WO2020218951A2 - Моноклональное антитело, которое специфически связывается с gitr - Google Patents
Моноклональное антитело, которое специфически связывается с gitr Download PDFInfo
- Publication number
- WO2020218951A2 WO2020218951A2 PCT/RU2020/050080 RU2020050080W WO2020218951A2 WO 2020218951 A2 WO2020218951 A2 WO 2020218951A2 RU 2020050080 W RU2020050080 W RU 2020050080W WO 2020218951 A2 WO2020218951 A2 WO 2020218951A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- antibody
- monoclonal antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention relates to the field of biotechnology, in particular to antibodies or antigen-binding fragments thereof, as well as their use. More specifically, the present invention relates to monoclonal antibodies that specifically bind to GITR (Glucocorticoid-induced TNFR-related protein) onyxone TNFRSF18 tumor necrosis factor receptor tumor necrosis). The invention also relates to a nucleic acid encoding a given antibody or antigen-binding fragment thereof, an expression vector, a method for producing the antibody, and the use of the antibody for the treatment of diseases or disorders associated with GITR.
- GITR Glucocorticoid-induced TNFR-related protein
- the invention also relates to a nucleic acid encoding a given antibody or antigen-binding fragment thereof, an expression vector, a method for producing the antibody, and the use of the antibody for the treatment of diseases or disorders associated with GITR.
- TNFRSF18 GITR (English Glucocorticoid-induced TNFR-related protein / glucocorticoid-induced onyxone necrosis factor receptor ⁇ TNFRSF18 / tumor necrosis factor receptor superfamily) is a membrane protein, a receptor from the tumor necrosis factor receptor superfamily.
- GITR is a type I transmembrane protein that consists of 216 amino acids and has a molecular weight of 26 kDa.
- the N-terminal extracellular domain contains 3 TNFR-Cys repeats and an N-glycosylation site.
- the 3 cysteine-rich domains and the cytoplasmic tail of GITR have significant homology to 4-1BB, 0X40 and CD27 (Nocentini, et al. (1997) Proc. Natl. Acad. Sci. 94: 6216-6221).
- GITR Human GITR is expressed at low levels by immunoreactive T cells, with CD4 + cells showing higher expression compared to CD8 + cells. GITR expression is significantly increased for several days after T cell activation. GITR is constantly expressed at high levels in regulatory T cells (Tregs) such as CD4 + CD25 + or CD8 + CD25 + cells, and is further increased upon activation of these cells (Nocentini and Riccardi (2005) E. J. Immunol. 35: 1016)
- GITR is not exclusively limited to T cells. Some studies have also indicated that GITR is expressed by NK cells, macrophages, B cells, dendritic cells, mast cells and monocytes (Nocentini and Riccardi (2005) E. J. Immunol. 35: 1016-1022). GITR is expressed in lymph nodes, peripheral blood leukocytes and, to a lesser extent, in the spleen; it is constitutively expressed in high amounts on Tregs, and in low amounts on naive T cells and memory cells.
- GITR is expressed not only on immune cells, but also on tumor cells.
- RNA-Seq analysis of data on GITR expression in 33 types of tumors was performed, high expression levels were found in NSCLC (head and neck squamous cell carcinoma), NSCLC (non-small cell lung cancer), BC (breast cancer), esophageal cancer, and bladder cancer (cancer Bladder) .
- GITR is expressed not only on immune cells, but also on the membrane of tumor cells.
- GITRL-Fc upregulated the expression of genes associated with T cells, CD8 T cells, cytotoxicity, Thl cells, IFN-gamma, NK, Teff, and T cell activation markers.
- GITR and its ligand is not limited to hematopoietic cells. GITR is also expressed on keratinocytes, osteoclast precursors, GITRL on endothelial cells.
- GITRL is a type II transmembrane protein that is typical of most members of the TNF ligand family. Research to date indicates that human GITRL generally exists as a trimer, although it can also exist as a monomer or form other multimeric forms (Chattopadhyay, et al. (2007) Proc. Natl. Acad. Sci. 104 : 19452-19457; Zhou, et al (2008) Proc Natl Acad Sci 105: 635-640). There is evidence to suggest that a soluble form of GITRL is also produced (Baltz, et al. (2008) Blood 112: 3735-3743; Mahesh, et al. (2006) Eur. J. Immunol. 36: 2128-2138).
- GITRL is expressed primarily on antigen presenting cells (APCs), including macrophages, B cells, dendritic cells, and endothelial cells, which can function as APCs (Nocentini and Riccardi (2005) E. J. Immunol. 35: 1016-1022; Agostini. et al (2005) Infect Immun 73: 7502-7508; and Nocentini, et al (2007) EJ Immunol 37: 11651169).
- APCs antigen presenting cells
- GITR signaling serves as a coactivation signal for both CD4 + and CD8 + naive T cells, thereby inducing or enhancing proliferation and effector function, in particular when stimulation of T cell receptors (RTKs) is close to optimal (Schaer, et al. (2012 ) Curr. Opin. Immunol. 24: 217224).
- GITR may have several effects on effector T cells and regulatory T cells, including: co-stimulation and activation of effector T cells so that they become more resistant to inhibition, inhibition of regulatory T cells, decreasing the sensitivity of effector T cells to suppression by regulatory T cells, and partial removal of regulatory T cells from circulation (Nocentini, et al. (2007) Eur. J. Immunol. 37: 1165-1169).
- GITR The main functions of GITR, and hence the main effects of anti-GITR antibodies, are to enhance the proliferation and functioning of effector T cells, as well as an inhibitory effect on the suppressive effect of Tregs.
- Teff cells are generated initially with an inability to resist the inhibitory tumor microenvironment and suppression of Treg cells. Stimulation of GITR at repeated stages of priming and expansion, via an anti-GITR agonist, soluble GITR ligand, or DC vaccine, modulates Teff and Treg tumor responses in favor of the former, which leads to tumor regression.
- anti-GITR confers Teff resistance to Treg suppression.
- GITR activation leads to an increase in the immune response. Such activation can potentially lead to the restoration of immune responses to infections and tumors. Accordingly, molecules capable of activating GITR would be of value as immunostimulatory agents under conditions where it is necessary to elicit an increased immune response.
- the antibody should have GITR agonist properties, with effector, cytotoxic properties on Treg lymphocytes.
- anti-GITR antibodies are known in the art (for example, WO2015187835, WO2015031667, WO2017068186, W02017096189, WO2017214548).
- BCD-166 is an agonist monoclonal antibody that interacts with GITR, activates the receptor, suppresses the suppressor effect of T-regulatory lymphocytes, inhibits / depletes the T-suppressor (regulatory) link of immunity due to ADCC effector properties, thereby increasing the number of CD8 + and CD4 + effector cells and activating the T-effector link of immunity in the tumor microenvironment.
- the present invention provides an isolated monoclonal antibody, or antigen-binding fragment thereof, that specifically binds to GITR, comprising:
- NYGMH (SEQ ID NO: 1) or YYWMY (SEQ ID NO: 12);
- VIWFDGSNKFYTDSVKG (SEQ ID NO: 2) or AISWNGGRTYYAESMKG (SEQ ID NO: 13);
- RASQSIGSWLA SEQ ID NO: 7
- TGTSTDIGTYKYIS SEQ ID NO: 8
- AASTLQR (SEQ ID NO: 8) or GVSHRPS (SEQ ID NO: 18);
- QQSHSHPLT (SEQ ID NO: 9) or SSYTSSGTW (SEQ ID NO: 19).
- the monoclonal antibody, or antigen-binding fragment thereof comprises a heavy chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 1, 2, and 3, respectively.
- the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 12, 13, and 14, respectively.
- the monoclonal antibody or antigen-binding fragment thereof comprises a variable domain of a light chain, which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences SEQ ID NO: 7, 8 and 9, respectively.
- the monoclonal antibody or antigen binding fragment thereof comprises a light chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 17, 18, and 19, respectively.
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of the heavy chain which contains CDRs 1, 2 and 3 with amino acid sequences represented by the sequences of SEQ ID NO: 1, 2 and 3, respectively;
- variable domain of the light chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 7, 8 and 9, respectively.
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of the heavy chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 12, 13 and 14, respectively;
- variable domain of the light chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 17, 18 and 19, respectively.
- the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 4.
- the monoclonal antibody, or antigen-binding fragment thereof comprises a heavy chain variable domain that comprises the amino acid sequence of SEQ ID NO: 4.
- the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 15.
- the monoclonal antibody, or antigen-binding fragment thereof comprises a heavy chain variable domain that comprises the amino acid sequence of SEQ ID NO: 15.
- the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain that contains an amino acid sequence at at least 90% homologous to the amino acid sequence
- the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain that comprises the amino acid sequence of SEQ ID NO: 10.
- the monoclonal antibody, or antigen-binding fragment thereof comprises a light chain variable domain that contains an amino acid sequence that is at least 90% homologous to an amino acid sequence
- the monoclonal antibody, or antigen-binding fragment thereof comprises a light chain variable domain that comprises the amino acid sequence of SEQ ID NO: 20.
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of the heavy chain which contains an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 4;
- a light chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 10.
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of the heavy chain that contains the amino acid sequence of SEQ ID NO: 4;
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of a heavy chain which contains an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 15;
- a light chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 20.
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of the heavy chain that contains the amino acid sequence of SEQ ID NO: 15;
- the monoclonal antibody that specifically binds to GITR is a full length IgG antibody.
- the IgG monoclonal antibody is of the human IgGl, IgG2, IgG3, or IgG4 isotype.
- the IgG monoclonal antibody is of the human IgG1 isotype.
- the monoclonal antibody that specifically binds to GITR comprises an E345R mutation in the Fc fragment to increase agonistic properties, antibody dependent cellular cytotoxicity (ADCC), but not complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cellular cytotoxicity
- CDC complement dependent cytotoxicity
- the monoclonal antibody comprises a heavy chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: 5.
- the monoclonal antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 5.
- the monoclonal antibody comprises a heavy chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: b.
- the monoclonal antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: b.
- the monoclonal antibody comprises a light chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: 11.
- the monoclonal antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 11.
- the monoclonal antibody comprises:
- the monoclonal antibody comprises:
- the monoclonal antibody comprises:
- the monoclonal antibody comprises: - a heavy chain containing the amino acid sequence of SEQ ID NO: 6;
- the monoclonal antibody comprises a heavy chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: 16.
- the monoclonal antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 16.
- the monoclonal antibody comprises a light chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: 21.
- the monoclonal antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 21.
- the monoclonal antibody comprises:
- the monoclonal antibody comprises:
- the present invention provides an isolated nucleic acid that encodes any of the aforementioned antibody or antigen binding fragment thereof.
- the nucleic acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
- the present invention relates to an expression vector comprising the aforementioned nucleic acid.
- the present invention relates to a method for producing a host cell for producing said antibody or antigen-binding fragment thereof, which comprises transforming a cell with the above vector.
- the present invention relates to a host cell for producing the above antibody or antigen-binding fragment thereof, comprising the above nucleic acid.
- the present invention relates to a method for producing the above antibody or antigen-binding fragment thereof, comprising culturing the above cell host in a culture medium under conditions sufficient to obtain the specified antibody, if necessary, followed by isolation and purification of the resulting antibody.
- the present invention relates to a pharmaceutical composition for the treatment of a disease or disorder mediated by GITR, comprising the above antibody or antigen-binding fragment thereof in a therapeutically effective amount, in combination with one or more pharmaceutically acceptable excipients.
- the pharmaceutical composition is intended for the treatment of a disease or disorder mediated by GITR selected from the group of cervical cancer (cervical cancer), head and neck cancer, stomach cancer, BC (breast cancer), renal cell carcinoma, CRC (colorectal cancer ), OC (ovarian cancer), NSCLC (non-small cell lung cancer).
