WO2021158092A2 - 보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도 - Google Patents

보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도 Download PDF

Info

Publication number
WO2021158092A2
WO2021158092A2 PCT/KR2021/001646 KR2021001646W WO2021158092A2 WO 2021158092 A2 WO2021158092 A2 WO 2021158092A2 KR 2021001646 W KR2021001646 W KR 2021001646W WO 2021158092 A2 WO2021158092 A2 WO 2021158092A2
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
protein
complement
internalin
present
Prior art date
Application number
PCT/KR2021/001646
Other languages
English (en)
French (fr)
Other versions
WO2021158092A3 (ko
Inventor
김학성
손유경
손수민
Original Assignee
한국과학기술원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한국과학기술원 filed Critical 한국과학기술원
Publication of WO2021158092A2 publication Critical patent/WO2021158092A2/ko
Publication of WO2021158092A3 publication Critical patent/WO2021158092A3/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • the present invention relates to a novel polypeptide that selectively binds to the complement proteolytic product C3a, and more particularly, the present invention relates to a polypeptide capable of inhibiting its activity by binding to the human complement proteolytic product C3a, the polypeptide encoding the polypeptide It relates to a polynucleotide, a recombinant vector comprising the polynucleotide, a recombinant microorganism into which the recombinant vector is introduced, a method for producing the polypeptide using the recombinant microorganism, and a therapeutic pharmaceutical composition comprising the polypeptide.
  • the present inventors have successfully developed a repebody, a non-antibody protein scaffold, that can replace the existing antibody.
  • Lipibody is 1/5 the size of an antibody and is mass-produced in E. coli, and has little immunogenicity as a result of animal experiments. It has been demonstrated that the thermal and pH stability is very good, the binding force to the target can be very easily increased to the pico-mole level, and the specificity to the target is very excellent.
  • Complement proteolysis product C3a is an important mediator between the innate immune system and the adaptive immune system and is known to be a trigger of inflammatory response-based immune-related diseases such as asthma, rheumatoid arthritis, and lupus.
  • it is well known as a target material for the development of a treatment for sepsis and asthma, which is caused by an excessive inflammatory reaction in the body as invaders such as bacteria infect and reproduce in the blood.
  • Sepsis is known as a major cause of morbidity and mortality in ICU worldwide, and 750,000 sepsis occur every year in the United States, and although there are no accurate statistics in Korea, the incidence rate is very high.
  • Repebody that can specifically bind to various proteins (Korean Patent Nos. 10-1356075, 10-1654890, 10-1587622, 10-1624702) , No. 10-1624703, No. 10-1713944, No. 10-1751501, No. 10-1818152 and No. 10-1875809), specific binding to various disease-related target proteins using the repeat body backbone
  • the present inventors made diligent efforts to successfully secure a protein that specifically binds to the complement protein degradation product C3a, which is known to be closely related to various immune diseases, using the repeat body skeleton.
  • the structural characteristics of the repeat body Based on the random mutation library constructed through in-modularity and overall structural analysis, novel proteins with specific binding affinity to the complement protein degradation product C3a are selected, and the binding power is improved through the repeat module-based affinity enhancement method.
  • An object of the present invention is a repeat body (Repebody) that specifically binds to the complement protein degradation product C3a; a polynucleotide encoding the repeat body; a recombinant vector comprising the polynucleotide; a recombinant microorganism into which the recombinant vector is introduced; And to provide a method for producing the repeat body using the recombinant microorganism.
  • Another object of the present invention is to provide a double-binding repebody (bispecific repebody) in which a repeati body specifically binding to vascular endothelial growth factor (VEGF) is fused to the repeati body.
  • VEGF vascular endothelial growth factor
  • Another object of the present invention comprises administering a composition for preventing or treating an immune disease containing the repeati body or double-bonded repeat-body and a composition for preventing or treating an immune disease containing the repeat-body or double-bonded repeati-body, To provide a method for preventing or treating an immune disease.
  • the present invention provides an N-terminus of Leucine rich repeat (LRR) family proteins having an alpha helical capping motif and a modified repeat module of VLR (Variable Lymphocyte Receptor) protein and C of VLR protein - a polypeptide that selectively binds to the fused end of the complement proteolytic product C3a, i) threonine at position 88 is substituted with methionine; ii) replacement of isoleucine at position 91 with leucine; iii) threonine at position 93 is replaced with methionine; iv) glycine at position 94 is replaced with proline; v) serine 99 is replaced with isoleucine; vi) substitution of valine 116 with tryptophan; vii) substitution of glutamic acid at position 117 with histidine;
  • LRR Leucine rich repeat
  • the present invention also provides a polynucleotide encoding the polypeptide and a recombinant vector comprising the polynucleotide.
  • the present invention also provides a recombinant microorganism containing the recombinant vector.
  • the present invention also provides a method for producing a polypeptide comprising the steps of culturing the recombinant microorganism to express the polypeptide, and recovering the polypeptide from the cultured recombinant microorganism or culture.
  • the present invention also provides a bispecific repebody in which a polypeptide that specifically binds to the complement protein degradation product C3a and a repeatibody that specifically binds to vascular endothelial growth factor (VEGF) are fused. .
  • VEGF vascular endothelial growth factor
  • the present invention also provides a composition for preventing or treating immune diseases containing the polypeptide or double-bonded repeater body as an active ingredient.
  • the present invention also provides the use of a composition for preventing or treating an immune disease containing the polypeptide or double-bond repeater body as an active ingredient for preventing or treating an immune disease.
  • the present invention also provides a method for preventing or treating an immune disease, comprising administering a composition for preventing or treating an immune disease containing the repeat body or the double bond repeat body.
  • 1 shows the amino acid residues present in the LRRV2 module and the LRRV3 module, from which the first library was constructed to initially select a polypeptide for the complement proteolysis product C3a.
  • the binding signal by enzyme immunoassay (ELISA) for the complement protein degradation product C3a compared to BSA was averaged (Normalization), and at this time, it was defined as a repeat body clone having a specific binding affinity for a clone with a signal increased by 8 times or more.
  • ELISA enzyme immunoassay
  • Figure 4 shows amino acid residues present in the LRRV4 module in which a second library was constructed based on H12, which is a clone that was primarily selected to increase binding affinity.
  • FIG. 5 is a result of bio-panning of phage display using the second library.
  • the binding signal by enzymatic immunoassay (ELISA) for the complement protein degradation product C3a compared to BSA was averaged (Normalization), and at this time, the clone with a 10-fold or more increase in signal was defined as a repeater body clone with increased binding affinity.
  • ELISA enzymatic immunoassay
  • FIG. 7 shows amino acid residues present in the LRR1 and LRRV1 modules in which a third library was constructed based on F5, a clone that was secondarily selected to increase binding affinity.
  • the binding signal by enzymatic immunoassay (ELISA) for the BSA compared to the complement protein degradation product C3a was averaged (Normalization), and at this time, the clone with the signal increased by more than 12 times was defined as a repeat body clone with increased binding affinity.
  • ELISA enzymatic immunoassay
  • Clone E10 had the highest binding affinity to the complement proteolytic product C3a at about 0.6 nM, which was about 1,000-fold increased compared to the H12 clone before the binding strength was increased.
  • FIG. 10 is a diagram showing the results of SDS-PAGE expression and purification of the final selected E10 having the highest binding force in E. coli.
  • FIG. 12 is a diagram illustrating interleukin-6 and tumor necrosis factor-alpha, which are used as indicators of pro-inflammatory responses, when E10 selected in the present invention is treated with monocytes isolated from human peripheral blood mononuclear cells. It is the result of confirming the degree of generation of factor- ⁇ ).
  • FIG. 13 is a structural schematic diagram of a repeater body double-binding to complement protein degradation product C3a and vascular endothelial growth factor by fusion of E10 selected in the present invention and a repeater body binding to vascular endothelial growth factor (VEGF) of the prior patent.
  • VEGF vascular endothelial growth factor
  • FIG. 14 is a structural schematic diagram of a repeater body that is double-bonded to complement protein C3a and complement protein C5a by fusion of E10 selected in the present invention and a repeater body that binds to complement protein C5a of the prior patent.
  • FIG. 15 is a view showing the result of confirming the double bond of the C3a-VEGF double bond repeater body prepared in the present invention through enzyme immunoassay (ELISA).
  • ELISA enzyme immunoassay
  • 16 is a view showing the result of confirming the double bond of the C3a-C5a double bond repeater body prepared in the present invention through enzyme immunoassay (ELISA).
  • ELISA enzyme immunoassay
  • a polypeptide that specifically binds to the complement protein degradation product C3a was selected and the effect of inhibiting the activity of the polypeptide was confirmed.
  • the selection of polypeptides that specifically bind to the polypeptides included in the library for refibody development through biopanning using the C3a phagemid was performed, and the binding ability thereof was improved. As a result, a polypeptide specific for C3a was prepared.
  • VLR Variable Lymphocyte Receptor
  • the library may be in the form of a phagemid including the polynucleotide.
  • phagemid refers to a circular polynucleotide molecule derived from a phage, a virus with Escherichia coli as a host, and includes sequences of proteins and surface proteins necessary for propagation and proliferation.
  • Recombinant phagemids may be prepared using genetic recombination techniques well known in the art, and site-specific DNA cleavage and ligation may be performed using enzymes generally known in the art.
  • the phagemid may include a signal sequence or leader sequence for secretion in addition to expression control elements such as promoter, operator, initiation codon, stop codon, and enhancer.
  • the promoter of the phagemid is primarily inducible and may contain selectable markers for selecting host cells.
  • the phagemid includes MalEss, DsbAss or PelBss, which is a signal sequence or leader sequence for expressing and secreting a polynucleotide encoding a polypeptide constituting the library, and the expression of the recombinant protein on the surface of the phage.
  • 10-2012-0019927 comprising a histidine-tag for identification and a polynucleotide encoding a gp3 domain, which is a kind of surface protein of M13 phage for expression on the phage surface It may be the polynucleotide of No. 2, but is not particularly limited thereto.
  • complement component C3a refers to a small protein fragment of about 9 kDa formed by cleavage of complement protein C3 during complement activation.
  • Complement proteolysis product C3a is involved in various inflammatory reactions, such as increasing vascular permeability by releasing histamine by destroying mast cells and basophil granules, and promoting phagocytosis by attracting leukocytes.
  • excessive and existing C3a in the body causes an excessive immune response to induce an abnormal inflammatory response, and this phenomenon is found in various diseases such as asthma, rheumatoid arthritis, sepsis, and the like.
  • the present inventors used a phage display method using a library containing the phagemid to select a novel polypeptide (SEQ ID NO: 3) in the form of a repeat body having excellent binding affinity to the complement protein degradation product C3a (Fig. 1, Fig. 2) ).
  • the selected polypeptide has a lower level of binding to the complement protein degradation product C3a than that of the complement component 5a recpetor existing in nature (FIG. 3), so that the mutation in the selected polypeptide
  • a second library in which four amino acid residues located in the LRRV4 module were mutated was constructed with respect to the selected SEQ ID NO: 3 (FIG. 4), and complement protein degradation products were constructed using the phage display method using the second library.
  • a novel polypeptide (SEQ ID NO: 4) with increased binding affinity to C3a was secondarily selected (FIG. 5).
  • binding affinity to the complement protein degradation product C3a was measured using isothermal titration calorimetry (FIG. 6), of which the polypeptide of SEQ ID NO: 4 had binding affinity to the complement protein degradation product C3a It was confirmed that this clone was the highest, and the binding force was confirmed to be 150 nM.
  • the present inventors have developed a total of 6 amino acid residues present in the LRR1 and LRRV1 modules based on SEQ ID NO: 4 in order to secure a repeatable body that can have biological efficacy while further improving binding ability with the complement protein degradation product C3a.
