는 ｒ12 -ｐｉａｓ3 융합 펩타이드 및 이를 유효성분으로 함유하는 면역질환의 예방 또는 치료용 조성물
KR102280725B1 (ko) 인간 b 세포 림프종-2 단백질에 선택적으로 결합하는 신규한 폴리펩타이드 및 이의 용도
WO1998052972A1 (fr) Nouvelle proteine, son gene, reactifs induisant l'apoptose et agents anticancereux
KR100791996B1 (ko) 미엘린 염기성 폴리펩타이드를 분비하는 형질전환 미생물을함유하는 자가면역질환 치료용 조성물
KR102582417B1 (ko) 인플라마솜 어댑터 단백질(asc)의 중합체화 도메인에 결합하는 신규한 폴리펩타이드 및 이의 용도
KR102690857B1 (ko) 제2형 중증급성호흡기증후군 코로나바이러스의 수용체 결합 도메인 (SARS-CoV2 RBD)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
WO2022270946A1 (ko) 세포내 면역 반응의 억제를 통한 목적 단백질의 발현 향상용 재조합 벡터 및 이의 응용

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20855918

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 20855918

Country of ref document: EP

Kind code of ref document: A1