- GITR selected from the group of cervical cancer (cervical cancer), head and neck cancer, stomach cancer, BC (breast cancer), renal cell carcinoma, CRC (colorectal cancer ), OC (ovarian cancer), NSCLC (non-small cell lung cancer).
- the present invention provides a pharmaceutical composition for the treatment of a disease or disorder mediated by GITR, comprising the aforementioned antibody or antigen-binding fragment thereof in a therapeutically effective amount and at least one therapeutically active anticancer compound in a therapeutically effective amount.
- the pharmaceutical composition is intended for the treatment of a disease or disorder mediated by GITR selected from the group of cervical cancer (cervical cancer), head and neck cancer, stomach cancer, BC (breast cancer), renal cell carcinoma, CRC (colorectal cancer) , OC (ovarian cancer), NSCLC (non-small cell lung cancer).
- GITR selected from the group of cervical cancer (cervical cancer), head and neck cancer, stomach cancer, BC (breast cancer), renal cell carcinoma, CRC (colorectal cancer) , OC (ovarian cancer), NSCLC (non-small cell lung cancer).
- the pharmaceutical composition comprises a therapeutically active anticancer compound selected from a chemotherapeutic agent, an antibody, or an anti-hormonal agent.
- the pharmaceutical composition comprises a therapeutically active anticancer compound, an antibody selected from the group of anti-PD1 antibodies, anti-PD-L1 antibodies, anti-CTLA4 antibodies, anti-4-1BB antibodies, anti-OX40 antibodies, or combinations thereof.
- the pharmaceutical composition comprises a therapeutically active anticancer compound that is a small molecule.
- the pharmaceutical composition comprises a therapeutically active anticancer compound selected from the group of innate or acquired immunity activators. In some embodiments of the pharmaceutical composition, the above antibody and at least one therapeutically active anticancer compound are administered sequentially.
- the above antibody and at least one therapeutically active anticancer compound are administered simultaneously.
- the present invention relates to a method of inhibiting the biological activity of GITR in a subject in need of such inhibition, comprising administering to the subject an effective amount of the aforementioned antibody or antigen-binding fragment thereof.
- the present invention provides a method of treating a disease or disorder mediated by GITR, comprising administering to a subject the above antibody or antigen binding fragment thereof or the above pharmaceutical composition in need of such treatment in a therapeutically effective amount.
- the method of treatment includes a disease or disorder that is selected from the group of cervical cancer (cervical cancer), head and neck cancer, stomach cancer, BC (breast cancer), renal cell carcinoma, CRC (colorectal cancer), OC ( ovarian cancer), NSCLC
- non-small cell lung cancer non-small cell lung cancer
- the present invention relates to the use of the aforementioned antibody or antigen binding fragment thereof or the aforementioned pharmaceutical composition for treating a GITR mediated disease or disorder in a subject in need of such treatment.
- the use includes a disease or disorder selected from the group of cervical cancer (cervical cancer), head and neck cancer, stomach cancer, BC (breast cancer), renal cell carcinoma, CRC (colorectal cancer), OC (cancer ovary), NSCLC
- non-small cell lung cancer non-small cell lung cancer
- FIG. 1 Plasmid for protein production pEE-GITR-TEV-Fc lama.
- FIG. 2 Plasmid for the production of pEE-GITR -Fc protein.
- FIG. 3 Map of the plasmid pEE-humGITR-ligand-foldon-EPEA.
- FIG. 4 SDS-gel electrophoresis in 4-20% PAGE
- FIG. 5 SDS-gel electrophoresis
- FIG. b Synthesis scheme for combinatorial naive human library
- FIG. 8 Map of expression plasmid pLL for the production of secreted Fab.
- FIG. 9 Map of the expression vector pEE-BCDl 66-01-001-VH- HC encoding the heavy chain of antibodies for the transient production of antibodies in mammalian cells
- FIG. 10 Map of the expression vector pEE-BCD166-01-001-VK- CK encoding the light chain of antibodies for the transient production of antibodies in mammalian cells
- FIG. 11 SDS-gel electrophoresis in 12% PAGE + b-ME
- FIG. 12 SDS-gel electrophoresis in 12% PAGE + b-ME
- FIG. 13 Graph showing the results of testing the specific agonist activity of anti-GITR monoclonal antibodies of lots 1161 (BCD166-01-01), 1210 BCD166-01-011) and 1213 BCD166-01-014) in a test on a reporter cell line.
- FIG. 14 Graph showing the results of testing the specific binding of the antibody BCD166-01-01 to human GITR, mouse GITR, and cynomolgus monkey GITR.
- FIG. 15 A graph showing the results of testing the specific binding of the BCD166-01-011 antibody to human GITR, mouse GITR and cynomolgus monkey GITR.
- FIG. 16 Graph showing the results of testing the specific binding of the BCD166-01-014 antibody to human GITR, mouse GITR, and cynomolgus monkey GITR.
- FIG. 17 Graph showing the results of the activation level in the cell agonist test of the subjects BCD166-01-01, BCD166-02-01, BCD166-01-014.
- FIG. 18 Graph with the results of EC50 values in the cellular ADCC test of the investigated BCD166-02-01, BCD166-01-01, BCD166-01-014, BCD166-02-014.
- FIG. 19 Graph with the results of the CDC level of the researched BCD166-01-01, BCD166-02-01, BCD166-01-014.
- FIG. 20 Graph showing the effects of the studied anti-GITR candidates on immunoreactive cells (NK) versus negative controls.
- FIG. 21 Graph showing the effects of the investigated anti-GITR candidates on immunoreactive cells (B) versus negative controls.
- FIG. 22 Graph showing the effects of the investigated anti-GITR candidates on immunoreactive cells (CD3) versus negative controls.
- FIG. 23 Graph showing the results of the effect of the investigated anti-GITR candidates on immunoreactive cells (CD8 + T cells) in comparison with the negative control.
- FIG. 24 Graph showing the effect of the investigated anti-GITR candidates on immunoreactive cells (CD4 + T cells) versus negative controls.
- FIG. 25 Analysis of antibody-dependent nTreg depletion under the action of the studied anti-GITR candidates for donor cell material 1.
- FIG. 26 Analysis of antibody-dependent nTreg depletion under the action of the studied anti-GITR candidates for donor cell material 2.
- FIG. 27 Analysis of antibody-dependent iTreg depletion under the action of the studied anti-GITR candidates for the cell material of donor 1 and donor 2
- FIG. 28 Results of the analysis of the effect of anti-GITR antibodies on the level of secretion of proinflammatory cytokines IL-2 and IFN- ⁇ , which determine the anticancer effect.
- FIG. 29 Data table of binding affinity constants of BCD166-02-01 candidate with gamma receptors.
- FIG. 30 Stability plot of BCD166-02-01 with 72-hour incubation at 50 ° C.
- FIG. 31 Stability plot of BCD166-01-014 at 72-hour incubation at 50 ° C.
- FIG. 32 Average values of tumor volumes in groups during the experiment.
- FIG. 33 Indicator of inhibition of tumor growth on the 33rd day.
- GITR International Glucocorticoid-induced TNFR-related protein / glucocorticoid-induced onyxone necrosis factor receptor ⁇ TNFRSF18 / tumor necrosis factor receptor superfamily
- GITR is a membrane protein, a receptor from the tumor necrosis factor receptor superfamily.
- GITR is a type I transmembrane protein that consists of 216 amino acids and has a molecular weight of 26 kDa.
- the N-terminal extracellular domain contains 3 TNFR-Cys repeats and an N-glycosylation site.
- 3 cysteine-rich domains and the cytoplasmic tail of GITR have significant homology with 4-1BB, 0X40 and CD27 (Nocentini, et al. (1997) Proc.
- GITR GITR
- head and neck cancer GITR
- stomach cancer GITR
- BC breast cancer
- OC ovarian cancer
- NSCLC non-small cell lung cancer
- binding molecule includes antibodies and immunoglobulins.
- antibody or “immunoglobulin” (Ig), as used herein, includes whole antibodies and any antigen-binding fragment (ie, "antigen-binding portion") or individual chains thereof.
- antibody refers to a glycoprotein containing at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds, or an antigen-binding portion thereof. Each heavy chain contains a heavy chain variable region (abbreviated herein as VH) and the constant region of the heavy chain.Five types of heavy chains of mammalian antibodies are known, which are denoted by Greek letters:, d, e, g and m.
- the type of heavy chain present determines the class of the antibody; these chains are found in antibodies such as IgA, IgD, IgE, IgG and IgM, respectively.
- the various heavy chains differ in size and composition; and g contains about 450 amino acids and m and e have about 550 amino acids.
- Each heavy chain contains two regions, ie a constant region and a variable region.
- the heavy chains g, and d contain a constant region th, which consists of three constant domains CHI, CH2 and CH3 (lined up) and a hinge region, which gives flexibility (Woof J., Burton D., Nat Rev Immunol 4, 2004, cc.89-99); heavy chains m and e contain a constant region, which consists of four constant domains CHI, CH2, CH3 and CH4. In mammals, only two types of light chains are known, which are designated as lambda (l) and kappa (k). Each light chain consists of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The approximate length of the light chain is 211-217 amino acids.
- the light chain is a kappa (k) light chain and the CL constant domain is preferably C-kappa (k).
- Antibodies can be antibodies of any class (eg, IgA, IgD, IgE, IgG and IgM, preferably IgG) or subclass (eg, IgGl, IgG2, IgG3, IgG4, IgAl and IgA2, preferably IgGl).
- class e.g, IgA, IgD, IgE, IgG and IgM, preferably IgG
- subclass eg, IgGl, IgG2, IgG3, IgG4, IgAl and IgA2, preferably IgGl.
- VH and VL regions can be further subdivided into regions of hypervariability, called complementarity determining regions (CDRs), scattered between regions, which are more conservative, called framework regions (FR).
- CDRs complementarity determining regions
- FR framework regions
- Each VH and VL consists of three CDRs and four FRs, located from the amino end to the carboxy end in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with antigen.
- Antibody constant regions can mediate the binding of immunoglobulin to host tissues or factors, including various cells of the immune system (eg, effector cells) and the first component (Clq) of the classical complement system.
- antigennegative portion of an antibody or "antigennegative fragment” refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments included in the term "antigen binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH 1 domains; (ii) F (ab f ) 2 fragment, a bivalent fragment, containing two Fab fragments linked by a disulfide bridge in the hinge region; (iii) an Fd fragment consisting of the VH and CH 1 domains; (iv) an Fv fragment consisting of the VL and VH domains in a single arm of an antibody, (v) dAb a fragment (Ward et al., (1989) Nature 341: 544-546), which consists of a VH / VHH domain; and (vi) an isolated complementarity determining region (CDR).
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH 1 domains
- F (ab f ) 2 fragment a bivalent fragment, containing two Fab fragments linked by
- two regions of the Fv fragment, VL and VH, encoded by different genes can be recombinantly linked using a synthetic linker that allows them to be produced as a single protein chain in which the VL and VH regions are paired to form monovalent molecules (known as single chain Fv (scFv); see, for example, Bird et al. (1988) Science 242 : 423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85: 5879-5883).
- scFv single chain Fv
- Such single-stranded molecules are also contemplated to be included in the term “antigen-binding portion.”
- Such antibody fragments are prepared using conventional techniques known to those of skill in the art, and these fragments are screened in the same manner as intact antibodies.
- the CDR of the antigen binding region, or all of the antigen binding region of the antibodies of the invention is of mouse, llama or human donor library origin, or is essentially human in origin with certain amino acid residues altered, for example substituted with different amino acid residues, in order to optimize specific antibody properties, for example KD , koff, IC50, EC50, ED50.
- the antibody frameworks of the invention are of human origin or of substantially human origin (at least 80, 85, 90, 95, 96, 97, 98, or 99% human).