  • a mutated fourth library was constructed (FIG. 7).
  • the present invention provides an N-terminal of a Leucine rich repeat (LRR) family protein having an alpha helical capping motif and a modified repeat module of a Variable Lymphocyte Receptor (VLR) protein and a C- of the VLR protein
  • LRR Leucine rich repeat
  • VLR Variable Lymphocyte Receptor
  • a polypeptide that selectively binds to a fused-terminal complement proteolytic product C3a i) threonine at position 88 is substituted with methionine; ii) replacement of isoleucine at position 91 with leucine; iii) threonine at position 93 is replaced with methionine; iv) glycine at position 94 is replaced with proline; v) serine 99 is replaced with isoleucine; vi) substitution of valine 116 with tryptophan; It relates to a polypeptide that selectively binds to complement proteolysis product C3a, characterized in that it
  • the N-terminus of the LRR family protein having the alpha helical capping motif may be characterized as the N-terminus of the internalin protein, and the internalin protein is preferably internalin A , may be characterized as selected from the group consisting of internalin B, internalin C, internalin H and internalin J, more preferably, it may be characterized as internalin B protein.
  • the term "internalin B protein” refers to a type of LRR family protein expressed in a Listeria strain, which is different from other LRR family proteins in which other hydrophobic cores are uniformly distributed throughout the molecule. Because of the N-terminal structure, it is known to be stably expressed in microorganisms. As for the N-terminus of these internalin proteins, the most important N-terminal site for the folding of the repeat module is derived from a microorganism and its shape includes a more stable structure including an alpha helix, so the LRR family proteins in the microorganism are It can be effectively used for stable expression.
  • N-terminus of an internalin protein refers to the N-terminus of an internalin protein required for water-soluble expression and folding of the protein, and includes an alpha helical capping motif and a repeating module of the internalin protein. it means.
  • the N-terminus of the internalin protein includes, without limitation, the N-terminus of the internalin protein necessary for the soluble expression and folding of the protein, examples include an alpha helical capping motif "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" (SEQ ID NO: 11) and a repeat module. can do.
  • the repeating module pattern may comprise "LxxLxxLxLxxN" (SEQ ID NO: 12).
  • N-terminus of the internalin protein the N-terminus with high structural similarity may be selected depending on the type of LRR family protein to which it can be fused. Variation is possible
  • VLR Very Lymphocyte Receptor
  • LRR Leucine rich repeat protein
  • LRR Leucine rich repeat protein
  • the repeat module consists of 20-30 amino acids
  • the LRR repeat module has "LxxLxxLxLxxN" as a conserved pattern, where L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine and tryptophan.
  • LRR family proteins have a three-dimensional structure like a horseshoe protein that has
  • the LRR family protein of the present invention is not only found using mRNA or cDNA whose sequence is known or newly derived in vivo, but also has a sequence unknown in nature through design such as consensus design. All variants with a framework structure of the module may be included.
  • the term "repebody” refers to a polypeptide optimized by a consensus design by fusion based on the similarity of the structure of the VLR with the N-terminus of the internalin having an LRR structure.
  • the repeat body protein can be structurally divided into a concave region and a convex region (Convex).
  • the concave region has high sequence diversity and is known to be an important site for protein interaction.
  • the convex region plays a role in stably maintaining the overall structure of the protein based on highly conserved sequences.
  • the repeat body protein may include all proteins belonging to the LRR family having a repeat module, including all fusion LRR family proteins whose water-soluble expression and biophysicochemical properties of the protein are improved by the above method.
  • polypeptide may be characterized in that it is represented by any one of the amino acid sequence of SEQ ID NOs: 3 to 5.
  • the polypeptide may be characterized in that it binds to the complement protein degradation product C3a and inhibits its activity.
  • the present invention relates to a polynucleotide encoding the polypeptide.
  • the polynucleotide is not particularly limited thereto, but may be a polynucleotide encoding an amino acid sequence of any one of SEQ ID NOs: 3 to 5, and 70% or more with the polynucleotide, more preferably 80 % or more, more preferably a polynucleotide having a nucleotide sequence having a homology of 90% or more, but is not particularly limited thereto.
  • the present invention relates to a recombinant vector comprising the polynucleotide.
  • the term "vector” refers to a DNA preparation containing the nucleotide sequence of a polynucleotide encoding the target protein operably linked to a suitable regulatory sequence so that the target protein can be expressed in a suitable host.
  • suitable regulatory sequences include promoters capable of initiating transcription, optional operator sequences for regulating such transcription, sequences encoding suitable mRNA ribosome binding sites, and sequences regulating the termination of transcription and translation.
  • the vector After transformation into a suitable host, the vector can replicate or function independently of the host genome, and can be integrated into the genome itself.
  • the vector used in the present invention is not particularly limited as long as it can replicate in a host, and any vector known in the art may be used.
  • Examples of commonly used vectors include plasmids, phagemids, cosmids, viruses and bacteriophages in a natural or recombinant state.
  • pWE15, M13, ⁇ MBL3, ⁇ MBL4, ⁇ IXII, ⁇ ASHII, ⁇ APII, ⁇ t10, ⁇ t11, Charon4A, and Charon21A may be used as phage vectors or cosmid vectors, and pBR-based, pUC-based, and pBluescriptII-based plasmid vectors may be used.
  • pGEM-based, pTZ-based, pCL-based and pET-based and the like can be used.
  • the vector usable in the present invention is not particularly limited, and a known expression vector may be used.
  • pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a vectors and the like may be used.
  • pET-21a or pET-32a vectors may be used.
  • the present invention relates to a recombinant microorganism into which the polynucleotide or a recombinant vector comprising the polynucleotide is introduced.
  • the term "recombinant microorganism” refers to a cell transfected such that a vector having a gene encoding one or more target proteins is introduced into a host cell to express the target protein, and all cells such as eukaryotic cells and prokaryotic cells It may be, but is not particularly limited thereto, bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium; yeast cells; fungal cells such as Pichia pastoris; insect cells such as Drosophila and Spodoptera Sf9 cells; animal cells such as CHO, COS, NSO, 293, and Bow melanoma cells; or plant cells.
  • bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium
  • yeast cells fungal cells such as Pichia pastoris
  • insect cells such as Drosophila and Spodoptera Sf9 cells
  • animal cells such as CHO, COS, NSO, 293, and Bow melanoma cells; or plant cells.
  • the host cells usable in the present invention are not particularly limited, but preferably Escherichia coli can be used as the host cell. Most preferably, Escherichia coli BL21 (DE3) and OrigamiB (DE3) can be used as host cells.
  • the term "transformation” refers to introducing a vector including a polynucleotide encoding a target protein into a host cell so that the protein encoded by the polynucleotide can be expressed in the host cell.
  • Transformed polynucleotides include all of them regardless of whether they are inserted into the chromosome of the host cell or located extrachromosomally, as long as they can be expressed in the host cell.
  • the polynucleotide includes DNA and RNA encoding a target protein. As long as the polynucleotide can be introduced and expressed into a host cell, it does not matter which form is introduced.
  • the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct including all elements necessary for self-expression.
  • the expression cassette usually includes a promoter operably linked to the polynucleotide, a transcription termination signal, a ribosome binding site, and a translation termination signal.
  • the expression cassette may be in the form of an expression vector capable of self-replication.
  • the polynucleotide may be introduced into a host cell in its own form and operably linked to a sequence required for expression in the host cell.
  • the present invention comprises the steps of (i) culturing the recombinant microorganism to express the polypeptide; and (ii) recovering the polypeptide from the cultured recombinant microorganism or culture.
  • the step of culturing the recombinant microorganism is not particularly limited thereto, but is preferably performed by a known batch culture method, a continuous culture method, a fed-batch culture method, etc., and the culture conditions are not particularly limited thereto,
  • a suitable pH pH 5-9, preferably pH 6-8, most preferably pH 6.8 is adjusted using a basic compound (eg sodium hydroxide, potassium hydroxide or ammonia) or an acidic compound (eg phosphoric acid or sulfuric acid).
  • aerobic conditions can be maintained by introducing oxygen or an oxygen-containing gas mixture into the culture, and the culture temperature can be maintained at 20 to 45 °C, preferably 25 to 40 °C, and for about 10 to 160 hours Incubation is preferred.
  • the polypeptide produced by the culture may be secreted into the medium or remain in the cell.
  • the culture medium used is a carbon source that includes sugars and carbohydrates (eg, glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose), oils and fats (eg, soybean oil, sunflower seeds).
  • sugars and carbohydrates eg, glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose
  • oils and fats eg, soybean oil, sunflower seeds.
  • Nitrogen sources include nitrogen-containing organic compounds (e.g., peptone, yeast extract, broth, malt extract, corn steep liquor, soy meal and urea), or inorganic compounds (e.g., ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and ammonium nitrate) may be used individually or in combination;
  • As the phosphorus source potassium dihydrogen phosphate, dipotassium hydrogen phosphate, sodium-containing salts corresponding thereto, and the like may be used individually or in combination; It may contain essential growth-promoting substances such as other metal salts (eg magnesium sulfate or iron sulfate), amino acids and vitamins.
  • the method for recovering the polypeptide produced in the culturing step of the present invention is a culture method, for example, a desired polypeptide from a culture medium using a suitable method known in the art according to a batch, continuous or fed-batch culture method. can be collected
  • the present invention relates to a double-binding repebody in which a polypeptide that selectively binds to the complement protein degradation product C3a and a repeater body that specifically binds to vascular endothelial growth factor (VEGF) are fused to a bispecific repebody. It's about
  • the double bond repeater body may be characterized in that it is represented by the amino acid sequence of SEQ ID NO: 7 or 8.
  • the present invention relates to a composition for preventing or treating immune diseases containing the polypeptide or double bond repeater body as an active ingredient.
  • the prevention or treatment of the immune disease may be characterized in that the polypeptide binds to the complement protein degradation product C3a.
  • the term “immune disease” refers to a disease caused by an abnormality in the immune system.
  • the immune disease in the present invention is any autoimmune disease, but preferably rheumatoid arthritis, systemic lupus erythematosus, Sjogren's syndrome, Behcet's syndrome, psoriasis, cirrhosis, ankylosing spondylitis, multiple sclerosis, Guillain-Barré syndrome, leukemia, Graves' disease, Crohn's disease, ciliac disease, Wegener's granulomatosis, muscular dystrophy, uveitis, Tachiyasu's arteritis, temporal arteritis, relapsing polychondritis, multiple sclerosis, Chuck-Strauss syndrome, Henoch-Schoonlein purpura, Goodpasture syndrome , type 1 diabetes, aphthous stomatitis, pemphigus, and may be characterized in
  • the term “treatment” means not only suppressing or alleviating an immune disease or one or more symptoms resulting therefrom by administration of the composition, but also treating cancer that reverses the symptoms of the disease or preventing the progression of cancer .
  • the term “prevention” refers to any action that suppresses or delays the onset of an immune disease by administration of the composition.
  • the prevention or treatment of immune diseases is achieved by binding the polypeptide obtained in the present invention to the complement protein degradation product C3a, and significantly inhibits its activity by binding to the complement protein degradation product C3a to prevent or treat immune diseases will do
  • composition for preventing or treating immune diseases containing the polypeptide or double-bond repeater body of the present invention as an active ingredient may further include a pharmaceutically acceptable carrier, and may be formulated together with the carrier.
  • the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not stimulate the organism and does not inhibit the biological activity and properties of the administered compound.
  • Acceptable pharmaceutical carriers for compositions formulated as liquid solutions include sterile and biocompatible, saline, sterile water, Ringer's solution, buffered saline, albumin injection, dextrose solution, maltodextrin solution, glycerol, ethanol and One or more of these components may be mixed and used, and other conventional additives such as antioxidants, buffers, and bacteriostats may be added as needed.
  • diluents such as an aqueous solution, suspension, emulsion, etc., pills, capsules, granules or tablets.
  • composition for preventing or treating immune diseases comprising the polypeptide of the present invention and a pharmaceutically acceptable carrier is applicable to any formulation containing the same as an active ingredient, and may be prepared as an oral or parenteral formulation.
  • the pharmaceutical formulation of the present invention may be administered to the oral, rectal, nasal, topical (including buccal and sublingual), subcutaneous, vaginal or parenteral (intramuscular, subcutaneous) forms. and those suitable for administration (including intravenous) or forms suitable for administration by inhalation or insufflation.
  • Formulations for oral administration containing the composition of the present invention as an active ingredient include, for example, tablets, troches, lozenges, aqueous or oily suspensions, prepared powders or granules, emulsions, hard or soft capsules, syrups or elixirs. can do.
  • a binder such as lactose, saccharose, sorbitol, mannitol, starch, amylopectin, cellulose or gelatin, an excipient such as dicalcium phosphate, a disintegrant such as corn starch or sweet potato starch, Masene stearate Lubricating oils such as calcium, calcium stearate, sodium stearyl fumarate or polyethylene glycol wax may be included, and in the case of capsule formulations, a liquid carrier such as fatty oil may be further contained in addition to the above-mentioned substances.
  • Formulations for parenteral administration containing the composition of the present invention as an active ingredient include injections such as subcutaneous injection, intravenous injection or intramuscular injection, suppository injection method, or an aerosol for inhalation through the respiratory tract.
  • injections such as subcutaneous injection, intravenous injection or intramuscular injection, suppository injection method, or an aerosol for inhalation through the respiratory tract.
  • the composition of the present invention may be mixed with a stabilizer or buffer in water to prepare a solution or suspension, and it may be formulated for unit administration in ampoules or vials.
  • a composition for rectal administration such as a suppository or an enema containing a conventional suppository base such as cocoa butter or other glycerides.
  • a propellant or the like may be blended with an additive so that the water-dispersed concentrate or wet powder is dispersed.
  • the present invention relates to a method for preventing or treating an immune disease, comprising administering a composition for preventing or treating an immune disease containing the polypeptide as an active ingredient.
  • the term "administration" means introducing the pharmaceutical composition of the present invention to a patient by any suitable method.
  • the administration route of the composition of the present invention may be administered through various routes, either oral or parenteral, as long as it can reach the target tissue, specifically, oral, rectal, topical, intravenous, intraperitoneal, intramuscular, intraarterial, It may be administered in a conventional manner via the transdermal, intranasal, inhalation, intraocular or intradermal routes.
  • the treatment method of the present invention includes administering the composition for preventing or treating immune diseases of the present invention in a pharmaceutically effective amount. It is apparent to those skilled in the art that a suitable total daily amount can be determined by a treating physician within the scope of sound medical judgment. A specific therapeutically effective amount for a particular patient will depend on the type and extent of the response to be achieved, the specific composition, including whether other agents are used, if necessary, the patient's age, weight, general health, sex and diet, time of administration; It is preferable to apply differently depending on various factors including the route of administration and secretion rate of the composition, the duration of treatment, the drug used together with or concurrently with the specific composition, and similar factors well known in the pharmaceutical field. Therefore, it is preferable to determine the effective amount of the composition for preventing or treating cancer suitable for the purpose of the present invention in consideration of the foregoing.
  • the treatment method of the present invention is applicable to any animal that can develop a disease due to excessive activity of the complement proteolytic product C3a, and the animal is not only humans and primates, but also cattle, pigs, sheep, horses, dogs and cats. including livestock such as
  • Example 1 Construction of a protein structure-based repeat body library
  • repeat units with a conserved leucine sequence are continuously connected to maintain the overall protein structure and modularity and the curvature of the shape of the entire structure. region) and a convex region.
  • a hypervariable region like a complementarity determining region (CDR) of an antibody, is located in the concave region to mediate protein-protein interaction.
  • CDR complementarity determining region
  • the convex region plays an important role in maintaining the overall structure of the LRR based on its well-conserved sequence.
  • a random library was designed in the following way by analyzing the protein structure of these repeat bodies.
  • a random mutation library was constructed by selecting six amino acid residues 91, 93, 94, 115, 117, and 118 located in the concave regions of two consecutive modules (LRRV2, LRRV3 module) located in the direction of the amine group terminal. (FIG. 1).
  • a mutagenic primer for library construction was synthesized so that the selected amino acid was substituted with an NNK degenerate codon.
  • the primer sequence is as follows.
  • SEQ ID NO: 13 M1 CTG CCG AAT GGC GTC TTT GAT AAA CTG ACG AAC CTG AAA GAA CTG NNK CTG NNK NNK AAT CAA CTG CAG TCT CTG CCG GAC
  • SEQ ID NO: 14 M2 CGT CAG TTT ATC AAA GAC GCC ATT CGG CAG GCT CTG CAG TTG GTT MNN MNN CAG MNN CAG ATA CGT CAG ATT GGT CAG TTC
  • overlap PCR overlap polymerase chain reaction
  • Example 2 Selection of polypeptides that specifically bind to C3a through a random phage library
  • Example 2-1 Selection of polypeptides binding to C3a through the panning process of the Lipibody library
  • a polypeptide capable of binding to the complement protein degradation product C3a was selected and purified using the library constructed in the prior patent.
  • the complement protein degradation product C3a was added to an immune tube (Immuno-tube) at a concentration of 50 ⁇ g/ml and coated at 4° C. for 12 hours.
  • the coated immune tube was washed three times with PBS, and blocked with a PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20 at 4° C. for 2 hours.
  • TPBSA PBS solution
  • the purified phage was added to the coated immunotube at a concentration of 10 12 cfu/ml, and reacted at room temperature for 2 hours. After the reaction was completed, it was washed with PBS solution (TPBS) containing 0.05% Tween 20 5 times for a total of 2 minutes and twice with PBS. Finally, 1 ml 0.2 M Glycine-HCl (pH 2.2) was added to the immunotube and reacted at room temperature for 13 minutes to elute the phage expressing the Lipibody candidate capable of binding to the complement proteolytic product C3a on the surface. .
  • the absorbance (OD 450) of the complement protein degradation product C3a compared to BSA was 8 by performing ELISA for the phage selected through the method of Example 2-1 using a 96-well plate coated with complement protein degradation product C3a and BSA.
  • Candidates for repeat bodies more than twice as high were selected (FIG. 2), and after confirming their respective amino acid sequences, clones having the same amino acid sequence were excluded.
  • FOG. 2 Candidates for repeat bodies more than twice as high were selected (FIG. 2), and after confirming their respective amino acid sequences, clones having the same amino acid sequence were excluded.
  • a total of four types of repeat body sequences were identified in the selected phage, and as a result of measuring the dissociation constant using an isothermal calorimeter, it was found that clone H12 binds to the complement protein degradation product C3a with a binding force of about 637 nM. was confirmed (FIG.
  • Example 3 Performing an increase in binding force to C3a of the repeat body using a module-based method
  • the module-based affinity enhancement method described in the present invention was performed according to a prior patent (KR2012-0019927). This method is a technique that can be used universally for proteins having repeat modules, and has been successfully reproduced in this patent, enabling the design of proteins with a high level of affinity.
  • Example 3-1 Additional library construction using a module, confirmation of increased binding force, and confirmation of cross-linking to other proteins
  • the dissociation constant for the complement protein degradation product C3a of H12, a clone confirmed to specifically bind to the complement protein degradation product C3a from the results of Example 2-2, is 637 nM (FIG. 2), but a naturally occurring complement protein
  • the dissociation constant of the degradation product C3a receptor for the complement protein degradation product C3a is at the level of 1 nM. Therefore, it was expected that the repeat body candidate of the present invention could not sufficiently inhibit the activity of the complement protein degradation product C3a.
  • E10 SEQ ID NO: 5
  • C9 SEQ ID NO: 6
  • isoleucine at position 47 was substituted with tyrosine
  • asparagine at position 49 with threonine
  • asparagine at position 50 with serine
  • alanine at position 69 and glycine at positions 71 and 72 were maintained.
  • asparagine at position 139 was substituted with glutamine and glycine at position 142 with asparagine.
  • the present inventors have successfully secured a refibody having a higher binding affinity than the receptor of the naturally occurring complement protein degradation product C3a, and it was confirmed that this is a polypeptide having a specific binding affinity to the complement protein degradation product C3a.
  • the naturally occurring complement proteolytic product C3a has a high sequence similarity of 43.6% to the complement proteolytic product C5a. Therefore, in order to confirm that the selected E10 repibody specifically exhibits strong binding to C3a, an experiment was performed to determine whether or not to cross-link with the complement protein degradation product C5a (RnD Systems, USA) and BSA.
  • E10 repeat bodies After each protein was coated on a 96-well plate, phages displaying E10 repeat bodies were added and the degree of binding was confirmed by enzyme-linked immunoprecipitation (ELISA). As a result, the selected E10 repeat bodies specifically bind only to C3a. was confirmed (FIG. 11).
  • the present inventors successfully secured a repeat body having high binding affinity to the complement protein degradation product C3a, and confirmed that it is a polypeptide having a specific binding ability to the target protein, the complement protein degradation product C3a.
  • Complement proteolysis product C3a is associated with inflammatory responses and is known to induce pro-inflammatory responses, particularly related to the secretion of cytokines such as interleukin-6 and tumor necrosis factor- ⁇ . there is. Accordingly, in order to confirm the activity of the selected Lipibody that specifically binds to the complement protein degradation product C3a can inhibit the pro-inflammatory response, interleukin-6 and tumor necrosis factor-alpha (Tumor) from monocytes. An experiment was performed to measure the degree of production and secretion of necrosis factor- ⁇ ).
  • the monocytes isolated from peripheral blood mononuclear cells were treated with the selected Lipibody, and the production level of Interleukin-6 and Tumor necrosis factor- ⁇ before and after treatment.
  • ELISA enzyme immunoprecipitation
  • VEGF vascular endothelial growth factor
  • a pET21a expression vector (Novagen, USA) including the sequence fused complex was prepared.
  • Two linkers were fused between the two repeat bodies (X2) and four fused (X4) were prepared, which were expressed in E. coli, and C2-X2-E10 and C2-X4-E10 complexes (SEQ ID NO: 7; SEQ ID NO: 8) was prepared (FIG. 13).
  • the GGGGS linker sequence was fused with the repeat body E10 that specifically binds to the complement protein degradation product C3a developed in the present invention with the repeat body binding to complement protein C5a described in Korean Patent No. 10-1624702-0000.
  • a pET21a expression vector (Novagen, USA) containing one complex was prepared.
  • Two linkers were fused between the two repeat bodies (X2) and four fused (X4) were prepared, which were expressed in E. coli, and the E8-X2-E10 and E8-X4-E10 complexes (SEQ ID NO: 9; SEQ ID NO: 10) was prepared (FIG. 14).
  • the complex was simultaneously exposed to the complement protein degradation product C3a and vascular endothelial growth factor (VEGF), and as a result of confirming the double binding by enzyme immunoprecipitation (ELISA), the complex was the complement protein degradation product C3a and vascular endothelial growth factor (VEGF) were confirmed to bind simultaneously (FIG. 15).
  • VEGF vascular endothelial growth factor
  • the complex was simultaneously exposed to the complement protein degradation product C3a and the complement protein C5a to confirm the double bond by enzyme immunoprecipitation (ELISA). It was confirmed that it binds at the same time to (FIG. 16).
  • the novel polypeptide binding to complement proteolysis product C3a of the present invention binds to complement proteolysis product C3a with a higher affinity than the naturally occurring complement proteolysis product C3a receptor and inhibits its activity, thereby inhibiting the activity associated with complement proteolysis product C3a. It is useful because it can be widely used in the development of agents for the prevention or treatment of various diseases.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