- the antigen binding portion of an antibody of the invention may be from other non-human species, including, but not limited to, a mouse, llama, rabbit, rat, or hamster.
- the antigen binding site can be from human species.
- variable refers to the fact that certain segments of the variable domains differ widely in sequence among antibodies.
- the V domain mediates antigen binding and determines the specificity of a particular antibody for its particular antigen.
- variability is unevenly distributed over the 110 amino acid variable domains.
- V regions are composed of invariant fragments called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” or CDRs.
- FRs framework regions
- Each variable domain of native heavy and light chains contains four FRs, generally adopting a beta sheet configuration, linked by three hypervariable regions that form binding loops, and in some cases are part of the beta sheet structure.
- hypervariable regions in each chain are held together in close proximity by FRs and with the hypervariable regions of the other chain contribute to the formation of the antigen-binding site of antibodies.
- Constant domains are not directly involved in the binding of an antibody to an antigen, but exhibit various effector functions, such as the involvement of an antibody in antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen binding.
- the hypervariable region contains amino acid residues from the "complementarity determining region" or "CDR" and / or such residues from the "hypervariable loop".
- affinity maturation it may also be preferable to alter one or more amino acid residues of the CDR regions in order to increase the binding affinity for the target epitope.
- affinity maturation is known as "affinity maturation” and in some cases can be performed in connection with humanization, for example, in situations where the humanization of an antibody leads to a decrease in the specificity or affinity of binding, and it is not possible to sufficiently improve the specificity or affinity of binding by using only reverse mutations.
- Various methods of affinity maturation are known in the art, for example, in vitro method scanning saturating mutagenesis described by Burks et al. , Proc Natl Acad Sci USA, 94: 412-417 (1997), and the stepwise in vitro affinity maturation method proposed by Wu et al. , Proc Natl Acad Sci USA 95: 6037 6042 (1998).
- FR Framework regions
- each variable domain has four FRs, designated FR1, FR2, FR3, and FR4.
- FR1, FR2, FR3, and FR4 are variable domain residues other than the CDR residues.
- each variable domain has four FRs, designated FR1, FR2, FR3, and FR4.
- the FR residues of the light chain are located approximately in the region of residues 1-23 (LCFR1), 35-49 (LCFR2), 57-88 (LCFR3) and 98-107 (LCFR4)
- the FR residues of the heavy chain are located approximately in the region of residues 1-30 (HCFR1), 36-49 (HCFR2), 66-94 (HCFR3) and 103-113 (HCFR4) in the heavy chain.
- the FR residues of the light chain are located at approximately residues 1-25 (LCFR1), 33-49 (LCFR2), 53-90 (LCFR3) and 97-107 (LCFR4) in the light chain and the FR residues of the heavy chain are located approximately at residues 1-25 (HCFRI), 33-52 (HCFR2), 56-95 (HCFR3) and 102-113 (HCFR4) in the residues of the heavy chain.
- the FRs are adjusted accordingly. For example, when CDRH1 includes amino acids H26-H35, the FR1 residues of the heavy chain are at positions 1-25 and the FR2 residues are at positions 36-49.
- a crystallizing fragment of immunoglobulin (English, fragment crystallizable region, Fc region, Fc) is the terminal part of an immunoglobulin molecule that interacts with the Fc receptor on the cell surface and with some proteins of the complement system. This property allows antibodies to activate the immune system.
- the Fc region of IgG, IgA and IgD isotypes consists of two identical protein fragments, respectively, of the second and third constant domains of two heavy chains; in the case of IgM and IgE isotypes, Fc contains three heavy chain constant domains (CH 2-4 domains) in each polypeptide chain.
- An antibody of the invention that “binds” a target antigen is an antibody that binds an antigen with sufficient affinity such that the antibody can be used as a diagnostic and / or therapeutic agent when targeting a protein or cell or tissue expressing the antigen, and slightly cross-reacts with other proteins.
- analytical methods sorting of fluorescently activated cells (FACS), radioimmunoprecipitation (RIA) or ELISA (ELISA), in such variants of the invention the degree of binding of the antibody to a protein that is not a “target” (with a “non-target protein”) is less than 10 % of binding of an antibody to a specific target protein.
- the term "specific binding "or the expressions” specifically binds to "or” specific to "a particular polypeptide or epitope on a particular target polypeptide means binding that is markedly (measurably) different from a non-specific interaction (for example, in the case of LH1-44 or LH1-81, a non-specific interaction is binds to bovine serum albumin, casein, fetal bovine serum or neutravidin).
- Specific binding can be quantified, for example by determining binding of a molecule versus binding of a control molecule. For example, specific binding can be determined by competitive reaction with another molecule similar to the target, for example, with an excess of unlabeled target. In this case, specific binding is indicated if the binding of a labeled target to a probe is competitively inhibited by an excess of unlabeled target.
- the term “specific binding” or the expression “specifically binds to” or “specific to” a particular polypeptide or epitope on a particular target polypeptide can be characterized by a molecule having a target Kd of at least about 200 nM, or at least at least about 150 nM, or at least about 100 nM, or at least about 60 nM, or at least about 50 nM, or at least about 40 nM, or at least about 30 nM, or at least about 20 nM, or at least about 10 nM, or at least about 8 nM, or at least about 6 nM, or at least about 4 nM, or at least about about 2 nM, or at least about 1 nM or higher.
- the term “specific binding” refers to binding in which a molecule binds to a particular polypeptide or epitope on a particular polypeptide, without substantially binding to any other polypeptide or epitope on the polypeptide.
- Ka refers to the rate of association of a particular antibody-antigen interaction.
- Kd refers to the rate of dissociation of a particular antibody-antigen interaction.
- Binding affinity generally refers to the strength of the cumulative non-covalent interactions between a single binding site of a molecule (eg, an antibody) and its binding partner (eg, an antigen). Unless otherwise indicated, "binding affinity” refers to an intrinsic (intrinsic, true) binding affinity that reflects a 1: 1 interaction between members of a binding pair (eg, antibody and antigen).
- the affinity of a molecule X for its partner Y can usually be represented by a constant dissociation (Kd).
- the Kd value is about 200 nM, 150 nM, 100 nM, 60 nM, 50 nM, 40 nM, 30 nM, 20 nM, 10 nM, 8 nM, b nM, 4 nM, 2 nM, 1 nM or less.
- Affinity can be measured by conventional methods known in the art, including those described herein. Low affinity antibodies usually bind slowly to the antigen and tend to dissociate easily, while high affinity antibodies generally bind antigen faster and tend to remain bound longer. Various methods for measuring binding affinity are known in the art, any of these methods can be used for the purposes of the present invention.
- KB or “KB value” according to this invention is measured by surface plasmon resonance methods on a BIAcore TM -2000 or BIAcore TM -3000 instrument (BIAcore, Inc., Piscataway, NJ) at 25 ° C using chips with immobilized antigen CM5 at ⁇ 10 relative units (response units, RU).
- CM5 carboxymethyldextran biosensor chips
- EDC N-ethyl-N '- (3-dimethylaminopropyl) -carbodiimide
- NHS N-hydroxysuccinimide
- the antigen is diluted with 10 mM sodium acetate, pH 4.8, to a concentration of 5 ⁇ g / ml ( ⁇ 0.2 ⁇ M), and then injected (injection) at a flow rate of 5 ⁇ l / minute until approximately 10 relative units (RU) of bound protein is reached.
- 1 M ethanolamine solution is injected to block unreacted groups.
- two-fold serial dilutions of Fab eg, 0.78 nM to 500 nM
- PBST Tween 20
- association rate (kop) and dissociation rate (koff) values are calculated using a simple Langmuir model for one-plus-one binding (BIAcore Evaluation Software version 3.2) by simultaneously obtaining a sensorgram of association and dissociation.
- the equilibrium dissociation constant (Kb) is calculated as the koff / kon ratio. See, for example, Chen, Y., et al. , (1999) J. Mol. Biol. 293: 865-881.
- a spectrometer such as a stopped flow spectrophotometer (Aviv Instruments) or an SLM spectrophotometer Aminco (ThermoSpectronie) Series 8000 with stirring cuvette.
- Koff refers to the dissociation rate constant of a particular interaction between a binding molecule and an antigen.
- the dissociation rate constant koff can be measured by biolayer interferometry, for example using the Octet TM system.
- the "oh-rate" or "cop” of the present invention can also be determined by the same surface plasmon resonance method described above on a BIAcore TM -2000 or BIAcore TM -3000 instrument (BIAcore, Inc., Piscataway, NJ ) at 25 ° C using chips with immobilized CM5 antigen at ⁇ 10 relative units (response units, RU).
- CM5 antigen at ⁇ 10 relative units (response units, RU).
- carboxymethyldextran biosensor chips CM5, BIAcore Inc.
- EDC -ethyl- '- (3-dimethylamino propyl) - carbodiimide hydrochloride
- NHS N-hydroxysuccinimide
- the antigen is diluted with 10 mM sodium acetate, pH 4.8, to a concentration of 5 ⁇ g / ml ( ⁇ 0.2 ⁇ M), and then injected (injection) at a flow rate of 5 ⁇ l / minute until approximately 10 relative units (RU) of bound protein is reached. After the introduction of the antigen, 1 M ethanolamine solution is injected to block unreacted groups.
- biologically active and biological activity and “biological characteristics”, with respect to a polypeptide of this invention, mean having the ability to bind to a biological molecule.
- biological molecule refers to a nucleic acid, protein, carbohydrate, lipid, and combinations thereof. In one embodiment of the invention, the biological molecule exists in nature.
- Antibody regions such as Fab and F (ab ') 2 fragments can be obtained from whole antibodies using conventional methods such as papain or pepsin digestion of whole antibodies. Moreover, antibodies, antibody portions, and immunoadhesion molecules can be produced using standard recombinant DNA techniques, for example, as described herein.
- recombinant antibody means an antibody that is expressed in a cell or cell line containing a nucleotide sequence (nucleotide sequences) that encodes antibodies, and the specified nucleotide sequence (nucleotide sequences) is not associated with the cell in nature.
- variant antibody refers to an antibody having an amino acid sequence that differs from the amino acid sequence of its "parent” antibody by adding, removing and / or replacing one or more amino acid residues relative to the sequence of the parent antibody.
- the variant antibody comprises at least one or more (e.g., from one to twelve, such as two, three, four, five, six, seven, eight or nine, ten, eleven, or twelve; and in some embodiments, one to about ten) amino acid additions, deletions and / or substitutions relative to the parent antibody.
- additions, deletions and / or substitutions are made at the CDRs of the variant antibody.
- Identity or homology to the sequence of a variant antibody is defined herein as the percentage of amino acid residues in the sequence of a variant antibody that are identical to those of the parent antibody, after sequence alignment and gaps, if necessary, to achieve the maximum percentage sequence identity.
- the variant antibody retains the ability to bind to the same antigen, and preferably an epitope, to which the parent antibody binds, and in some embodiments, at least one property or biological activity is superior to that of the parent antibody.
- a variant antibody can have, for example, a higher binding affinity, a longer half-life, a lower IC50 value, or an increased ability to suppress the biological activity of an antigen compared to the parent antibody.
- a variant antibody showing a biological activity that is at least 2 times (preferably at least 5 times, 10 times, or 20 times) the biological activity of the parent antibody.
- bispecific antibody means an antibody containing an antigen-binding domain or antigen-binding domains that are capable of specifically binding to two different epitopes on one biological molecule or capable of specific binding to epitopes on two different biological molecules.
- a bispecific antibody is also referred to herein as being “dual specific” or as being “dual specific”.
- chimeric antibody refers broadly to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies, typically an antibody of partially human origin and partially non-human origin, i.e., obtained in part from a non-human animal such as a mouse, rat or other rodent or camelids such as a llama or alpaca. Chimeric antibodies are preferred over non-human antibodies in order to reduce the risk of an immune response directed against antibodies in humans, such as a response against murine antibodies in humans in the case of a murine antibody.