본 발명은 보체 단백 분해 산물 C3a에 선택적으로 결합하는 신규한 폴리펩티드에 관한 것으로, 보다 구체적으로 본 발명은 인간의 보체 단백 분해 산물 C3a에 결합함으로써 그의 활성을 저해할 수 있는 폴리펩티드, 상기 폴리펩티드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터, 상기 재조합 벡터가 도입된 재조합 미생물, 상기 재조합 미생물을 이용한 상기 폴리펩티드 생산방법 및 상기 폴리펩티드를 포함하는 치료용 의약 조성물에 관한 것이다. 본 발명의 보체 단백 분해 산물 C3a에 결합하는 신규한 폴리펩타이드는 자연계에 존재하는 보체 단백 분해 산물 C3a 수용체보다 높은 친화력으로 보체 단백 분해 산물 C3a에 결합하여 그의 활성을 억제함으로써 보체 단백 분해 산물 C3a와 연관된 다양한 질환의 예방 또는 치료용 제제의 개발에 널리 활용될 수 있어 유용하다.

Description

보체 단백 분해 산물 C3A와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도
본 발명은 보체 단백 분해 산물 C3a에 선택적으로 결합하는 신규한 폴리펩티드에 관한 것으로, 보다 구체적으로 본 발명은 인간의 보체 단백 분해 산물 C3a에 결합함으로써 그의 활성을 저해할 수 있는 폴리펩티드, 상기 폴리펩티드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터, 상기 재조합 벡터가 도입된 재조합 미생물, 상기 재조합 미생물을 이용한 상기 폴리펩티드 생산방법 및 상기 폴리펩티드를 포함하는 치료용 의약 조성물에 관한 것이다.
항체 치료제는 화학제재에 비해 낮은 부작용과 높은 치료 효능 때문에 글로벌 제약기업과 생명공학 기업들이 개발에 집중 투자를 하여 현재 다수의 항체 치료제가 임상에 사용되고 있으며 많은 치료제 후보가 임상실험 중에 있다.
그러나 항체 치료제는 생산 비용이 비싸고 기존 특허 장벽을 벗어나기 힘들며 분자량이 커서 세포내 침투가 어렵고 기대만큼 실제 환자의 치료 효과가 높지 않은 문제점이 있기 때문에, 최근 항체 치료제를 대체하기 위한 인공항체의 개발이 활발하게 진행되고 있다. 이러한 인공항체 골격 단백질은 항체 치료제와 달리 암 조직 내로 침투되는 효율에 크게 향상되어 결과적으로 치료 효과를 향상 시킬 수 있다는 장점이 많은 연구를 통해 밝혀지고 있다.
이러한 배경 하에, 본 발명자들은 기존의 항체를 대체할 수 있는 비 항체 단백질 골격 (non-antibody protein scaffold)인 리피바디 (repebody)를 성공적으로 개발하였다. 리피바디는 크기가 항체의 1/5 수준이고 대장균에서 대량생산 되며 동물 실험결과 면역원성이 거의 없음. 열 및 pH 안정성이 매우 우수하고 타겟에 대한 결합력을 pico-mole 수준까지 매우 용이하게 증대시킬 수 있으며 타겟에 대한 특이성이 매우 탁월함을 입증한 바가 있다.
보체 단백 분해 산물 C3a는 선천성 면역계와 적응 면역계 사이의 중요한 매개체로 천식, 류마티스 관절염, 루프스와 같은 염증 반응 기반의 면역 관련 질환들의 유발인자로 알려져 있다. 특히, 혈액 중에 세균과 같은 침입자가 생체를 감염시키고 번식하면서 체내 과도한 염증 반응이 원인인 패혈증과 천식 치료제 개발의 표적 물질로 잘 알려져 있다. 패혈증은 전 세계적으로 중환자실 이환율 및 사망률의 주요한 원인으로 알려져 있고 미국의 경우 해마다 750,000명의 패혈증 환자가 발생하며 국내에서도 정확한 통계는 없지만 매우 높은 발병률을 나타내고 있다. 치사율 또한 40% 정도로 매우 높은 편이나, 2001년 FDA 승인을 받은 치료제가 2011년 시장에서 퇴출되면서 아직까지 효과적인 치료법이나 치료 물질은 매우 부족한 실정이다. 따라서 패혈증과 같이 과도한 염증 반응의 결과로 나타나는 질병의 치료제로써 보체 단백 분해 산물 C5a를 표적으로 하는 치료제 개발 연구가 꾸준히 진행되고 있지만, 비슷한 기능을 하는 C3a를 표적으로 하는 치료제 개발 연구는 상대적으로 많이 진행되지 못한 상태이다.
본 발명자들은 다양한 단백질에 대해 특이적으로 결합가능한 리피바디(Repebody)라는 폴리펩티드를 개발한 바 있으며 (대한민국 특허 제10-1356075호, 제10-1654890호, 제10-1587622호, 제10-1624702호, 제10-1624703호, 제10-1713944호, 제10-1751501호, 제10-1818152호 및 제10-1875809호), 상기 리피바디 골격을 이용하여 다양한 질환 관련 표적 단백질들에 대한 특이적인 결합 단백질 (Specific protein binder)을 성공적으로 제조하고, 세포 기반의 방법으로 생물학적인 저해효과가 있음을 검증하였고, 추가적인 연구를 활발히 진행하고 있다.
이러한 배경 하에서, 본 발명자들은 상기 리피바디 골격을 이용하여 다양한 면역 질환과 관련이 깊은 것으로 알려진 보체 단백 분해 산물 C3a에 특이적으로 결합하는 단백질을 성공적으로 확보하기 위해 예의 노력한 결과, 리피바디의 구조적 특징인 모듈성과 전체구조분석을 통해 구축한 무작위한 돌연변이 라이브러리를 바탕으로 보체 단백 분해 산물 C3a에 대해 특이적인 결합력을 갖는 신규한 단백질을 선별하고, 반복 모듈 기반의 친화력 증대방식을 통해 결합력을 향상시키며, 결합력이 향상된 리피바디가 C3a의 활성을 억제할 수 있음을 확인하여, 본 발명을 완성하였다.
발명의 요약
본 발명의 목적은 보체 단백 분해 산물 C3a에 특이적으로 결합하는 리피바디(Repebody); 상기 리피바디를 코딩하는 폴리뉴클레오티드; 상기 폴리뉴클레오티드를 포함하는 재조합 벡터; 상기 재조합 벡터가 도입된 재조합 미생물; 및 상기 재조합 미생물를 이용해 상기 리피바디를 생산하는 방법을 제공하는데 있다.
본 발명의 다른 목적은 상기 리피바디에 혈관 내피세포 성장인자 (VEGF)에 특이적으로 결합하는 리피바디가 융합된 이중 결합 리피바디(bispecific repebody)를 제공하는데 있다.
본 발명의 다른 목적은 상기 리피바디 또는 이중 결합 리피바디를 함유하는 면역 질환 예방 또는 치료용 조성물 및 상기 리피바디 또는 이중 결합 리피바디를 함유하는 면역 질환 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 면역 질환을 예방 또는 치료하는 방법을 제공하는 것이다.
상기 목적을 달성하기 위해, 본 발명은 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드로, i) 88번 트레오닌이 메티오닌으로 치환; ii) 91번 이소류신이 류신으로 치환; iii) 93번 트레오닌이 메티오닌으로 치환; iv) 94번 글라이신이 프롤린으로 치환; v) 99번 세린이 이소류신으로 치환; vi) 116번 발린이 트립토판으로 치환; vii) 117번 글루탐산이 히스티딘으로 치환;으로 구성된 군에서 선택되는 하나 또는 둘 이상의 아미노산 변이를 포함하는 것을 특징으로 하는, 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드를 제공한다.
본 발명은 또한, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드 및 상기 폴리뉴클레오티드를 포함하는 재조합 벡터를 제공한다.
본 발명은 또한, 상기 재조합 벡터가 포함되어 있는 재조합 미생물을 제공한다.
본 발명은 또한, 상기 재조합 미생물을 배양하여 상기 폴리펩타이드를 발현시키는 단계 및 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 폴리펩타이드의 제조방법을 제공한다.
본 발명은 또한, 상기 보체 단백 분해 산물 C3a에 특이적으로 결합하는 폴리펩타이드와 혈관 내피세포성장인자(VEGF)에 특이적으로 결합하는 리피바디가 융합된 이중 결합 리피바디(bispecific repebody)를 제공한다.
본 발명은 또한, 상기 폴리펩타이드 또는 이중 결합 리피바디를 유효성분으로 함유하는 면역 질환 예방 또는 면역 질환 치료용 조성물을 제공한다.
본 발명은 또한, 상기 폴리펩타이드 또는 이중 결합 리피바디를 유효성분으로 함유하는 면역 질환 예방 또는 면역 질환 치료용 조성물의 면역 질환 예방 또는 면역 질환 치료 용도를 제공한다.
본 발명은 또한, 상기 리피바디 또는 이중 결합 리피바디를 함유하는 면역 질환 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 면역 질환을 예방 또는 치료하는 방법을 제공한다.
도 1은 보체 단백 분해 산물 C3a에 대한 폴리펩타이드를 초기 선별하기 위해 첫 번째 라이브러리가 구축된 LRRV2 모듈과 LRRV3 모듈에 존재하는 아미노산 잔기를 나타낸다.
도 2은 보체 단백 분해 산물 C3a에 대한 파지 디스플레이의 바이오 패닝을 수행한 결과이다. BSA 대비 보체 단백 분해 산물 C3a에 대한 효소면역측정법 (ELISA)에 의한 결합 신호를 평균화 (Normalization)를 하였으며, 이때 8배 이상의 신호가 증가한 클론에 대해 특이적인 결합력을 갖는 리피바디 클론으로 정의하였다.
도 3는 상기 도 2에서 얻어진 클론인 H12에 대해 등온열량측정기 (Isothermal titration calorimetry; ITC)를 이용하여 해리상수를 측정한 결과로, 보체 단백 분해 산물 C3a에 대해 637 nM의 낮은 결합력을 가지고 있음을 확인하였다.
도 4는 결합력을 증대시키기 위해 일차적으로 선별된 클론인 H12을 바탕으로 두 번째 라이브러리가 구축된 LRRV4 모듈에 존재하는 아미노산 잔기를 나타낸다.
도 5는 두 번째 라이브러리를 이용하여 파지 디스플레이의 바이오 패닝을 수행한 결과이다. BSA 대비 보체 단백 분해 산물 C3a에 대한 효소면역측정법 (ELISA)에 의한 결합 신호를 평균화 (Normalization)를 하였으며, 이때 10배 이상의 신호가 증가한 클론에 대해 결합력이 증대된 리피바디 클론으로 정의하였다.
도 6은 상기 도 5에서 수득한 클론 중 가장 높은 결합력을 보이는 클론인 F6에 대해 등온열량측정기를 이용하여 해리상수를 측정한 결과로, 보체 단백 분해 산물 C3a에 대해 150 nM의 결합력을 가지고 있음을 확인하였다. 이는 결합력 증대 전의 H12 클론에 비해 약 4배 결합력이 증대된 것이다.
도 7은 결합력을 증대시키기 위해 이차적으로 선별된 클론인 F5를 바탕으로 세 번째 라이브러리가 구축된 LRR1 및 LRRV1 모듈에 존재하는 아미노산 잔기를 나타낸다.
도 8은 세 번째 라이브러리를 이용하여 파지 디스플레이의 바이오 패닝을 수행한 결과이다. BSA 대비 보체 단백 분해 산물 C3a에 대한 효소면역측정법 (ELISA)에 의한 결합 신호를 평균화 (Normalization)를 하였으며, 이때 12배 이상의 신호가 증가한 클론에 대해 결합력이 증대된 리피바디 클론으로 정의하였다.
도 9는 상기 도 8에서 수득한 클론 중 F6보다 결합력이 증대된 클론들에 대해 등온열량측정기를 이용하여 해리상수를 측정한 결과이다. 클론 E10이 보체 단백 분해 산물 C3a에 대해 약 0.6 nM로 가장 높은 결합력을 가지며, 이는 결합력 증대 전의 H12 클론에 비해 약 1,000배 결합력이 증대된 것이다.
도 10은 가장 높은 결합력을 지닌, 최종 선별된 E10을 대장균에서 발현 및 정제한 SDS-PAGE 결과를 나타내는 도면이다.
도 11은 본 발명에서 선별된 리피바디 E10이 보체 단백 분해 산물 C3a에 대해 특이적으로 결합하는지를 확인한 것으로, 이는 파지를 이용한 효소면역측정법 (ELISA)으로 측정하였다.
도 12는 본 발명에서 선별된 E10을 사람의 말초 혈액 단핵세포로부터 분리한 단핵구에 처리했을 때, 전 염증성 반응의 지표로 사용되는 인터루킨-6 (Interleukin-6)와 종양괴사인자-알파 (Tumor necrosis factor-α)의 생성 정도를 확인한 결과이다.
도 13은 본 발명에서 선별된 E10과 선행 특허의 혈관 내피세포 성장인자 (VEGF)에 결합하는 리피바디를 융합하여 보체 단백 분해 산물 C3a과 혈관 내피세포 성장인자에 이중 결합 리피바디의 구조 개략도이다.
도 14는 본 발명에서 선별된 E10과 선행 특허의 보체 단백질 C5a에 결합하는 리피바디를 융합하여 보체 단백 분해 산물 C3a과 보체 단백질 C5a에 이중 결합 리피바디의 구조 개략도이다.
도 15는 본 발명에서 제조한 C3a-VEGF 이중 결합 리피바디의 이중 결합을 효소면역측정법 (ELISA)을 통해 확인한 결과를 나타내는 도면이다.
도 16은 본 발명에서 제조한 C3a-C5a 이중 결합 리피바디의 이중 결합을 효소면역측정법 (ELISA)을 통해 확인한 결과를 나타내는 도면이다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법 및 이하에 기술하는 실험 방법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는 보체 단백 분해 산물 C3a에 특이적으로 결합하는 폴리펩티드를 선별하고, 상기 폴리펩티드의 활성 억제 효과를 확인하고자 하였다.
본 발명에서는, 리피바디 개발을 위한 라이브러리에 포함된 폴리펩티드를 C3a의 파지미드를 이용한 바이오패닝을 통해 특이적으로 결합하는 폴리펩티드의 선별을 수행하고, 이들의 결합력을 개선하는 작업을 수행하였다. 그 결과 C3a에 특이적인 폴리펩티드를 제조하였다.