- An example of a typical chimeric antibody is one in which the variable region sequences are murine while the constant region sequences are human.
- the non-human portions can be further altered to humanize the antibody.
- humanization refers to the fact that when an antibody is wholly or partially non-human, for example, a mouse or llama antibody obtained by immunizing mice or llamas, respectively, with an antigen of interest, or is a chimeric antibody based on such a mouse or llama antibody , it is possible to replace some amino acids, for example, in the framework regions and constant domains of the heavy and light chains, in order to avoid or minimize the immune response in humans.
- the specificity of the interaction of an antibody with a target antigen is mainly inherent in amino acid residues located in the six CDRs of the heavy and light chains. Therefore, amino acid sequences within CDRs are much more variable between individual antibodies than sequences outside of CDRs.
- non-human antibodies can be "humanized” and the binding specificity and affinity of the parent antibody can be largely preserved.
- non-human antibodies are generally more immunogenic than human antibodies.
- Chimeric antibodies in which foreign (eg, rodent or camel) constant regions have been replaced with sequences of human origin have shown generally lower immunogenicity than antibodies of completely foreign origin, and there is a tendency to use humanized or fully human antibodies in therapeutic antibodies.
- Chimeric antibodies, or other antibodies of non-human origin can thus be humanized to reduce the risk of an immune response directed against the antibody in humans.
- humanization usually involves the modification of the framework regions of the variable plot.
- Amino acid residues that are part of the complementarity determining regions (CDRs) will most often not change due to humanization, although in some cases it may be desirable to alter individual amino acid residues of the CDR region, for example, to remove a glycosylation site. a deamidation site, an aspartate isomerization site, or an unwanted cysteine or methionine residue.
- N-linked glycosylation occurs by the attachment of an oligosaccharide chain to an asparagine residue in the tripeptide sequence Asn-X-Ser or Asn-X-Thr, where X can be any amino acid other than Pro.
- Removal of the N-glycosylation site can be achieved by mutating the Asn or Ser / Thr residue with another residue, preferably by conservative substitution.
- Deamidation of asparagine and glutamine residues can occur depending on factors such as pH and surface exposure.
- Asparagine residues are particularly susceptible to deamidation, especially if they are present in the Asn-Gly sequence, and to a lesser extent in other dipeptide sequences such as Asn-Ala. In the presence of such a deamidated region, for example Asn-Gly in the sequence of the CDR region, it may be preferable to remove this region, usually by conservative substitution to remove one of the residues involved.
- CDR transplantation Numerous methods of humanizing an antibody sequence are known in the art.
- CDR transplantation may be based on Rabat CDR determinations, although a later publication (Magdelaine-Beuzelin et al., Crit Rev. Oncol Hematol. 64: 210 225 (2007)) suggests that no IMGT® definition (the international ImMunoGeneTics information system®, www.imgt.org) can improve humanization outcomes (see Lefranc et al., Dev. Comp Immunol. 27: 55-77 (2003)).
- CDR transplantation can reduce the specificity and binding affinity, and hence biological activity, in the CDR of the transplanted non-human antibody, compared to the parent antibody from which the CDRs are derived.
- Reverse mutations (sometimes referred to as "framework repair") can be used at selected CDR positions of the grafted antibody, usually in the framework regions, in order to restore the specificity and binding affinity of the parent antibody. Determination of positions for possible reverse mutations can be performed using information available in the literature and in antibody databases. Amino acid residues that are candidates for reverse mutations are usually located on the surface of the antibody molecule, while residues that are deepened or have a low degree of surface exposure are usually not will be subject to change.
- the humanization method is a surface alteration in which non-human residues unexposed on the surface are retained, while the residues exposed on the surface are transformed into human residues.
- naive and immune libraries are constructed using naturally rearranged genes encoding the variable domains of immunoglobulins of healthy donors or those immune to any antigen, respectively. For this, mRNA of lymphoid cells producing antibodies is isolated. Most often these are peripheral blood lymphocytes, but in some cases splenocytes are used [Sheets MD, Amersdorfer P, Finnern R, Sargent P, Lindquist E, Schier R, et al.
- One or more primers can be used at once, limiting the set of amplified genes to one or more gene families of variable domains or antibody isotypes already at the cDNA level [Marks JD, Hoogenboom HR, Bonnert TP, McCafferty J, Griffiths AD, Winter G. Bypassing immunization. Human antibodies from V-gene libraries displayed on phage. J Mol Biol 1991,222: 581-597].
- Primers used for amplification genes encoding immunoglobulins are complementary to their most conserved regions. Their sequences are selected from gene collections that are organized into databases such as the Rabat database or V BASE. The primer design also provides for the presence of internal restriction sites in them, which allow cloning of PCR products into the composition of the corresponding vectors.
- Phage display is the first and most widely used in vitro technology for antibody detection.
- Smith discovered that foreign DNA sequences can be cloned into filamentous bacteriophage M13 in such a way that the cloned gene sequences are expressed on the surface of phage particles as fusion proteins (Smith GP: Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface Science 1985,228: 1315-1317.).
- Smith GP Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface Science 1985,228: 1315-1317.
- the repertoire of phage libraries reflects the repertoire of B-lymphocyte antibodies of each person or animal whose blood was used to create the library.
- mice that expressed fully human antibodies whose repertoire could be matched with hybridoma technology obtained (Lonberg N, Taylor LD, Harding FA, Trounstine M, Higgins KM, Schramm SR, Kuo CC, Mashayekh R, Wymore K, McCabe JG et al .: Antigen-specific human antibodies from mice comprising four distinct genetic modifications. Nature 1994, 368: 856-859) These animals have been deliberately disrupted the genes of their own endogenous heavy and light chains of immunoglobulins and introduced transgenes, which are segments of genes of heavy and light chains of a person.
- transgenic mice express B-cell receptors, which are essentially hybrid of mouse and human (human immunoglobulin, mouse Ig, Irb and other signaling molecules), their B-cells develop and mature normally. In some cases, it may also be preferable to alter one or more amino acid residues of the CDR regions in order to increase the binding affinity for the target epitope.
- affinity maturation This is known as “affinity maturation” and in some cases can be performed in connection with humanization, for example, in situations where the humanization of an antibody leads to a decrease in the specificity or affinity of binding, and it is not possible to sufficiently improve the specificity or affinity of binding with only reverse mutations.
- Various methods of affinity maturation are known in the art, for example, the in vitro scanning saturation mutagenesis method described by Burks et al. , Proc Natl Acad Sci USA, 94: 412-417 (1997), and the stepwise in vitro affinity maturation method proposed by Wu et al. , Proc Natl Acad Sci USA 95: 6037 6042 (1998).
- the term "monoclonal antibody” or "tAb” refers to an antibody that is synthesized and isolated by a separate clonal population of cells.
- the clonal population can be a clonal population of immortalized cells.
- the immortalized cells in the clonal population are hybrid cells, hybridomas, which are usually obtained by fusion of individual B lymphocytes from immunized animals with individual lymphocytic tumor cells. Hybridomas are a type of engineered cell and do not occur in nature.
- “Native antibodies” are usually heterotetrameric glycoproteins with a molecular weight of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to the heavy chain by one covalent disulfide bond, while the number of disulfide bonds between the heavy chains varies in different immunoglobulin isotypes. Each heavy and light chain also has evenly spaced intrachain disulfide bridges. Each heavy chain has a variable domain (VH) at one end, followed by several constant domains. Each light chain has a variable domain at one end (VL) and a constant domain at the other end. The light chain constant domain is aligned with the first heavy chain constant domain, and the light chain variable domain is aligned with the heavy chain variable domain. It is believed that particular amino acid residues form an interface between the light chain and heavy chain variable domains.
- isolated means an antibody identified and isolated and / or regenerated from the cell or cell culture in which it is expressed. Impurities (polluting components) from the natural environment are materials that typically interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
- the antibody is purified (1) to an extent sufficient to obtain at least 15 residues of the N-terminal or internal amino acid sequence using a rotating glass cup sequencer (Edman sequencer), or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie brilliant blue or preferably silver staining.
- Isolated antibody comprises antibodies in situ within recombinant cells since at least one component of the polypeptide's natural environment is absent.
- an isolated polypeptide is obtained from at least one purification step.
- nucleic acid molecule is a nucleic acid molecule that has been identified and separated from at least one contaminant nucleic acid molecule with which it is normally associated in a natural source of antibody nucleic acid.
- An isolated nucleic acid molecule differs from the form or set in which it naturally occurs. Thus, the isolated nucleic acid molecule differs from the nucleic acid molecule that exists naturally in cells.
- an isolated nucleic acid molecule includes a nucleic acid molecule found in cells in which the antibody is normally expressed, for example, if the nucleic acid molecule has a different localization in the chromosome from its localization in cells in natural conditions.
- epitope refers to a portion (determinant) of an antigen that specifically binds to a binding molecule (eg, and an antibody or related molecule such as a bispecific binding molecule).
- Epitope determinants usually consist of chemically active surface groups of molecules such as amino acids or carbohydrates, or sugar side chains, and usually have specific three-dimensional structural characteristics as well as specific charge characteristics.
- the epitope can be “linear” or “conformational. »In a linear epitope, all interaction points between a protein (eg antigen) and an interacting molecule (such as an antibody) occur linearly along the primary amino acid sequence of the protein.
- a conformational epitope interaction points occur through amino acid residues on a protein that are separated from each other in the primary amino acid sequence.
- antibodies to this epitope can be generated with using techniques well known in the art.
- the generation and characterization of antibodies or other binding molecules can shed light on desired epitopes. Based on this information, you can then competitively screen binding molecules to bind to the same or similar epitopes, for example, by conducting competition studies to find binding molecules that compete for antigen binding.
- peptide linker in this document means any peptide with the ability to connect domains with a length depending on the domains that it links to each other, containing any amino acid sequence.
- the peptide linker is more than 5 amino acids in length and consists of any set of amino acids selected from G, A, S, P, E, T, D, K.
- in vitro refers to a biological object, biological process or biological response outside the body, simulated under artificial conditions.
- in vitro cell growth should be understood as the growth of cells in an environment outside the body, for example, in a test tube, culture flask or microplate.
- the term “1C 5 o” refers to concentrations of the drug at which the measured activity or response, for example, the growth or proliferation of cells, such as tumor cells, is inhibited by 50%.
- the IC50 value can be estimated using appropriate log dose response curves using special statistical programs for curve processing.
- GI50 50% growth inhibition refers to drug concentrations at which the proliferation of cells, such as tumor cells, is inhibited by 50%.
- ED50 50% effective dose / concentration refers to the concentrations of a drug at which a measurable biological effect is achieved by 50% (may include cytotoxicity).
- antiproliferative action means stopping or inhibiting the growth of proliferating cells, such as cancer cells.
- effector function of an antibody refers to biological activities associated with the Fc region (native Fc region sequence or amino acid sequence variants of the Fc region) of an antibody, and varies depending on the isotype of the antibody.
- Examples of antibody effector functions are: C1 q - binding; complement dependent cytotoxicity; Fc receptor binding; antibody dependent cell mediated cytotoxicity (ADCC); phagocytosis; downward regulation of cell surface receptors (eg, B-cell receptor, BCR) and B-cell activation.
- Antibody-dependent cellular cytotoxicity refers to a cell-mediated response in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (eg, natural killer (NK) cells, neutrophils and macrophages) recognize the bound antibody on the target cell and then induce lysis or phagocytosis of the target cell.
- FcRs Fc receptors
- FcR expression on hematopoietic cells is summarized in Table 3 on page 464 in Ravetch and Kinet, Annu. Rev. Immunol 9: 457-92 (1991).
- ADCC activity of a molecule of interest can be assessed in vitro, for example, in an animal model, such as that described in Clynes et al. PNAS (USA) 95: 652-656 (1998).