즉, 본 발명의 일 실시예에서는 C3a에 특이적으로 결합할 수 있는 신규한 폴리펩티드를 개발하기 위하여, 인터날린 B (Internalin B) 단백질의 Ｎ-말단, 가변 림프구 수용체(Variable Lymphocyte Receptor, VLR) 의 LRR (Leucine-rich repeat) 단백질 부분이 융합된, 폴리펩티드의 반복 모듈을 무작위적으로 포함하는 라이브러리를 구축하였다(도 1). 상기 라이브러리에 포함된 폴리펩타이드는 서열번호 1의 폴리뉴클레오티드 서열에 의하여 코딩되거나 또는 서열번호 1의 폴리뉴클레오티드 서열과 75%, 바람직하게는 85%, 보다 바람직하게는 90%, 더욱 바람직하게는 95% 이상의 상동성을 갖는 폴리뉴클레오티드 서열에 의하여 코딩될 수 있다.
또한, 상기 라이브러리는 상기 폴리뉴클레오티드를 포함하는 파지미드의 형태가 될 수 있다. 본 발명의 용어 "파지미드"란, 대장균을 숙주로 하는 바이러스인 파지로 부터 유래된 원형의 폴리뉴클레오티드 분자를 의미하는데, 번식과 증식에 필요한 단백질 및 표면 단백질들의 서열이 포함되어 있다. 재조합 파지미드는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 수행될 수 있다. 상기 파지미드는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 인핸서 같은 발현 조절 요소 외에도 분비를 위한 신호 서열 또는 리더 서열을 포함할 수 있고, 주로 원하는 단백질을 파지의 표면 단백질과 융합하여 파지 표면에 표지하기 위한 방법에 사용될 수 있다. 파지미드의 프로모터는 주로 유도성이며, 숙주 세포를 선택하기 위한 선택성 마커를 포함할 수도 있다. 본 발명의 목적상 상기 파지미드는 상기 라이브러리를 구성하는 폴리펩티드를 코딩하는 폴리뉴클레오티드를 발현 및 분비하기 위한 신호 서열 또는 리더 서열인 MalEss, DsbAss 또는 PelBss를 포함하고, 파지의 표면에 재조합 단백질의 발현을 확인하기 위한 히스티딘-태그와 파지 표면으로의 발현을 위한 M13 파지의 표면 단백질의 일종인 gp3 도메인을 인코딩하는 폴리뉴클레오티드를 포함하는 본 발명자의 선행 특허 (제10-2012-0019927호)에 기술된 서열번호 2의 폴리뉴클레오티드가 될 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명의 용어 “보체 단백 분해 산물 C3a (complement component C3a)”는 보체 활성화 과정에서 보체 단백질 C3가 잘리면서 형성된 약 9 kDa의 작은 단백질 조각이다. 보체 단백 분해 산물 C3a 는 비만세포와 호염구 과립 파괴로 히스타민을 방출시켜 혈관 투과성을 증가시키며, 백혈구를 불러들여 식작용을 촉진시키는 등의 다양한 염증 반응에 관여한다. 특히 체내에 과도하고 존재하는 C3a는 면역 반응을 과도하게 일으켜 비정상적인 염증 반응을 유발하며, 이러한 현상은 천식, 류마티스 관절염, 패혈증 등과 같은 다양한 질환에서 발견되고 있다.
본 발명자들은 상기 파지미드를 포함하는 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 보체 단백 분해 산물 C3a에 대한 결합력이 우수한 리피바디 형태의 신규한 폴리펩타이드(서열번호 3)를 선별하였다 (도 1, 도 2). 그러나, 선별된 폴리펩타이드는 자연계에 존재하는 보체 단백 분해 산물 C3a의 수용체 (complement component 5a recpetor) 보다도 보체 단백 분해 산물 C3a에 대한 결합력이 낮은 수준이어서(도 3), 상기 선별된 폴리펩타이드에 돌연변이를 가하여 보체 단백 분해 산물 C3a에 대한 결합력이 향상된 변이 폴리펩타이드를 제작하고자 하였다. 이를 위하여, 상기 선별된 서열번호 3을 대상으로 LRRV4 모듈에 위치한 아미노산 잔기 4개를 돌연변이 시킨 두 번째 라이브러리를 구축하고(도 4), 상기 두 번째 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 보체 단백 분해 산물 C3a에 대한 결합력이 증대된 신규한 폴리펩타이드(서열번호 4)를 2차 선별하였다 (도 5). 선별된 각 클론에 대하여 등온열량적정기 (Isothermal titration calorimetry)를 이용하여 보체 단백 분해 산물 C3a에 대한 결합력을 측정하였으며 (도 6), 이 중 서열번호 4의 폴리펩타이드가 보체 단백 분해 산물 C3a에 대한 결합력이 가장 높은 클론임이 확인되었고, 그 결합력은 150 nM 인 것으로 확인하였다.
그러나, 선별된 보체 단백 분해 산물 C3a에 결합하는 폴리펩타이드는 자연계에 존재하는 보체 단백 분해 산물 C3a 수용체보다 낮은 결합력을 가지기 때문에 생물학적 효능이 낮을 것으로 예상된다. 이에, 본 발명자들은 보체 단백 분해 산물 C3a와의 결합능이 더욱 개선됨과 동시에 생물학적 효능을 갖을 수 있는 리피바디를 확보하기 위하여, 서열번호 4를 기반으로 하여 LRR1과 LRRV1 모듈에 존재하는 총 6 개의 아미노산 잔기를 돌연변이 시킨 네 번째 라이브러리를 구축하였다(도 7).
상기 세 번째 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 보체 단백 분해 산물 C3a에 대한 결합력이 증대된 2개의 서로 다른 폴리펩타이드(서열번호 5, 서열번호 6)를 선별하였으며, 이 중 증대된 0.6 nM의 가장 높은 결합력을 지닌 리피바디 형태의 신규한 폴리펩타이드 (서열번호 5)를 최종적으로 선별하였다.
따라서, 본 발명은 일 관점에서, 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드로, i) 88번 트레오닌이 메티오닌으로 치환; ii) 91번 이소류신이 류신으로 치환; iii) 93번 트레오닌이 메티오닌으로 치환; iv) 94번 글라이신이 프롤린으로 치환; v) 99번 세린이 이소류신으로 치환; vi) 116번 발린이 트립토판으로 치환; vii) 117번 글루탐산이 히스티딘으로 치환;으로 구성된 군에서 선택되는 하나 또는 둘 이상의 아미노산 변이를 포함하는 것을 특징으로 하는, 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드를에 관한 것이다.
본 발명에 있어서, 상기 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR 패밀리 단백질의 N-말단은 인터날린 단백질의 N-말단인 것을 특징으로 할 수 있고, 상기 인터날린 단백질은 바람직하게는 인터날린 A, 인터날린 B, 인터날린 C, 인터날린 H 및 인터날린 J로 이루어진 군에서 선택되는 것을 특징으로 할 수 있으며, 더욱 바람직하게는 인터날린 B 단백질인 것을 특징으로 할 수 있다.
본 발명의 용어 "인터날린 B 단백질"이란, 리스테리아 (Listeria) 균주에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 다른 소수성 코어가 전 분자에 걸쳐서 일정하게 분포되어 있는 다른 LRR 패밀리 단백질들과는 다른 유형의 N-말단 구조 때문에 미생물에서도 안정적으로 발현되는 것으로 알려져 있다. 이러한 인터날린 단백질의 N-말단은 반복 모듈의 접힘 (Folding)에 가장 중요한 N-말단 부위가 미생물 유래일 뿐 아니라 그 형태가 알파 나선을 포함하는 더욱 안정적인 구조를 포함하므로, 미생물에서 LRR 패밀리 단백질들의 안정적인 발현을 위하여 효과적으로 사용될 수 있다.
본 발명의 용어, "인터날린 단백질의 N-말단"은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 의미하며 알파 나선형 캡핑 모티프 (capping motif) 및 인터날린 단백질의 반복 모듈을 의미한다. 인터날린 단백질의 N-말단은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단은 제한 없이 포함되나, 그 예로 알파 나선형 캡핑 모티프인 "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE"(서열번호 11) 및 반복 모듈을 포함할 수 있다. 바람직하게 반복 모듈 패턴은 "LxxLxxLxLxxN" (서열번호 12)을 포함할 수 있다. 상기 반복 모듈 패턴 중 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌, x는 친수성 아미노산을 의미한다. 인터날린 단백질의 N-말단은 융합될 수 있는 LRR 패밀리 단백질의 종류에 따라 높은 구조 유사도를 갖는 N-말단이 선택될 수 있으며 결합 에너지 등의 계산을 통해 가장 안정적인 아미노산을 선택하여 해당 모듈의 아미노산의 변이가 가능하다.
본 발명의 용어 "가변 림프구 수용체 (Variable Lymphocyte Receptor, VLR)"란, 먹장어와 칠성 장어에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 먹장어와 칠성 장어에서 면역 기능을 수행하는 단백질로서 다양한 항원 물질에 결합할 수 있는 골격으로 유용하게 사용될 수 있다. 상기 인터날린 B 단백질의 N-말단 및 VLR 단백질이 융합된 폴리펩타이드는 인터날린 B 단백질이 융합되지 않은 VLR 단백질보다 수용성 및 발현양이 증가하므로, 이를 기반으로 한 신규한 단백질 치료제의 제조에 사용될 수 있다.
본 발명의 용어 "LRR (Leucine rich repeat) 단백질"이란, 루이신이 일정한 위치에 반복되는 모듈의 조합으로 이루어진 단백질을 의미하는 것으로, (i) 하나 이상의 LRR 반복 모듈을 갖고 있고, (ii) 상기 LRR 반복 모듈은 20 내지 30개의 아미노산으로 이루어져 있고, (iii) LRR 반복 모듈은 보존 패턴으로 "LxxLxxLxLxxN"을 갖고 있으며, 여기서 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 및 트립토판과 같은 소수성 아미노산을, N은 아스파라진, 글루타민, 세린, 시스테인 또는 쓰레오닌을, x는 모든 종류의 20가지의 아미노산을 의미하며, (iv) LRR 패밀리 단백질은 말발굽과 같은 삼차원 구조를 갖는 구조를 갖고 있는 단백질을 의미한다. 본 발명의 LRR 패밀리 단백질은 이미 그 서열이 알려져 있거나, 생체에서 새로 유도된 mRNA나 cDNA를 이용하여 찾아낸 것뿐 아니라, 컨센서스 디자인 (Consensus design) 등의 설계를 통하여 자연계에 알려지지 않은 서열을 가지면서 반복모듈의 골격 구조가 있는 변이체를 모두 포함할 수 있다.
본 발명의 용어 "리피바디 (Repebody)"란, LRR 구조를 갖는 상기 인터날린의 N-말단과 상기 VLR의 구조의 유사성을 바탕으로 융합하여 컨센서스 디자인으로 최적화시킨 폴리 폴리펩타이드이다. 리피바디 단백질은 구조상 오목한 지역 (Concave) 와 볼록한 지역 (Convex) 으로 나누어 질 수 있다. 여기서 오목한 지역은 서열의 다양성이 높으며 단백질 상호작용에 중요한 부위로 알려져 있다. 이와 반대로 볼록한 지역은 보존성이 높은 서열을 바탕으로 단백질의 전체구조를 안정하게 유지하는 역할을 수행한다. 리피바디 단백질은 반복 모듈을 갖는 LRR 패밀리에 속하는 모든 단백질을 상기 방법으로 수용성 발현 및 단백질의 생물리화학적 성질을 향상 시킨 모든 융합 LRR 패밀리 단백질을 모두 포함할 수 있다.
본 발명에 있어서, 상기 폴리펩타이드는 서열번호 3 내지 5 중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 폴리펩타이드는 보체 단백 분해 산물 C3a에 결합하여 그의 활성을 저해하는 것을 특징으로 할 수 있다.
본 발명은 다른 관점에서, 상기 폴리펩타이드를 코딩하는 폴리뉴클레오타이드에 관한 것이다.
본 발명에서 있어서, 상기 폴리뉴클레오타이드는 특별히 이에 제한되지 않으나, 상기 서열번호 3 내지 5 중 어느 하나의 아미노산 서열을 코딩하는 폴리뉴클레오타이드가 될 수 있고, 상기 폴리뉴클레오타이드와 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상의 상동성을 가지는 염기 서열을 가지는 폴리뉴클레오타이드일 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명은 또다른 관점에서, 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터에 관한 것이다.
본 발명의 용어 "벡터"는 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절 서열에 작동 가능하게 연결된 상기 목적 단백질을 암호화하는 폴리뉴클레오타이드의 염기서열을 함유하는 DNA 제조물을 의미한다. 상기 조절 서열은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 및 전사 및 해독의 종결을 조절하는 서열을 포함한다. 벡터는 적당한 숙주 내로 형질 전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 발명에서 사용되는 벡터는 숙주 중에서 복제 가능한 것이면 특별히 한정되지 않으며 당 업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 파지미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, λMBL3, λMBL4, λIXII, λASHII, λAPII, λt10, λt11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 본 발명에서 사용 가능한 벡터는 특별히 제한되는 것이 아니며 공지된 발현 벡터를 사용할 수 있다. 바람직하게는 pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a 벡터 등을 사용할 수 있다. 가장 바람직하게는 pET-21a, pET-32a 벡터를 사용할 수 있다.