- PBMC peripheral blood mononuclear cells
- NK natural killer cells
- Human effector cells are leukocytes that express one or more FcRs and perform effector functions. Preferably, the cells express at least FcyRIII and exercise ADCC effector function. Examples of human leukocytes that mediate ADCC include peripheral blood mononuclear cells (PBMCs), natural killer (NK) cells, monocytes, cytotoxic T cells, and neutrophils; with PBMC and NK cells being preferred.
- PBMCs peripheral blood mononuclear cells
- NK natural killer cells
- monocytes monocytes
- cytotoxic T cells cytotoxic T cells
- neutrophils neutrophils
- the effector cells can be isolated from their natural source, such as blood or PBMC, as described in this publication.
- Fc receptor and “FcR” are used to describe a receptor that binds to the Fc region of an antibody.
- a preferred FcR is a native sequence human FcR.
- a preferred FcR is an FcR that binds an IgG antibody (gamma receptor), and preferred receptors include those of the FcyRI, FcyRII and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
- FcyRII receptors include FcyRI IA ("activating receptor") and FcyRI IB ("inhibitory receptor”), which have similar amino acid sequences that differ mainly in their cytoplasmic domains.
- the activating receptor FcyRI IA contains in its cytoplasmic domain a tyrosine-based immunoreceptor activation motif (ITAM).
- the inhibitory receptor FcyRI IB contains in its cytoplasmic domain based on tyrosine immunoreceptor inhibition motif (ITIM) (for a review see Baron, Annu. Rev. Immunol. 15: 203-234 (1997)).
- ITIM tyrosine immunoreceptor inhibition motif
- FcR is included in the present description in the term "FcR”.
- FcR also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgG to the fetus.
- Complement-dependent cytotoxicity and “SBS” refer to the ability of a molecule to lyse a target in the presence of complement.
- the complement activation pathway is initiated by the binding of the first component of the complement system (Clq) to a molecule (eg, an antibody) in a complex with its antigen.
- a SBS assay can be performed, for example, as described in Gazzano-Santoro et al. , J. Immunol. Methods 202: 163 (1996).
- identity should be construed to mean the percentage of amino acid residues in a candidate sequence that are identical to the residues of the corresponding sequence to which it is compared, after sequence comparison and gaps, if a maximum percentage of identity for the entire sequence is to be achieved, and disregarding any conservative substitutions as part of sequence identity. Neither the N- or C-terminal extension nor the insertional segments should be construed as diminishing identity or homology. Comparison methods and computer programs are well known. Sequence identity can be determined using sequence analysis software (eg, Sequence Analysis Software Package, Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Ave., Madison, WI 53705). This software is suitable for such sequences by determining the degree of homology for a variety of substitutions, deletions (elimination) and other modifications.
- sequence analysis software eg, Sequence Analysis Software Package, Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Ave., Madison, WI 53705
- the phrase "homologous" with respect to the polypeptide sequence of an antibody is to be construed as an antibody exhibiting at least 70%, preferably 80%, more preferably 90% and most preferably 95% sequence identity relative to the polypeptide sequence.
- the term in relation to a nucleic acid sequence is to be construed as a sequence of nucleotides exhibiting at least 85%, preferably 90%, more preferably 95% and most preferably 97% sequence identity with respect to the nucleic acid sequence.
- Modification (s) of the amino acid sequences of the antibodies described in this publication are provided. For example, it may be desirable to improve the binding affinity and / or other biological properties of the antibody.
- Amino acid sequence variants of an antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid or by peptide synthesis. Such modifications include, for example, deletions and / or insertions and / or substitutions of residues in the amino acid sequences of the antibody. Any combination of deletion, insertion and substitution is performed to obtain the final construct, provided that the final construct has the desired characteristics. Changes in amino acids can also alter post-translational processes in the antibody, such as altering the number or position of glycosylation sites.
- a variant of modifying the amino acid sequences of antibodies using amino acid substitutions is the replacement of at least one amino acid residue in the antibody molecule with another residue.
- Sites of greatest interest for mutagenesis by substitutions include hypervariable regions or CDRs, but changes in the FR or Fc region are also contemplated.
- Conservative substitutions are shown in Table A under the heading “preferred substitutions”. If such substitutions result in a change in biological activity, then additional significant changes, referred to as "examples of substitutions" in Table A, or changes further described below in the description of amino acid classes, can be introduced, and products can be screened.
- nucleic acid denotes a clear sequence of nucleotides, modified or not modified, defining a fragment or region of nucleic acid, containing or not containing unnatural nucleotides and being either double-stranded DNA or RNA, or single-stranded DNA or RNA, or transcription products of said DNA.
- this invention does not relate to nucleotide sequences in their natural chromosomal environment, i.e. in a natural state.
- the sequences of the present invention have been isolated and / or purified, i. E. were taken directly or indirectly, for example by copying, and their environment was at least partially modified.
- isolated nucleic acids obtained by genetic recombination, for example, using host cells (host cells), or obtained by chemical synthesis.
- nucleotide sequence covers its compliment, unless otherwise indicated.
- reference to a nucleic acid having a defined sequence is to be understood as encompassing its complementary strand with its complementary sequence.
- control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
- Suitable prokaryotic control sequences are, for example, a promoter, optionally an operator, and a ribosome binding site. It is known that eukaryotic cells contain promoters, polyadenylation signals, and enhancers.
- a nucleic acid is “operably linked” if it is in a functional relationship with another nucleotide sequence.
- DNA of a presequence or secretory leader is operably linked to DNA of a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence;
- the ribosome binding site is operably linked to a coding sequence if located so that it can facilitate translation.
- "operably linked” means that the linked DNA sequences are contiguous, and in the case of a secretory leader sequence, are contiguous and in readout phase. However, enhancers do not have to be contiguous.
- vector means a nucleic acid molecule capable of transporting another nucleic acid to which it is linked.
- the vector is a plasmid, i. e. a circular double-stranded portion of DNA into which additional DNA segments can be ligated.
- the vector is a viral vector in which additional DNA segments can be ligated into the viral genome.
- vectors are capable of autonomous replication in the host cell into which they are introduced (eg, bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors eg, non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into a host cell, and thus replicate with the host genome.
- some vectors are capable of directing the expression of genes to which they are operably linked. Such vectors are referred to herein as “recombinant expression vectors” (or simply “expression vectors”).
- recombinant host cell means a cell into which a recombinant expression vector has been introduced.
- the present invention relates to host cells, which may include, for example, a vector in accordance with the present invention described above.
- the present invention also relates to host cells, which include, for example, a nucleotide sequence encoding a heavy chain or antigen-binding portions thereof, a nucleotide sequence encoding a light chain or antigen-binding portions thereof, or both of a first binding domain and / or a second binding domain binding molecule according to this invention.
- excipient is used herein to describe any ingredient other than the compound (s) of this invention.
- GITR disease or disorder mediated by GITR
- diseases or disorders that are either directly or indirectly related to GITR, including the etiology, development, progression, persistence, or pathology of the disease or disorder.
- Treatment refers to a method of alleviating or eliminating a biological disorder and / or at least one of its accompanying symptoms.
- Alleviate a disease, disease or condition means reducing the severity and / or frequency of the symptoms of a disease, disorder or condition.
- references herein to “treatment” include references to curative, palliative and prophylactic therapy.
- the subject of treatment or patient is a mammal, preferably a human subject.
- the aforementioned subject can be male or female of any age.
- disorder means any condition that can be improved by the treatment of the present invention.
- the definition of this term includes chronic and acute disorders or diseases, including pathological conditions that predispose a mammal to the occurrence of this disorder.
- cancer refers to a physiological state or describe a physiological state in mammals that is typically characterized by unregulated cell growth / proliferation. This definition covers benign and malignant cancers. Examples of cancers include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia.
- cancers include squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous cell lung carcinoma, peritoneal cancer, hepatocellular carcinoma, stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, glioma, cervical cancer, cancer ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, carcinoma of the endometrium and uterus, carcinoma of the salivary glands, kidney cancer (renal cell carcinoma), prostate cancer (prostate cancer), cancer of the external female genital organs, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, melanoma, and various types of head and neck cancer.
- stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, glioma, cervical cancer, cancer ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, carcinoma of the endometrium and uterus
- immune response refers, for example, to the action of lymphocytes, antigen-presenting cells, phagocytic cells, granulocytes, and soluble macromolecules produced by said cells or liver cells (including antibodies, cytokines and complement, resulting from the selective damage, destruction or elimination from the human body of invasive pathogens, cells or tissues infected with pathogens, cancer cells or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues).
- a “therapeutically effective amount” is defined as the amount of therapeutic agent administered during treatment, which will relieve to a certain extent one or more symptoms of the disease for which treatment is being carried out.
- chromenic use refers to the continuous (prolonged) use of the agent (s) as opposed to the acute (short-term) route of administration, so as to maintain the initial therapeutic effect (activity) over an extended period of time.
- Intermittent use means a treatment that is not administered sequentially without interruptions, but which is rather intermittent in nature.
- the present invention relates to a monoclonal antibody that specifically binds to GITR.
- the present invention provides a monoclonal antibody or antigen-binding fragment thereof that specifically binds to GITR, comprising:
- NYGMH (SEQ ID NO: 1) or YYWMY (SEQ ID NO: 12);
- VIWFDGSNKFYTDSVKG (SEQ ID NO: 2) or AISWNGGRTYYAESMKG (SEQ ID NO: 13);
- RASQSIGSWLA SEQ ID NO: 7
- TGTSTDIGTYKYIS SEQ ID NO: 8
- QQSHSHPLT (SEQ ID NO: 9) or SSYTSSGTW (SEQ ID NO: 19).
- the monoclonal antibody, or antigen-binding fragment thereof comprises a heavy chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 1, 2, and 3, respectively.
- the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 12, 13, and 14, respectively.
- the monoclonal antibody or antigen-binding fragment thereof comprises a light chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 7, 8, and 9, respectively.
- the monoclonal antibody or antigen binding fragment thereof comprises a light chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 17, 18, and 19, respectively.
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of the heavy chain which contains CDRs 1, 2 and 3 with amino acid sequences represented by the sequences of SEQ ID NO: 1, 2 and 3, respectively;
- variable domain of the light chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 7, 8 and 9, respectively.
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of the heavy chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 12, 13 and 14, respectively;
- variable domain of the light chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 17, 18 and 19, respectively.
- the monoclonal antibody or antigen binding fragment includes a heavy chain variable domain which comprises an amino acid sequence at least 90% homologous to the amino acid sequence EVQLVQSGGGWQPGKSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVIWFDGSNKFYTDSV KGRFTISRDNSKDTLSLQMNSLRAEDTAVYYCARELGGYYYDSSGFRPYYYGMDVWGQGTMVTV SS (SEQ ID NO: 4).