본 발명은 다른 관점에서, 상기 폴리뉴클레오타이드 또는 상기 폴리뉴클레오타이드를 포함하는 재조합 벡터가 도입되어 있는 재조합 미생물에 관한 것이다.
본 발명의 용어 "재조합 미생물"이란, 하나 이상의 목적 단백질을 암호화하는 유전자를 갖는 벡터가 숙주세포에 도입되어 목적 단백질을 발현시키도록 형질이 감염된 세포를 의미하며, 진핵세포, 원핵세포 등의 모든 세포가 될 수 있는데, 특별히 이에 제한되지 않으나, 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류 세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO, COS, NSO, 293, 보우 멜라노마 세포 등의 동물 세포; 또는 식물 세포가 될 수 있다. 본 발명에서 사용 가능한 숙주세포는 특별히 제한되는 것이 아니나, 바람직하게는 대장균을 숙주 세포로 사용할 수 있다. 가장 바람직하게는 대장균 BL21(DE3), OrigamiB(DE3)를 숙주 세포로 사용할 수 있다.
본 발명에서 용어 "형질전환"이란, 표적 단백질을 암호화하는 폴리뉴클레오타이드를 포함하는 벡터를 숙주 세포 내에 도입하여 숙주 세포 내에서 상기 폴리뉴클레오타이드가 암호화하는 단백질이 발현할 수 있도록 하는 것을 의미한다. 형질 전환된 폴리뉴클레오타이드는 숙주 세포 내에 발현될 수 있기만 한다면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하든지 상관없이 이들 모두를 포함한다. 또한, 상기 폴리뉴클레오타이드는 표적 단백질을 암호화하는 DNA 및 RNA를 포함한다. 상기 폴리뉴클레오타이드는 숙주세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로 도입되는 것이든 상관없다. 예를 들면, 상기 폴리뉴클레오타이드는, 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트 (Expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오타이드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결 신호, 리보좀 결합부위 및 번역 종결신호를 포함한다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오타이드는 그 자체의 형태로 숙주세포에 도입되어, 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있다.
본 발명은 또 다른 관점에서, (i) 상기 재조합 미생물을 배양하여 상기 폴리펩타이드를 발현시키는 단계; 및 (ii) 상기 배양된 재조합 미생물 또는 배양물로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는 폴리펩타이드의 제조방법에 관한 것이다.
본 발명에 있어서, 상기 재조합 미생물을 배양하는 단계는 특별히 이에 제한되지 않으나, 공지된 회분식 배양방법, 연속식 배양방법, 유가식 배양방법 등에 의해 수행됨이 바람직하고, 배양조건은 특별히 이에 제한되지 않으나, 염기성 화합물(예: 수산화나트륨, 수산화칼륨 또는 암모니아) 또는 산성 화합물(예: 인산 또는 황산)을 사용하여 적정 pH(pH 5 내지 9, 바람직하게는 pH 6 내지 8, 가장 바람직하게는 pH 6.8)를 조절할 수 있고, 산소 또는 산소-함유 가스 혼합물을 배양물에 도입시켜 호기성 조건을 유지할 수 있으며, 배양온도는 20 내지 45℃, 바람직하게는 25 내지 40℃를 유지할 수 있고, 약 10 내지 160 시간동안 배양함이 바람직하다. 상기 배양에 의하여 생산된 상기 폴리펩타이드는 배지중으로 분비되거나 세포내에 잔류할 수 있다.
아울러, 사용되는 배양용 배지는 탄소 공급원으로는 당 및 탄수화물(예: 글루코오스, 슈크로오스, 락토오스, 프럭토오스, 말토오스, 몰라세, 전분 및 셀룰로오스), 유지 및 지방(예: 대두유, 해바라기씨유, 땅콩유 및 코코넛유), 지방산(예: 팔미트산, 스테아르산 및 리놀레산), 알콜(예: 글리세롤 및 에탄올) 및 유기산(예: 아세트산) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 질소 공급원으로는 질소-함유 유기 화합물(예: 펩톤, 효모 추출액, 육즙, 맥아 추출액, 옥수수 침지액, 대두 박분 및 우레아), 또는 무기 화합물(예: 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있으며; 인 공급원으로서 인산 이수소칼륨, 인산수소이칼륨, 이에 상응하는 나트륨 함유 염 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 기타 금속염(예: 황산마그네슘 또는 황산철), 아미노산 및 비타민과 같은 필수성장-촉진 물질을 포함할 수 있다.
본 발명의 상기 배양 단계에서 생산된 폴리펩타이드를 회수하는 방법은 배양방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 분야에 공지된 적합한 방법을 이용하여 배양액으로부터 목적하는 폴리펩타이드를 수집할 수 있다.
본 발명은 또 다른 관점에서, 상기 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드 및 혈관 내피세포 성장인자(VEGF)에 특이적으로 결합하는 리피바디가 융합된 이중 결합 리피바디(bispecific repebody)에 관한 것이다.
본 발명에 있어서, 상기 이중결합 리피바디는 서열번호 7 또는 8의 아미노산 서열로 표시되는 것을 특징으로 할 수 있다.
본 발명은 또 다른 관점에서, 상기 폴리펩타이드 또는 이중 결합 리피바디를 유효성분으로 함유하는 면역 질환 예방 또는 치료용 조성물에 관한 것이다.
본 발명에 있어서, 상기 면역 질환 예방 또는 치료는 상기 폴리펩타이드가 보체 단백 분해 산물 C3a과 결합하여 이루어지는 것을 특징으로 할 수 있다.
본 발명에서 용어 "면역 질환"은 면역 체계에 이상이 생겨 발생하는 질환을 의미하는 것이다. 본 발명에서의 면역 질환은, 자가면역 질환이면 모두 해당되나, 바람직하게는 류마티스 관절염, 전신성홍반성낭창, 쇼그렌 증후군, 베체트 증후군, 건선, 경파증, 강직성 척추염, 다발성 경화증, 길랑바레 증후군, 백혈병, 그레이브스 병, 크론병, 실리악병, 베게너육아종증, 근육성 이영양증, 포도막염, 타키야수 동맥염, 측두 동맥염, 재발성 다발 연골염, 다발성 경화증, 척-스트라우스 증후군, 헤노흐-쇤라인 자반증, 굿파스처 증후군, 타입1 당뇨병, 아프타구내염, 천포창 및 췌양성 대장염으로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 한정되는 것은 아니다.
본 발명에서 용어 "치료"란 조성물의 투여로 면역 질환이나 그로부터 야기된 하나 또는 그 이상의 증상을 억제하거나 완화하는 것뿐만 아니라 질환의 증상을 반전시키는 암의 치료 또는 암의 진행을 방지하는 것을 의미한다. 본 발명에서 용어 "예방"이란 조성물의 투여로 면역 질환을 억제시키거나 발병을 지연시키는 모든 행위를 의미한다. 본 발명에서 면역 질환의 예방 또는 치료는 본 발명에서 확보한 폴리펩타이드가 보체 단백 분해 산물 C3a과 결합하여 이루어지는 것으로, 보체 단백 분해 산물 C3a에 결합하여 그의 활성을 유의하게 억제하여 면역 질환을 예방 또는 치료하는 것이다.
본 발명의 상기 폴리펩타이드 또는 이중 결합 리피바디를 유효성분으로 함유하는 면역 질환 예방 또는 치료용 조성물은 약학적으로 허용 가능한 담체를 추가로 포함할 수 있으며, 담체와 함께 제제화될 수 있다.
본 발명에서 용어, "약학적으로 허용 가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 허용되는 약제학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다.
본 발명의 상기 폴리펩타이드 및 약학적으로 허용 가능한 담체를 포함하는 면역 질환 예방 또는 치료용 조성물은 이를 유효성분으로 포함하는 어떠한 제형으로도 적용가능하며, 경구용 또는 비경구용 제형으로 제조할 수 있다. 본 발명의 약학적 제형은 구강(oral), 직장(rectal), 비강(nasal), 국소(topical; 볼 및 혀 밑을 포함), 피하, 질(vaginal) 또는 비경구(parenteral; 근육내, 피하 및 정맥내를 포함) 투여에 적당한 것 또는 흡입 (inhalation) 또는 주입(insufflation)에 의한 투여에 적당한 형태를 포함한다.
본 발명의 조성물을 유효성분으로 포함하는 경구 투여용 제형으로는, 예를 들어 정제, 트로키제, 로렌지, 수용성 또는 유성현탁액, 조제분말 또는 과립, 에멀젼, 하드 또는 소프트 캡슐, 시럽 또는 엘릭시르제로 제제화할 수 있다. 정제 및 캡슐 등의 제형으로 제제화하기 위해, 락토오스, 사카로오스, 솔비톨, 만니톨, 전분, 아밀로펙틴, 셀룰로오스 또는 젤라틴과 같은 결합제, 디칼슘 포스페이트와 같은 부형제, 옥수수 전분 또는 고구마 전분과 같은 붕괴제, 스테아르산 마스네슘, 스테아르산 칼슘, 스테아릴푸마르산 나트륨 또는 폴리에틸렌글리콜 왁스와 같은 윤활유를 포함할 수 있으며, 캡슐제형의 경우 상기 언급한 물질 외에도 지방유와 같은 액체 담체를 더 함유할 수 있다.
본 발명의 조성물을 유효성분으로 포함하는 비경구 투여용 제형으로는, 피하주사, 정맥주사 또는 근육내 주사 등의 주사용 형태, 좌제 주입방식 또는 호흡기를 통하여 흡입이 가능하도록 하는 에어로졸제 등 스프레이용으로 제제화할 수 있다. 주사용 제형으로 제제화하기 위해서는 본 발명의 조성물을 안정제 또는 완충제와 함께 물에서 혼합하여 용액 또는 현탁액으로 제조하고, 이를 앰플 또는 바이알의 단위 투여용으로 제제화할 수 있다. 좌제로 주입하기 위해서는, 코코아버터 또는 다른 글리세라이드 등 통상의 좌약 베이스를 포함하는 좌약 또는 관장제와 같은 직장투여용 조성물로 제제화할 수 있다. 에어로졸제 등의 스프레이용으로 제형화하는 경우, 수분산된 농축물 또는 습윤 분말이 분산되도록 추진제 등이 첨가제와 함께 배합될 수 있다.
본 발명은 또 다른 관점에서, 상기 폴리펩타이드를 유효성분으로 함유하는 면역 질환 예방 또는 치료용 조성물을 투여하는 것을 포함하는, 면역 질환을 예방 또는 치료하는 방법에 관한 것이다.
본 발명에서 용어, "투여"는 어떠한 적절한 방법으로 환자에게 본 발명의 약제학적 조성물을 도입하는 것을 의미한다. 본 발명의 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 경구 또는 비경구의 다양한 경로를 통하여 투여될 수 있으며, 구체적으로, 구강, 직장, 국소, 정맥내, 복강내, 근육내, 동맥내, 경피, 비측내, 흡입, 안구 내 또는 피내경로를 통해 통상적인 방식으로 투여될 수 있다.
본 발명의 치료방법은 본 발명의 면역 질환 예방 또는 치료용 조성물을 약학적 유효량으로 투여하는 것을 포함한다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있다는 것은 당업자에게 자명한 일이다. 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다. 따라서 본 발명의 목적에 적합한 암의 예방 또는 치료용 조성물의 유효량은 전술한 사항을 고려하여 결정하는 것이 바람직하다.
또한, 본 발명의 치료 방법은 보체 단백 분해 산물 C3a의 과도한 활성으로 인하여 질병이 발생할 수 있는 임의의 동물에 적용가능하며, 동물은 인간 및 영장류뿐만 아니라, 소, 돼지, 양, 말, 개 및 고양이 등의 가축을 포함한다.
실시예
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지는 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1: 단백질 구조 기반의 리피바디 라이브러리 구축
리피바디는 자연계에 존재하는 LRR 단백질들과 마찬가지로 보존된 루이신 서열을 갖는 반복 단위체 (Repeat unit)가 연속적으로 연결되어 전체 단백질 구조를 유지하는 모듈성과 전체 구조의 모양의 곡률로 인한 오목한 지역 (concave region)과 볼록한 지역 (convex region)으로 구별되는 구조적 특징을 갖는다. 상기 오목한 지역에는 항체의 상보결정지역 (complementarity determining region; CDR)처럼 초가변영역 (hypervariable region)이 위치하여, 단백질-단백질 상호작용을 매개한다. 또한, 볼록한 지역은 잘 보존되어 있는 서열을 바탕으로 LRR의 전체 구조를 유지하는데 중요한 역할을 한다. 이러한 리피바디의 단백질 구조를 분석하여 하기와 같은 방식으로 무작위적인 라이브러리를 설계하였다.
구체적으로, 아민기말단 방향에 위치한 연속적인 두 개의 모듈 (LRRV2, LRRV3 module)의 오목한 지역에 위치하는 여섯 아미노산 잔기 91, 93, 94, 115, 117, 118번을 선택하여 무작위적인 돌연변이 라이브러리를 구축하였다(도 1).
그런 다음, 상기 선택한 아미노산을 NNK 동의코돈 (degenerate codon)으로 치환하도록, 라이브러리 구축을 위한 돌연변이 유발 프라이머 (mutagenic primer)를 합성하였다. 프라이머 서열은 아래와 같다.
서열번호 13 M1: CTG CCG AAT GGC GTC TTT GAT AAA CTG ACG AAC CTG AAA GAA CTG NNK CTG NNK NNK AAT CAA CTG CAG TCT CTG CCG GAC
서열번호 14 M2: CGT CAG TTT ATC AAA GAC GCC ATT CGG CAG GCT CTG CAG TTG GTT MNN MNN CAG MNN CAG ATA CGT CAG ATT GGT CAG TTC
이어, 상기 프라이머들을 이용하여 두 모듈에 대한 겹침 중합효소 연쇄 반응 (overlap PCR)을 수행하며 라이브러리 DNA를 수득하고, 본 발명자의 선행 특허 (대한민국 등록특허 제1,356,075호)에 기술된 서열번호 2의 파지미드 pBEL118M에 삽입하여 최종적인 라이브러리 파지미드를 확보하였다.
상기 확보된 라이브러리를 전기천공법 (electroporation)으로 대장균 TG-1에 도입하여 형질전환체를 수득함으로써, 2.0x108 수준의 다양성을 갖는 라이브러리를 구축하였다.
실시예 2: 무작위적인 파지 라이브러리를 통한 C3a와 특이적으로 결합하는 폴리펩타이드 선별
실시예 2-1: 리피바디 라이브러리의 패닝 과정을 통한 C3a와 결합하는 폴리펩타이드 선별
상기 선행특허에서 구축한 라이브러리를 사용하여 보체 단백 분해 산물 C3a에 결합할 수 있는 폴리펩타이드를 선별하여 정제하였다. 보체 단백 분해 산물 C3a와 결합할 수 있는 후보를 선별하기 위하여, 보체 단백 분해 산물 C3a를 면역튜브 (Immuno-tube)에 50 ㎍/㎖의 농도로 가하고, 4 ℃에서 12시간동안 코팅하였다. 상기 코팅된 면역튜브를 PBS로 3회 세척하고, 1% BSA와 0.05 % Tween 20을 포함하는 PBS 용액 (TPBSA)으로 4 ℃에서 2시간동안 블로킹(Blocking) 하였다.
상기 정제된 파지를 1012 cfu/ml의 농도로 상기 코팅된 면역튜브에 가하고, 상온에서 2시간 반응시켰다. 반응이 종료된 후, 0.05% Tween 20을 포함하는 PBS 용액 (TPBS)으로 총 2분간 5번씩 및 PBS로 2번 세척하였다. 마지막으로, 1 ml 0.2 M Glycine-HCl (pH 2.2)를 상기 면역튜브에 가하고, 상온에서 13분간 반응시킴으로써, 보체 단백 분해 산물 C3a와 결합할 수 있는 리피바디 후보를 표면에 발현시킨 파지를 용출시켰다.
상기 용출액에 60 ㎕의 1.0 M Tris-HCl (pH 9.0)를 가하여 중화시키고, 숙주세포인 9 ml 대장균 XL1-Blue 용액 (OD 600 = 0.6)에 가한 다음, 2xYT 플레이트에 도말하는 바이오패닝 (Bio-panning) 과정을 동일하게 4회 반복하여 수행하였다. 그 결과, 각 패닝 과정을 통해 보체 단백 분해 산물 C3a와 특이적으로 결합하는 파지가 농축됨을 확인하였다. 상기 결과는 보체 단백 분해 산물 C3a와 결합하는 라이브러리 파지가 특이적으로 증가함을 의미하는 것으로 분석되었다.
실시예 2-2: 선별된 리피바디의 보체 단백 분해 산물 C3a에 대한 특이적인 결합여부 확인 및 서열 분석
실시예 2-1의 방법을 통하여 선별된 파지를 보체 단백 분해 산물 C3a와 BSA가 코팅된 96-웰 플레이트를 이용하여 ELISA를 수행함으로써, BSA 대비 보체 단백 분해 산물 C3a의 흡광도(OD 450)가 8배 이상 높은 리피바디 후보들을 선별하고 (도 2), 이들 각각의 아미노산 서열을 확인한 후, 동일한 아미노산 서열을 갖는 클론을 제외 하였다. 그 결과, 상기 선별된 파지에서 총 4 종류의 리피바디 서열을 확인하였으며, 등온열량측정기를 이용하여 해리상수를 측정한 결과, 클론 H12는 약 637 nM의 결합력으로 보체 단백 분해 산물 C3a에 결합함을 확인하였다 (도 3). H12는 91번 아미노산인 이소류신이 류신으로 치환되고, 93번 아미노산인 트레오닌이 메티오닌으로 치환되며, 94번 아미노산인 글리신이 프롤린으로 치환되고, 114번 아미노산인 발린은 발린이 유지되고, 116번 아미노산인 발린이 트립토판으로 치환되며, 117번 아미노산인 글루탐산이 히스티딘으로 치환되었음을 확인하였다 (서열번호 3). 추가적으로, 라이브러리를 구축하지 않은 88번의 트레오닌이 메티오닌으로, 99번의 세린이 이소류신이 치환되었음을 확인하였다.
상기 결과는 보체 단백 분해 산물 C3a와 결합하는데 중요한 역할을 수행하는 잔기가 존재함을 의미하는 것으로 분석되었다.
실시예 3: 모듈 기반 방법을 이용한 리피바디의 C3a에 대한 결합력 증대 수행
본 발명에서 기술된 모듈 기반 친화력 증대 방식은 선행특허(KR2012-0019927)에 따라 수행하였다. 해당 방법은 반복 모듈을 갖는 단백질에 대해 보편적으로 사용할 수 있는 기술로써, 본 특허에서 성공적으로 재현되어 높은 수준의 친화력을 갖는 단백질 설계를 가능하게 하였다.
실시예 3-1: 모듈을 이용한 추가적인 라이브러리 구축 및 결합력 증가 확인 및 다른 단백질에 대한 교차결합여부 확인
실시예 2-2의 결과에서 보체 단백 분해 산물 C3a에 특이적으로 결합하는 것이 확인된 클론인 H12의 보체 단백 분해 산물 C3a에 대한 해리상수는 637 nM이지만(도 2), 자연적으로 존재하는 보체 단백 분해 산물 C3a 수용체의 보체 단백 분해 산물 C3a에 대한 해리상수는 1 nM 수준이다. 따라서, 본 발명의 리피바디 후보로는 보체 단백 분해 산물 C3a의 활성을 충분히 억제할 수 없을 것으로 예상되었다.
이러한 문제점을 해결하고자, 추가적인 라이브러리 구축방법을 이용하여 결합력이 향상된 돌연변이체를 개발하고자 하였다.
구체적으로, 첫 번째 모듈 기반 친화력 증대를 위한 라이브러리는 LRRV4 모듈의 총 4개 아미노산 잔기를 돌연변이 시켜(도 4), 총 5번의 패닝과정을 거쳐서 결합력이 증대된 F6(서열번호 4)를 확보하였으며(도 5), 등온열량측정기를 이용하여 해리 상수를 측정한 결과, 보체 단백 분해 산물 C3a에 대해 150 nM의 결합력을 가지는 것을 확인하였다(도 6). F6는 137번 타이로신이 아르기닌으로 치환되고, 139번 아스파라긴이 라이신으로 치환되며, 141번 알라닌이 아스파라긴으로, 142번 히스티딘이 글리신으로 치환되었음을 확인하였다.
한편, 더욱 향상된 결합력을 나타내는 돌연변이체를 개발하기 위해서 F6를 기본 폴리펩타이드로 하여 LRRV1 및 LRR1 모듈의 총 여섯 개의 잔기를 돌연변이 시킨 후(도 7), 동일한 패닝과정을 거쳐, E10(서열번호 5)과 C9(서열번호 6)을 선별하였다. E10은 47번 이소류신이 타이로신으로 치환되고, 49번 아스파라긴이 트레오닌으로, 50번 아스파라긴이 세린으로 치환되었으며, 69번 알라닌, 71번과 72번 글리신은 그대로 유지되었다. 추가적으로, 139번 아스파라긴이 글루타민으로 치환되었으며, 142번 글리신이 아스파라긴으로 치환되었다. C9는 47번 이소류신이 류신으로 치환되고, 49번 아스파라긴이 류신으로 치환되었고, 50번 아스파라긴은 그대로 유지되었으며, 69번 알라닌과 71번 글리신은 발린으로 치환되고, 72번 글리신은 세린으로 치환되었다. 추가적으로, 139번 아스파라긴이 글루타민으로 치환되었으며, 142번 글리신이 아스파라긴으로 치환되었다. 등온열량측정기를 이용하여 해리 상수를 측정한 결과, E10이 보체 단백 분해 산물 C3a에 대해 0.6 nM의 가장 높은 결합력을 가지는 것을 확인하였다(도 9). 이는 초기 선별된 H12와 비교 했을 때 결합력이 약 1,000배 향상된 결과이다.
이러한 결과를 통해 본 발명자는 자연적으로 존재하는 보체 단백 분해 산물 C3a의 수용체보다 높은 결합력을 갖는 리피바디를 성공적으로 확보하였으며, 이는 보체 단백 분해 산물 C3a에 특이적인 결합력을 갖는 폴리펩타이드임을 확인하였다.
실시예 4: 선별된 리피바디의 다른 단백질들에 대한 교차결합 여부 확인
자연적으로 존재하는 보체 단백 분해 산물 C3a는 보체 단백 분해 산물 C5a과 43.6 %의 높은 서열 유사성을 지니고 있다. 따라서, 선별한 E10 리피바디가 특이적으로 C3a에만 강한 결합력을 보이는지 확인하기 위해 보체 단백 분해 산물 C5a (RnD Systems, USA) 및 BSA와의 교차결합 여부를 확인하는 실험을 수행하였다.
각각의 단백질을 96-웰 플레이트에 코팅 후 E10 리피바디를 디스플레이하고 있는 파지를 가하여 결합 정도를 효소결합 면역침강법 (ELISA)으로 확인한 결과, 선별한 E10 리피바디는 C3a에만 특이적으로 결합하는 것을 확인하였다 (도 11).
이러한 결과를 통해 본 발명자들은, 보체 단백 분해 산물 C3a에 높은 결합력을 갖는 리피바디를 성공적으로 확보하였으며, 이는 표적 단백질인 보체 단백 분해 산물 C3a에 특이적인 결합 능력을 갖는 폴리펩타이드임을 확인하였다.
실시예 5: 선별된 리피바디의 전 염증성 반응 억제 능력 확인
보체 단백 분해 산물 C3a는 염증 반응과 관련이 있고, 특히 인터루킨-6 (Interleukin-6)와 종양괴사인자-알파 (Tumor necrosis factor-α)와 같은 사이토카인의 분비와 관련된 전 염증성 반응을 유도한다고 알려져 있다. 이에 보체 단백 분해 산물 C3a에 특이적으로 결합하는 선별된 리피바디가 전 염증성 반응을 억제할 수 있는지 그 활성을 확인하기 위하여 단핵구로부터의 인터루킨-6 (Interleukin-6)와 종양괴사인자-알파 (Tumor necrosis factor-α)의 생성 및 분비 정도를 측정하는 실험을 수행하였다.
억제 여부를 확인하기 위하여 말초 혈액 단핵세포로부터 분리된 단핵구에 선별된 리피바디를 처리하여, 처리 전 후의 인터루킨-6 (Interleukin-6)와 종양괴사인자-알파 (Tumor necrosis factor-α)의 생성 정도를 효소면역침강법 (ELISA)를 통해 분석한 결과, 리피바디가 처리됨에 따라 인터루킨-6 (Interleukin-6)와 종양괴사인자-알파 (Tumor necrosis factor-α)의 생성 정도가 감소되는 것을 확인하였다(도 12).
실시예 6: 이중 결합 복합체로서의 결합 가능성 확인
실시예 6-1: 이중 결합 복합체 제조
대한민국 특허 제10-1713944-0000호에 기재된 혈관 내피세포 성장인자 (VEGF)에 특이적으로 결합하는 리피바디를 본 발명에서 개발한 보체 단백 분해 산물 C3a에 특이적으로 결합하는 리피바디 E10와 GGGGS 링커 서열을 융합한 복합체를 포함한 pET21a 발현 벡터(Novagen, USA)를 제조하였다. 두 리피바디 사이에 링커를 2개 융합 시킨 것 (X2)과, 4개 융합시킨 것 (X4) 총 두 가지를 제조하였으며, 이를 대장균에서 발현시켜, C2-X2-E10과 C2-X4-E10 복합체 (서열번호 7; 서열번호 8)를 제조하였다 (도 13).
또한, 같은 전략으로 대한민국 특허 제10-1624702-0000호에 기재된 보체 단백질 C5a와 결합하는 리피바디를 본 발명에서 개발한 보체 단백 분해 산물 C3a에 특이적으로 결합하는 리피바디 E10과 GGGGS 링커 서열을 융합한 복합체를 포함한 pET21a 발현 벡터(Novagen, USA)를 제조하였다. 두 리피바디 사이에 링커를 2개 융합 시킨 것 (X2)과, 4개 융합시킨 것 (X4) 총 두 가지를 제조하였으며, 이를 대장균에서 발현시켜, E8-X2-E10과 E8-X4-E10 복합체 (서열번호 9; 서열번호 10)를 제조하였다 (도 14).
실시예 6-2: 이중 결합 복합체의 이중 결합 여부 분석
이중 결합 여부를 확인하기 위하여 상기 복합체를 보체 단백 분해 산물 C3a 및 혈관 내피세포 성장인자 (VEGF)에 동시에 노출시켜 효소면역침강법 (ELISA)으로 이중 결합 여부를 확인한 결과, 복합체는 보체 단백 분해 산물 C3a 및 혈관 내피세포 성장인자 (VEGF) 모두에 동시에 결합함을 확인하였다 (도 15).
이중 결합 여부를 확인하기 위하여 상기 복합체를 보체 단백 분해 산물 C3a 및 보체 단백질 C5a에 동시에 노출시켜 효소면역침강법 (ELISA)으로 이중 결합 여부를 확인한 결과, 복합체는 보체 단백 분해 산물 C3a 및 보체 단백질 C5a 모두에 동시에 결합함을 확인하였다 (도 16).
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
본 발명의 보체 단백 분해 산물 C3a에 결합하는 신규한 폴리펩타이드는 자연계에 존재하는 보체 단백 분해 산물 C3a 수용체보다 높은 친화력으로 보체 단백 분해 산물 C3a에 결합하여 그의 활성을 억제함으로써 보체 단백 분해 산물 C3a와 연관된 다양한 질환의 예방 또는 치료용 제제의 개발에 널리 활용될 수 있어 유용하다.
전자파일 첨부하였음.