- the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain that contains the amino acid sequence
- the monoclonal antibody, or antigen-binding fragment thereof comprises a heavy chain variable domain that contains an amino acid sequence that is at least 90% homologous to an amino acid sequence
- the monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable domain that contains the amino acid sequence
- the monoclonal antibody, or antigen-binding fragment thereof comprises a light chain variable domain that contains an amino acid sequence that is at least 90% homologous to an amino acid sequence
- the monoclonal antibody, or antigen-binding fragment thereof comprises a light chain variable domain that contains the amino acid sequence DVVMTQSPSSVSASVGDRVTITCRASQS IGSWLAWYQQKPGEAPKLLIYAASTLQRGVPSRFSG GGYGTEFTLTISSPLQFQGHSH
- the monoclonal antibody, or antigen binding fragment thereof comprises a light chain variable domain that contains an amino acid sequence at least 90% homologous to the amino acid sequence QSALTQPASVSGSPGQS ITISCTGTSTDIGTYKYISWYQQHPGKAPKLI IYGVSFLISGTSGVSDN
- the monoclonal antibody, or antigen-binding fragment thereof comprises a light chain variable domain that contains the amino acid sequence QSALTQPASVSGSPGQS ITISCTGTSTDIGTYKYISWYQQHPGKAPKLI IYGVSHRPSGVSDRF SGSKSDNTASLEDGTSGLL
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of a heavy chain that contains an amino acid sequence that is at least 90% homologous to an amino acid sequence EVQLVQSGGGWQPGKSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVIWFDGSNKFYTDSV KGRFTISRDNSKDTLSLQMNSLRAEDTAVYYCARELGGYYYDSSGFRPYYYGTM NOVWG 4;
- light chain variable domain that contains an amino acid sequence that is at least 90% homologous to an amino acid sequence
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- variable domain of a heavy chain that contains an amino acid sequence that is at least 90% homologous to an amino acid sequence
- light chain variable domain that contains an amino acid sequence that is at least 90% homologous to an amino acid sequence
- the monoclonal antibody, or antigen-binding fragment thereof comprises:
- the GITR specific monoclonal antibody is a full length IgG antibody.
- the IgG monoclonal antibody is of the human IgGl, IgG2, IgG3, or IgG4 isotype.
- the IgG monoclonal antibody is of the human IgG1 isotype.
- the monoclonal antibody specific for GITR comprises an E345R mutation in the Fc fragment to increase agonistic properties, antibody dependent cellular cytotoxicity (ADCC), but not complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cellular cytotoxicity
- CDC complement dependent cytotoxicity
- the monoclonal antibody comprises a heavy chain having an amino acid sequence that is at least 90% sequence homologous
- the monoclonal antibody comprises a heavy chain comprising the amino acid sequence
- the monoclonal antibody comprises a heavy chain having an amino acid sequence that is at least 90% sequence homologous
- the monoclonal antibody comprises a heavy chain comprising the amino acid sequence
- the monoclonal antibody comprises a light chain comprising an amino acid sequence that is at least 90% sequence homologous
- the monoclonal antibody comprises a light chain comprising the amino acid sequence
- the monoclonal antibody comprises:
- the monoclonal antibody that specifically binds to GITR is BCD166-01-001.
- Monoclonal antibody BCD166-01-001 includes:
- a heavy chain comprising the amino acid sequence EVQLVQSGGGWQPGKSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVIWFDGSNKFYTDSV KGRFTISRDNSKDTLSLQMNSLRAEDTAVYYCARELGGYYYDSSGFRPYYYGMDVWGQGTMVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
- a light chain comprising the amino acid sequence DVVMTQSPSSVSASVGDRVTITCRASQSIGSWLAWYQQKPGEAPKLLIYAASTLQRGVPSRFSG GGYGTEFTLTISSLQPEDFATYFCQQSHSHPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSG TASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVY ACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 11).
- the monoclonal antibody comprises:
- the monoclonal antibody that specifically binds to GITR is BCD166-02-001.
- BCD166-02-001 differs from BCD166-01-001 by one mutation E345R in the Fc fragment to increase agonistic properties, antibody dependent cellular cytotoxicity (ADCC), but not complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cellular cytotoxicity
- CDC complement dependent cytotoxicity
- Monoclonal antibody BCD166-02-001 includes:
- a heavy chain comprising the amino acid sequence EVQLVQSGGGWQPGKSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVIWFDGSNKFYTDSV KGRFTISRDNSKDTLSLQMNSLRAEDTAVYYCARELGGYYYDSSGFRPYYYGMDVWGQGTMVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRRPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
- the monoclonal antibody comprises a heavy chain containing an amino acid sequence that is at least 90% sequence homologous
- the monoclonal antibody comprises a heavy chain comprising the amino acid sequence
- the monoclonal antibody comprises a light chain comprising an amino acid sequence that is at least 90% sequence homologous
- the monoclonal antibody comprises a light chain comprising the amino acid sequence
- the monoclonal antibody comprises:
- the monoclonal antibody that specifically binds to GITR is BCD166-01-014.
- Monoclonal antibody BCD166-01-014 includes:
- the present invention also relates to nucleic acid molecules, namely, sequences encoding a monoclonal antibody that specifically binds to GITR of this invention, as described herein, optionally including any peptide linker sequence connecting them.
- nucleotide sequence covers its compliment unless otherwise indicated.
- reference to a nucleic acid having a specific sequence is to be understood as encompassing its complementary strand with its complementary sequence.
- polynucleotide means a polymeric form of nucleotides at least 10 bases in length, either ribonucleotides or deoxynucleotides, or a modified form of any type of nucleotide. The term includes single and double stranded forms.
- the present invention relates to a nucleic acid molecule comprising a nucleotide sequence that encodes an amino acid sequence selected from SEQ ID NO: 1-21.
- a nucleic acid molecule can also contain any combination of the indicated nucleotide sequences.
- the present invention provides a nucleic acid that contains a nucleotide sequence that encodes a monoclonal antibody or antigen-binding fragment thereof that specifically binds to GITR, and includes:
- NYGMH (SEQ ID NO: 1) or YYWMY (SEQ ID NO: 12);
- VIWFDGSNKFYTDSVKG (SEQ ID NO: 2) or AISWNGGRTYYAESMKG (SEQ ID NO: 13);
- RASQSIGSWLA SEQ ID NO: 7
- TGTSTDIGTYKYIS SEQ ID NO: 8
- AASTLQR (SEQ ID NO: 8) or GVSHRPS (SEQ ID NO: 18);
- QQSHSHPLT (SEQ ID NO: 9) or SSYTSSGTW (SEQ ID NO: 19).
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody or antigen-binding fragment thereof, which includes a heavy chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 1, 2, and 3, respectively.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody or antigen binding fragment thereof, which includes a heavy chain variable domain that contains CDRs 1, 2, and 3 with amino acid sequences represented by SEQ ID NOs: 12, 13, and 14, respectively.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody or antigen-binding fragment thereof, which includes a light chain variable domain that contains CDRs 1, 2, and 3 with the amino acid sequences represented by SEQ ID NOs: 7, 8, and 9, respectively.
- the nucleic acid molecule comprises a nucleotide sequence that encodes variants of a monoclonal antibody or antigen-binding fragment thereof, which includes a light chain variable domain that contains CDRs 1, 2, and 3 with amino acid sequences represented by SEQ ID NOs: 17, 18, and 19 , respectively.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, which includes:
- variable domain of the heavy chain which contains CDRs 1, 2 and 3 with amino acid sequences represented by the sequences of SEQ ID NO: 1, 2 and 3, respectively;
- variable domain of the light chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 7, 8 and 9, respectively.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, which includes:
- variable domain of the heavy chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 12, 13 and 14, respectively;
- variable domain of the light chain which contains CDRs 1, 2 and 3 with the amino acid sequences represented by the sequences of SEQ ID NO: 17, 18 and 19, respectively.
- the nucleic acid molecule contains a nucleotide sequence that encodes a monoclonal antibody or antigen-binding fragment thereof, which includes a heavy chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 4.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, that includes a heavy chain variable domain that comprises the amino acid sequence of SEQ ID NO: 4.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, that includes a heavy chain variable domain that contains an amino acid a sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 15.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, which includes a heavy chain variable domain that comprises the amino acid sequence of SEQ ID NO: 15.
- the nucleic acid molecule contains a nucleotide sequence that encodes a monoclonal antibody or antigen-binding fragment thereof, which includes a light chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 10.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, that includes a light chain variable domain that comprises the amino acid sequence of SEQ ID NO: 10.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, that includes a light chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 20.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody or antigen-binding fragment thereof that includes a light chain variable domain that comprises the amino acid sequence of SEQ ID NO: 20.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, which includes:
- variable domain of the heavy chain which contains an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 4;
- a light chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 10.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, which includes:
- variable domain of the heavy chain that contains the amino acid sequence of SEQ ID NO: 4;
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, which includes:
- variable domain of a heavy chain which contains an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 15;
- a light chain variable domain that contains an amino acid sequence that is at least 90% homologous to the amino acid sequence of SEQ ID NO: 20.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody, or antigen-binding fragment thereof, which includes:
- variable domain of the heavy chain that contains the amino acid sequence of SEQ ID NO: 15;
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that specifically binds to GITR, which is a full length IgG antibody.
- the nucleic acid molecule comprises a nucleotide sequence that encodes an IgG monoclonal antibody that is of the human IgGl, IgG2, IgG3, or IgG4 isotype.
- the nucleic acid molecule comprises a nucleotide sequence that encodes an IgG monoclonal antibody that is of the human IgGl isotype.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that specifically binds to GITR, which includes an E345R mutation in the Fc fragment to increase agonistic properties, antibody dependent cellular cytotoxicity (ADCC), but not complement dependent cytotoxicity (CDC).
- ADCC antibody dependent cellular cytotoxicity
- CDC complement dependent cytotoxicity
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a heavy chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: 5.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a heavy chain comprising the amino acid sequence of SEQ ID NO: 5.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a heavy chain containing an amino acid sequence at least 90% homologous to the sequence SEQ ID NO: b.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a heavy chain comprising the amino acid sequence of SEQ ID NO: b.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a light chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: 11.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a light chain comprising the amino acid sequence of SEQ ID NO: 11.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes:
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes:
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes:
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes:
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a heavy chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: 16.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a heavy chain comprising the amino acid sequence of SEQ ID NO: 16.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a light chain having an amino acid sequence that is at least 90% homologous to SEQ ID NO: 21.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes a light chain comprising the amino acid sequence of SEQ ID NO: 21.
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes:
- the nucleic acid molecule comprises a nucleotide sequence that encodes a monoclonal antibody that includes:
- the nucleic acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
- the nucleic acid molecules can be isolated.
- nucleic acid molecule of this invention can be isolated from any source that produces a monoclonal antibody that specifically binds to GITR. In certain embodiments of the invention, the nucleic acid molecule of this invention can be synthesized rather than isolated. In one embodiment, nucleic acid molecules encoding VH (SEQ ID NO: 4 or SEQ ID NO: 15) or VL (SEQ ID NO: 10 or SEQ ID NO: 20) domains are converted to full length antibody genes by insertion into an expression vector already encoding heavy chain (CH) or light chain (CL) constant domains, respectively, such that the VH segment is operably linked to the CH segment (s) in the vector and / or the VL segment is operatively linked to the CL segment in the vector.
- VH SEQ ID NO: 4 or SEQ ID NO: 15
- VL SEQ ID NO: 10 or SEQ ID NO: 20 domains
- nucleic acid molecules encoding VH and / or VL domains are converted to genes along the entire length of the antibody by linking, for example, ligating, a nucleic acid molecule encoding VH and / or VL domains to a nucleic acid molecule encoding CH and / or CL domains using standard molecular biology techniques. Nucleic acid molecules encoding the entire length of the heavy and / or light chain can then be expressed from the cell into which they were introduced.
- Nucleic acid molecules can be used to express a large amount of recombinant monoclonal antibody that specifically binds to GITR.
- the present invention provides a vector suitable for expressing any of the nucleotide sequences described herein.
- the present invention relates to vectors containing nucleic acid molecules that encode any of the amino acid sequences of a monoclonal antibody that specifically binds to GITR, or parts thereof (e.g., heavy chain sequences of the first and / or heavy and / or light chain of the second binding domains) as described in this document.
- the present invention further relates to vectors containing nucleic acid molecules encoding fusion proteins, modified antibodies, antibody fragments.
- a monoclonal antibody that specifically binds to GITR of this invention is expressed by inserting DNA encoding part or all of the sequence of the first and second binding domain (e.g., heavy and light chain sequences, where the binding domain contains heavy and light sequences chains), obtained as described above, in expression vectors in such a way that the genes are operably linked to the necessary control sequences expression such as transcriptional and translational control sequences.