Claims (17)

  1. 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR (Leucine rich repeat) 패밀리 단백질의 N-말단과 VLR(Variable Lymphocyte Receptor) 단백질의 변형된 반복모듈 및 VLR 단백질의 C-말단이 융합되어 있는 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드로, 서열번호 2로 표시되는 아미노산 서열에서 하기의 군으로부터 선택되는 하나 또는 둘 이상의 아미노산 변이를 포함하는 것을 특징으로 하는, 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드:
    i) 47번 이소류신이 타이로신 또는 류신으로 치환;
    ii) 49번 아스파라긴이 트레오닌 또는 류신으로 치환;
    iii) 50번 아스파라긴이 세린으로 치환;
    iv) 69번 알라닌이 발린으로 치환;
    v) 71번 글리신이 발린으로 치환;
    vi) 72번 글리신이 세린으로 치환;
    vii) 88번 트레오닌이 메티오닌으로 치환;
    viii) 91번 이소류신이 류신으로 치환;
    ix) 93번 트레오닌이 메티오닌으로 치환;
    x) 94번 글라이신이 프롤린으로 치환;
    xi) 99번 세린이 이소류신으로 치환;
    xii) 116번 글루탐산이 히스티딘으로 치환;
    xiii) 137번 타이로신이 아르기닌으로 치환;
    xiv) 139번 아스파라긴이 글루타민 또는 라이신으로 치환;
    xv) 141번 알라닌이 아스파라긴으로 치환; 및
    xvi) 142번 히스티딘이 글리신 또는 아스파라긴으로 치환
  2. 제1항에 있어서, 상기 알파 나선형 캡핑 모티프 (capping mofit)를 가지는 LRR 패밀리 단백질의 N-말단은 인터날린 단백질의 N-말단인 것을 특징으로 하는, 체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드.
  3. 제2항에 있어서, 상기 인터날린 단백질은 인터날린 A, 인터날린 B, 인터날린 C, 인터날린 H 및 인터날린 J로 이루어진 군에서 선택되는 것을 특징으로 하는, 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드.
  4. 제3항에 있어서, 상기 인터날린 단백질은 인터날린 B 단백질인 것을 특징으로 하는, 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드.
  5. 제1항에 있어서,
    상기 VLR 단백질의 변형된 반복모듈은 하기의 반복 모듈 패턴을 포함하는 것을 특징으로 하는, 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드:
    LxxLxxLxLxxN
    상기 패턴에서,
    L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판이고;
    N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌이며 및
    x는 모든 종류의 20개의 아미노산이다.
  6. 제1항에 있어서, 상기 폴리펩타이드는 서열번호 3 내지 5중 어느 하나의 아미노산 서열로 표시되는 것을 특징으로 하는, 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드.
  7. 제1항에 있어서, 상기 폴리펩타이드는 보체 단백 분해 산물 C3a에 결합하여 그의 활성을 저해하는 것을 특징으로 하는 폴리펩타이드.
  8. 제1항의 폴리펩타이드를 코딩하는 폴리뉴클레오타이드.
  9. 제8항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
  10. 제9항의 재조합 벡터가 도입되어 있는 재조합 미생물.
  11. 다음의 단계를 포함하는 보체 단백 분해 산물 C3a에 특이적으로 결합하는 폴리펩타이드의 제조방법:
    (i) 제10항의 재조합 미생물을 배양하여 제1항의 폴리펩타이드를 발현시키는 단계; 및
    (ii) 상기 배양된 재조합 미생물 또는 배양물로부터 제1항의 폴리펩타이드를 회수하는 단계.
  12. 제1항 내지 제7항 중 어느 한 항의 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드 및 혈관 내피세포 성장인자(VEGF)에 특이적으로 결합하는 리피바디가 융합된 이중 결합 리피바디(bispecific repebody).
  13. 제12항에 있어서, 상기 이중 결합 리피바디는 서열번호 7 또는 8의 아미노산 서열로 표시되는 것을 특징으로 하는 이중 결합 리피바디(bispecific repebody).
  14. 제1항 내지 제7항 중 어느 한 항의 보체 단백 분해 산물 C3a에 선택적으로 결합하는 폴리펩타이드 및 보체 단백질 C5a에 특이적으로 결합하는 리피바디가 융합된 이중 결합 리피바디(bispecific repebody).
  15. 제14항에 있어서, 상기 이중 결합 리피바디는 서열번호 9 또는 10의 아미노산 서열로 표시되는 것을 특징으로 하는 이중 결합 리피바디(bispecific repebody).
  16. 제1항의 폴리펩타이드, 제12항의 이중 결합 리피바디 또는 제14항의 이중 결합 리피바디를 유효성분으로 함유하는 면역 질환 예방 또는 치료용 조성물.
  17. 제14항에 있어서, 상기 면역 질환은 류마티스 관절염, 전신성홍반성낭창, 쇼그렌 증후군, 베체트 증후군, 건선, 경파증, 강직성 척추염, 다발성 경화증, 길랑바레 증후군, 백혈병, 그레이브스 병, 크론병, 실리악병, 베게너육아종증, 근육성 이영양증, 포도막염, 타키야수 동맥염, 측두 동맥염, 재발성 다발 연골염, 다발성 경화증, 척-스트라우스 증후군, 헤노흐-쇤라인 자반증, 굿파스처 증후군, 타입 1 당뇨병, 아프타구내염, 천포창 및 췌양성 대장염으로 구성된 군에서 선택되는 것을 특징으로 하는 면역 질환 예방 또는 치료용 조성물.
PCT/KR2021/001646 2020-02-07 2021-02-08 보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도 WO2021158092A2 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2020-0014943 2020-02-07
KR1020200014943A KR102390931B1 (ko) 2020-02-07 2020-02-07 보체 단백 분해 산물 C3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도

Publications (2)

Publication Number Publication Date
WO2021158092A2 true WO2021158092A2 (ko) 2021-08-12
WO2021158092A3 WO2021158092A3 (ko) 2021-09-30

Family

ID=77200338

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/001646 WO2021158092A2 (ko) 2020-02-07 2021-02-08 보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도

Country Status (2)

Country Link
KR (1) KR102390931B1 (ko)
WO (1) WO2021158092A2 (ko)

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101219628B1 (ko) * 2010-03-02 2013-01-10 한국과학기술원 인터날린 단백질의 ｎ-말단 및 ｌｒｒ 패밀리 단백질이 융합된 수용성 융합 폴리펩타이드 및 이의 제조 방법
KR101624702B1 (ko) * 2014-08-01 2016-05-27 한국과학기술원 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도
KR101713944B1 (ko) * 2015-06-19 2017-03-09 한국과학기술원 신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도
MY191756A (en) * 2015-09-23 2022-07-14 Genentech Inc Optimized variants of anti-vegf antibodies

Also Published As

Publication number Publication date
KR20210100945A (ko) 2021-08-18
KR102390931B1 (ko) 2022-04-26
WO2021158092A3 (ko) 2021-09-30

Similar Documents

Publication Publication Date Title
CA2669806C (en) Selective glucagon-like-peptide-2 (glp-2) analogues
CA2111100C (en) Interleukin-1 beta protease and interleukin-1 beta protease inhibitors
JP2614989B2 (ja) 腫瘍壊死因子含有組成物
JP4006021B2 (ja) ケモカインの生物学的活性の強化法
HU229262B1 (en) Hepatitis c inhibitor tri-peptides, process for production thereof, pharmaceutical compositions copmprising thereof, intermediates and their use
BG60256B2 (bg) Рекомбинантен метод за получаване на лимфотоксин
HU209152B (en) Method for producing human interferon protein of high purity and pharmaceutical preparative containing it
WO2012050402A2 (ko) 세포투과성 parkin 재조합 단백질 및 이를 함유하는 퇴행성 뇌질환 치료용 약학적 조성물
SK38998A3 (en) Truncated glial cell line-derived neurotrophic factor
IE70519B1 (en) Novel cytokines
WO2013129852A1 (ko) 신규한 인터루킨-6에 대한 리피바디 및 그 용도
WO2021158092A2 (ko) 보체 단백 분해 산물 c3a와 결합할 수 있는 신규한 폴리펩타이드 및 이의 용도
WO2016018133A9 (ko) 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도
WO2022098220A1 (ko) 인플라마솜 어댑터 단백질(asc)의 중합체화 도메인에 결합하는 신규한 폴리펩타이드 및 이의 용도
WO2019164358A1 (ko) 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
WO2022010319A1 (ko) 글루카곤-유사 펩타이드-1 및 인터루킨-1 수용체 길항제를 포함하는 융합단백질 및 이의 용도
WO2021040336A1 (ko) 사람의 프로그램된 세포사멸 단백질(pd-1)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
US6444202B1 (en) Processed polypeptides with IL-16 activity, processes for their production and their use
JP2675294B2 (ja) ヒト腫瘍壊死因子
WO2016204341A1 (ko) 신규한 혈관내피세포 성장인자와 결합할 수 있는 폴리펩타이드 및 이의 용도
KR100308441B1 (ko) 인터루킨-16활성을갖는프로세싱된폴리펩티드,그의제조방법및용도
WO2022260468A1 (ko) 신규 fgf21 변이체 개발 및 이의 생산기법과 용도
KR102280725B1 (ko) 인간 b 세포 림프종-2 단백질에 선택적으로 결합하는 신규한 폴리펩타이드 및 이의 용도
WO2022015049A1 (ko) ＩｇＥ Ｆｃ 수용체 알파서브유닛의 세포외 도메인 및 항-IL-4R 항체를 포함하는 융합단백질 및 이의 용도
KR20220149174A (ko) 제2형 중증급성호흡기증후군 코로나바이러스의 수용체 결합 도메인 (SARS-CoV2 RBD)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21751345

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21751345

Country of ref document: EP

Kind code of ref document: A2