- Expression vectors include plasmids, retroviruses, adenoviruses, adeno-associated viruses (AAV), plant viruses such as cauliflower mosaic virus, tobacco mosaic viruses, cosmids, YACs, EBV derived episomes, and the like.
- DNA molecules can be ligated into a vector such that the sequences that control transcription and translation in the vector perform their intended function of regulating DNA transcription and translation.
- the expression vector and expression control sequences can be selected to be compatible with the expression host cell used.
- DNA molecules encoding part or all of the sequences of the first and second binding domains eg, heavy and light chain sequences, where the binding domain contains the sequence of the heavy and light chain
- DNA molecules can be introduced into separate vectors. In one embodiment, any combination of the above DNA molecules is introduced into the same expression vector.
- DNA molecules can be introduced into the expression vector by standard methods (for example, ligation of complementary restriction sites on the fragment of the antibody gene and the vector, or blunt-end ligation if there are no restriction sites).
- a suitable vector is one that encodes functionally complete human immunoglobulin CH or CL sequences with appropriate restriction site construction such that any VH or VL sequence can be readily incorporated and expressed as described above.
- HC- and LC-coding of genes in such vectors may contain intron sequences, which leads to an overall increase in antibody protein products by stabilizing the corresponding mRNA.
- Intron sequences are surrounded by splice donor and splice acceptor sites that determine where RNA splicing will take place.
- the location of intron sequences can be either in the variable or constant regions of the antibody chains, or in both variable and constant regions when multiple introns are used. Termination of polyadenylation and transcription can occur downstream of the native chromosome site of the encoded regions.
- the recombinant expression vector can also encode a signal peptide that facilitates the production of an antibody chain by a host cell.
- the antibody chain gene can be cloned into a vector such that the signal peptide is linked to the reading frame of the amino terminus of the immunoglobulin chain.
- the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (ie, a signal peptide of a non-immunoglobulin protein).
- the recombinant expression vectors of the invention may carry regulatory sequences that control the expression of the antibody chain genes in the host cell.
- mammalian host cell expression control sequences include viral elements for high expression of proteins in mammalian cells, such as promoters and / or enhancers derived from retroviral LTR, cytomegalovirus (CMV) (e.g., CMV promoter / enhancer), simian virus 40 (SV40) (e.g.
- CMV cytomegalovirus
- SV40 simian virus 40
- SV40 promoter / enhancer adenovirus (e.g., adenovirus large late promoter (AdMLP)), polyoma virus, and strong mammalian promoters such as the native immunoglobulin promoter or actin promoter.
- AdMLP adenovirus large late promoter
- strong mammalian promoters such as the native immunoglobulin promoter or actin promoter.
- the recombinant expression vectors of the invention may carry additional sequences, such as sequences that regulate replication of the vector in host cells (eg, origin of replication) and selectable marker genes.
- the selectable marker gene facilitates the selection of host cells into which the vector has been introduced (see, for example, US patents 4,399,216, 4,634,665 and 5,179,017).
- typically a selectable marker gene confers resistance to drugs such as G418, hygromycin or methotrexate to the host cell into which the vector has been introduced.
- selectable marker genes include a dihydrofolate reductase (DHFR) gene (for use in dhfr host cells for methotrexate selection / amplification), a neo gene (for G418 selection), and a glutamate synthetase gene.
- DHFR dihydrofolate reductase
- neo for G418 selection
- glutamate synthetase gene glutamate synthetase gene
- expression control sequence means polynucleotide sequences that are required to influence the expression and processing of the coding sequences to which they are ligated.
- Expression Control Sequences include the corresponding sequences of transcription initiation, termination, promoter and enhancer; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that increase protein stability; and, if desired, sequences that enhance protein secretion.
- control sequences differs depending on the host organism; in prokaryotes, such control sequences typically include a promoter, a ribosome binding site, and transcription termination sequences; in eukaryotes, such control sequences generally include promoters and transcription termination sequences.
- control sequences includes at least all components that are essential for expression and processing, and may also include additional components whose presence is useful, for example, leader sequences and fusion cell sequences.
- An additional aspect of the present invention relates to methods for producing a monoclonal antibody that specifically binds to GITR according to this invention.
- One embodiment of the invention relates to a method for producing a monoclonal antibody that specifically binds to GITR as defined herein, comprising obtaining a recombinant host cell capable of expressing a monoclonal antibody that specifically binds to GITR, culturing said host cell under conditions suitable for expressing the production of a monoclonal antibody that specifically binds to GITR, and isolating the resulting monoclonal antibody that specifically binds to GITR.
- a monoclonal antibody that specifically binds to GITR obtained by such expression in such recombinant host cells is referred to herein as a “recombinant monoclonal antibody that specifically binds to GITR”.
- the invention also relates to the progeny of the cells of such host cells and a monoclonal antibody that specifically binds to GITR prepared in a similar manner.
- Nucleic acid molecules encoding a monoclonal antibody that specifically binds to GITR according to the invention and vectors containing these nucleic acid molecules can be used to transfect a suitable mammal or its cell, plant or cell, bacterial or yeast host cells. Conversion can occur by any known method for introducing polynucleotides into a host cell. Methods for introducing heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, nucleic acid-positively charged polymer complex transfection, nucleic acid calcium phosphate precipitate transfection, polybrene-mediated transfection, protoplast fusion, and lipid encapsulation transfection. direct microinjection of DNA into the nucleus.
- nucleic acid molecules can be introduced into mammalian cells by viral vectors.
- Methods for transfecting cells are well known in the art. See, for example, U.S. Patent Nos. 4,399,216, 4,912,040, 4,740,461, and 4,959,455.
- Methods for transforming plant cells are well known in the art, including, for example, Agrobacterium-mediated transformation, biolistic transformation, direct injection, electroporation, and viral transformation. Methods for transforming bacterial and yeast cells are also well known in the art.
- Mammalian cell lines used as hosts for transformation are well known in the art and include many immortalized cell lines available. These include, for example, Chinese hamster ovary (CHO) cells, NS0 cells, SP2 cells, HEK-293T cells, 293 Freestyle cells (Invitrogen), NIH-3T3 cells, HeLa cells, hamster kidney cells (BHK), African kidney cells green monkeys (COS), human hepatocellular carcinoma cells (eg, Hep G2), A549 cells and a number of other cell lines. Cell lines are selected by determining which cell lines have high levels of expression and provide the desired characteristics of the produced protein. Other cell lines that can be used are insect cell lines such as Sf9 or Sf21 cells.
- the antibodies When recombinant expression vectors encoding a monoclonal antibody that specifically binds to GITR are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a time sufficient to express the antibodies in the host cells, or, more preferably, isolate the antibodies into a culture medium. in which host cells are grown.
- a monoclonal antibody that specifically binds to GITR can be isolated from culture media using standard protein purification techniques.
- Plant host cells for example, include Nicotiana, Arabidopsis, duckweed, corn, wheat, potatoes, etc.
- Host bacterial cells include Escherichia and Streptomyces species.
- Yeast host cells include Schizosaccharomyces pombe, Saccharomyces cerevisiae, and Pichia pastoris.
- the level of production of a monoclonal antibody that specifically binds to GITR of the present invention from a producing cell line can be enhanced by a number of known techniques.
- the glutamine synthetase gene expression system (GS system) is widespread enough to enhance expression under certain conditions.
- the GS system is discussed in whole or in part in connection with EP 0216846, 0256055, 0323997 and 0338841.
- a monoclonal antibody that specifically binds to GITR from different cell lines or transgenic animals will differ in glycosylation profile.
- a monoclonal antibody that specifically binds to GITR, encoded by the nucleic acid molecules described herein, or containing the amino acid sequences described herein are part of this invention, regardless of the glycosylation state of the binding molecules and in general, regardless of the presence or absence of post-translational modifications.
- the invention also relates to methods and processes for producing a monoclonal antibody that specifically binds to GITR and antigen binding fragments thereof.
- Monoclonal antibodies can be generated, for example, using the hybridoma-based method first described by Kohler et al. , Nature, 256, 1975, pp. 495, or using recombinant DNA techniques (US 4816567).
- lymphocytes When using the hybridoma method, a mouse or other suitable host animal, such as a hamster, is immunized as described above in order to induce the formation of lymphocytes that produce, or can produce, antibodies capable of specifically binding to the protein used for immunization.
- lymphocytes can be obtained by in vitro immunization. After immunization, lymphocytes are isolated and then fused with a myeloma cell line using a suitable binding agent such as polyethylene glycol to obtain a hybridoma cell.
- the hybridoma cells thus obtained are seeded and grown in a suitable culture medium, which preferably contains one or more substances that inhibit the growth or survival of non-fused parental myeloma cells.
- a suitable culture medium which preferably contains one or more substances that inhibit the growth or survival of non-fused parental myeloma cells.
- the parental myeloma cells do not contain the enzyme hypoxanthine guanine phosphoribosyltransferase (HGPRT or HPRT)
- HGPRT or HPRT hypoxanthine guanine phosphoribosyltransferase
- HGPRT hypoxanthine guanine phosphoribosyltransferase
- HAT medium hypoxanthine, aminopterin and thymidine
- Preferred myeloma cells as a fusion component are cells that readily fuse, maintain a stable high level of antibody production by the selected antibody-producing cells, and are sensitive to a selective environment in which unbound parental cells are selected.
- Preferred myeloma cell lines are murine myeloma lines, such as those derived from the murine tumor cell lines MOPC-21 and MPC-11, available from the Salk Institite Cell Disrtibution Center, San Diego, NY. California, USA, and lines SP-2 or HBZ-Ad8-653, available from the American Type Culture Collection, Rockville, CA. Maryland, USA.
- the use of human myeloma and mouse-human heteromyeloma cell lines for the production of monoclonal antibodies has also been described (Kozbor, J. Immunol., 133, 1984, p. 3001).
- the binding specificity of monoclonal antibodies obtained using hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay such as radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA).
- an in vitro binding assay such as radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA).
- the binding affinity of the monoclonal antibody can, for example, be determined using the Scatchard assay described by Munson et al. , Anal. Biochem., 107, 1980, p. 220.
- the clones can be subcloned using the limiting dilution method and grown by standard methods. Suitable media for this purpose include, for example, DMEM or RPMI-1640 media.
- hydriboma cells can be grown in vivo as ascites tumors in animals, for example, by intraperitoneal (i.p.) injection of cells into mice.
- Monoclonal antibodies secreted by subclones can be separated from the culture medium, ascites fluid or serum using conventional antibody purification methods, for example, affinity chromatography (for example, using protein A or protein Q-sepharose), or ion exchange chromatography, hydroxylapatite chromatography, gel electrophoresis, dialysis, etc.
- affinity chromatography for example, using protein A or protein Q-sepharose
- ion exchange chromatography for example, using protein A or protein Q-sepharose
- hydroxylapatite chromatography hydroxylapatite chromatography
- gel electrophoresis dialysis, etc.
- DNA encoding monoclonal antibodies can be easily isolated and sequenced using conventional procedures (for example, using oligonucleotide probes that have the ability to specifically bind to genes encoding heavy and light chains of murine antibodies).
- Hybridoma cells are a preferred source of such DNA.
- the DNA can be incorporated into expression vectors, which are then transfected into host cells such as E. coli cells, monkey COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not produce antibody protein without transfection, resulting in synthesis of monoclonal antibodies in recombinant host cells.
- monoclonal antibodies or antibody fragments can be isolated from phage antibody libraries created using the methods described by McCafferty et al. , Nature, 348, 1990, pp. 552-554. Clackson et al. , Nature, 352, 1991, pp. 624-628 and Marks et al. , J. Mol. Biol., 222, 1991, pp. 581-597 describe the isolation of murine and human antibodies, respectively, using phage libraries. Subsequent publications have described the production of high affinity (nM-range) human antibodies by chain shuffling (Marks et al., Bio / Technology, 10, 1992, pp.
- the DNA encoding the antibody can also be modified, for example to produce chimeric or fusion antibody polypeptides, for example, by replacing the heavy and light chain constant region sequences (CH and CL) with homologous murine sequences (US Pat. No. 4,816,567 and Morrison et al., Proc. Natl. Acad. Sci. USA: 81, 1984, p. 6851) or by covalently linking an immunoglobulin coding sequence to all or part of the coding sequence of a non-immunoglobulin polypeptide (heterologous polypeptide).
- CH and CL heavy and light chain constant region sequences
- homologous murine sequences US Pat. No. 4,816,567 and Morrison et al., Proc. Natl. Acad. Sci. USA: 81, 1984, p. 6851
- Non-immunoglobulin polypeptide sequences can be substituted for antibody constant regions or substituted for variable regions of an antibody antigen-binding site to create a chimeric bivalent antibody that contains one antigen-binding site with specificity for an antigen and another antigen-binding site with specificity for another.
- transgenic animals for example, mice
- transgenic animals for example, mice
- DNA segment antibody heavy chain gene junction
- transfer of a human immunoglobulin gene germline kit into such a mutant mouse germline results in the production of human antibodies after challenge with the antigen (US 5545806, 5569825, 5591669 (all in the name of GenPharm); 5545807; and WO 97/17852).
- phage display technology can be used to obtain human antibodies and antibody fragments in vitro from the immunoglobulin variable region (V) genes spectrum from immunized donors (McCafferty et al., Nature, 348, 1990, pp. 552-553).
- V region genes are cloned in frame with either the major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and presented as functional antibody fragments on the phage particle surface. Since the filamentous particle contains a copy of the single-stranded DNA of the phage genome, selection based on the functional properties of the antibody also leads to the selection of the gene encoding the antibody that has these properties.
- the phage mimics some of the properties of the B cell.
- Phage presentation can be done in a variety of formats.
- Various sources of V gene segments can be used for phage presentation. Clackson and others. , Nature, 352, 1991, pp. 624-628 isolated various sets of anti-oxazolone antibodies from a small random combinatorial V-gene library obtained from the spleen of immunized mice.
- a spectrum of V genes obtained from immunized human donors can be constructed, and antibodies to a different set of antigens (including autoantigens) can be isolated generally according to the methods described by Marks et al. , J. Mol. Biol., 222, 1991, pp. 581-597.
- human antibodies can also be produced in vitro by activated B cells (see US Pat. No. 5,567,610 and 5,229,275).
- fragments of antibodies rather than full antibodies.
- the smaller size of the fragments facilitates their rapid clearance and may facilitate better penetration into solid tumors.
- antibody fragments Traditionally, these fragments were obtained by proteolytic cleavage of intact antibodies. However, at present, these fragments can be obtained directly using recombinant host cells. Fab, Fv and scFv antibody fragments can be expressed and secreted from E. coli to facilitate the production of large quantities of these fragments. Antibody fragments can be isolated from the antibody phage libraries described above. In another embodiment, Fab 'SH fragments can be directly isolated from E. coli and chemically ligated to generate F (ab') 2 fragments (Carter et al., Bio / Technology, 10, 1992, pp. 163-167).
- F (ab ') 2 fragments can be isolated directly from the culture of the recombinant host cells.
- Fab and F (ab ') 2 fragments with increased in vivo half-lives, in which epitope-binding receptor residues are retained, are described in US Pat. No. 5,869,046.
- Other techniques for preparing antibody fragments will be apparent to those skilled in the art.
- the antibody of choice is a single chain Fv fragment (scFv) (see WO 93/16185; US 5571894 and US 5587458).
- scFv single chain Fv fragment
- Fv and scFv are the only species with intact binding sites devoid of constant regions; as a result, they can be used for reduced non-specific binding when used in vivo.
- Fusion proteins carrying scFvs can be engineered to produce an effector protein fusion at either the N- or C-terminus of the scFv.
- An antibody fragment can also be a "linear antibody", for example, as described in US Pat. No. 5,641,870. Such linear antibody fragments can be monospecific or bispecific.
- Another aspect of the invention is a pharmaceutical composition
- a pharmaceutical composition comprising, as an active ingredient (or as the only active ingredient), a monoclonal antibody that specifically binds to GITR.
- the pharmaceutical composition may include at least one monoclonal antibody that specifically binds to GITR and at least one of the components selected from the group consisting of pharmaceutically acceptable and pharmacologically compatible excipients.
- the pharmaceutical composition may include at least one monoclonal antibody that specifically binds to GITR and one or more additional binding molecules (eg, antibodies) that target one or more corresponding surface receptors.
- the compositions are designed to improve, prevent, or treat disorders that may be associated with GITR.
- “Pharmaceutical composition” means a composition comprising a monoclonal antibody that specifically binds to GITR according to the invention and at least one of the components selected from the group consisting of pharmaceutically acceptable and pharmacologically compatible excipients such as fillers, solvents, diluents , carriers, auxiliary, distribution, delivery vehicles, preservatives, stabilizers, emulsifiers, suspending agents, thickeners, slow-release regulators, the choice and ratio of which depends on the nature and method of administration and dosage.
- the pharmaceutical compositions of the present invention and methods of making them will be undeniably obvious to those skilled in the art.
- the production of pharmaceutical compositions should preferably comply with GMP (Good Manufacturing Practice) requirements.
- the composition may include a buffering composition, tonic agents, stabilizers, and solubilizers. Prolonged action of the composition can be provided by agents that delay absorption of the active pharmaceutical ingredient, for example, aluminum monostearate and gelatin.
- suitable carriers, solvents, diluents and delivery vehicles are water, ethanol, polyalcohols, as well as mixtures thereof, oils, and injectable organic esters.
- Drug (preparation) a substance or a mixture of substances in the form of a pharmaceutical composition in the form of tablets, capsules, powders, lyophilisates, injections, infusions, ointments, etc. ready-made forms, designed to restore, correct or change physiological functions in humans and animals, as well as for the treatment and prevention of diseases, diagnostics, anesthesia, contraception, cosmetology and others. Any method of administering peptides, proteins or antibodies accepted in the art can be suitably used for a monoclonal antibody that specifically binds to GITR of the present invention.
- pharmaceutically acceptable means one or more compatible liquid or solid components that are suitable for administration to a mammal, preferably a human.
- excipient or “excipient” is used herein to describe any component other than those previously described in this invention. These are substances of inorganic or organic origin used in the production process, the manufacture of drugs to give them the necessary physical and chemical properties.
- buffer means a solution that is able to maintain the pH value due to the interaction of acidic and alkaline components that make up its composition, which enables the preparation of monoclonal antibodies that specifically bind to GITR exhibit resistance to pH changes.
- the pH of the pharmaceutical composition is preferably from 4.0 to 8.0.
- buffering agents for example, acetate, phosphate, citrate, histidine, succinate and the like can be used. buffer solutions, but not limited to them.
- tonic agent refers to an excipient that can apply the osmotic pressure of a liquid antibody preparation.
- An "isotonic” drug is a drug that has an osmotic pressure equivalent to that of human blood. Isotonic formulations typically have an osmotic pressure of about 250 to 350 mOsm / kg.
- isotonic agents polyols, mono- and disaccharides, amino acids, metal salts, for example, sodium chloride, and the like, can be used, but are not limited to them.
- stabilizer an auxiliary substance or a mixture of two or more auxiliary substances that provide the physical and / or chemical stability of the active agent.
- Amino acids can be used as stabilizers, for example, but not limited to arginine, histidine, glycine, lysine, glutamine, proline; surfactants such as polysorbate 20 (trade name Tween 20), polysorbate 80 (trade name Tween 80), polyethylene-polypropylene glycol and copolymers (trade names Poloxaner, Pluronic), sodium dodecyl sulfate (SDS ), but not limited to them; antioxidants, for example, but not limited to methionine, acetylcysteine, ascorbic acid, monothioglycerol, sulfuric acid salts, and the like; chelating agents, for example, but not limited to ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTPA), sodium citrate and the like.
- a pharmaceutical composition is "stable" if the active agent maintains its physical stability and / or chemical stability and / or biological activity during the stated shelf life at a storage temperature, for example, at 2-8 ° C. It is preferred that the active agent retains both physical and chemical stability as well as biological activity.
- the storage period is selected based on the results of stability studies with accelerated and natural storage.
- the pharmaceutical composition of this invention can be manufactured, packaged or marketed as a unit dosage or a plurality of unit dosages in a finished dosage form.
- unit dosage means a discrete amount of a pharmaceutical composition containing in advance a certain amount of the active ingredient.
- the amount of active ingredient is usually equal to the dosage of the active ingredient to be administered to the subject, or a convenient portion of such dosage, for example, half or a third of such dosage.
- compositions of the present invention are generally suitable for parenteral administration in the form of sterile drugs intended for administration to the human body in violation of the integrity of the skin or mucous membranes, bypassing the gastrointestinal tract by injection, infusion or implantation.
- parenteral administration is contemplated to include, but is not limited to, subcutaneous, intraperitoneal, intramuscular, intravenous, intraarterial, intrathecal, intraventricular, intraurethral, intracranial, intra-articular, transdermal injection or infusion .; and renal dialysis infusion techniques.
- Intratumoral delivery such as intratumoral injection, may also be useful.
- Regional perfusion is also provided.
- Preferred embodiments of the invention include intravenous and subcutaneous routes. Any method of administering peptides or proteins accepted in the art can be suitably used for a monoclonal antibody that specifically binds to GITR of the present invention.
- Injectable drugs can be manufactured, packaged or sold in unit dosage form, for example, in ampoules, vials, polymer containers, pre-filled syringes, autoinjection devices, but not limited to them.
- Medicines for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous bases, pastes, and the like.
- Another embodiment of the invention is a medicament for parenteral administration, where the pharmaceutical composition is provided in dry form, that is, a powder or granules for dissolution in a suitable solvent (eg sterile pyrogen-free water) prior to administration.
- a suitable solvent eg sterile pyrogen-free water
- Such a drug can be obtained, for example, by lyophilization, i.e. a process known in the art as freeze drying, which includes freezing the preparation and then removing the solvent from the frozen contents.
- the monoclonal antibody that specifically binds to GITR of this invention can also be administered intranasally or by inhalation, alone, as a mixture with a suitable pharmaceutically acceptable vehicle from an inhaler, such as a pressurized aerosol container, pump, spray, nebulizer) or nebulizer, in which a suitable propellant is used or not used, or in the form of nasal drops or spray.
- a suitable pharmaceutically acceptable vehicle from an inhaler, such as a pressurized aerosol container, pump, spray, nebulizer) or nebulizer, in which a suitable propellant is used or not used, or in the form of nasal drops or spray.
- the drug for parenteral administration can be immediate or modified release. Modified release drugs include delayed, sustained, pulsed, controlled, targeted and programmed release.
- a monoclonal antibody that specifically binds to GITR of the present invention is used in the treatment of disorders that are associated (mediated) with GITR activity.
- the subject of treatment or patient is a mammal, preferably a human subject.
- the above subject can be male or female and of any age.
- a monoclonal antibody or antigen-binding fragment thereof that specifically binds to GITR is used to treat a disease or disorder mediated by GITR, where the disease or disorder is selected from the group of cervical cancer (cervical cancer), head and neck cancer, stomach cancer, BC (breast cancer), renal cell carcinoma, CRC (colorectal cancer), OC (ovarian cancer), NSCLC (non-small cell lung cancer).
- a therapeutically effective amount of an antibody or antibody fragment can reduce the number of cancer cells; reduce the initial tumor size; inhibit (i.e., slow down to some extent) and, preferably, stop) cancer cell infiltration of peripheral organs; inhibit (i.e. slow down to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and / or facilitate, to some extent, one or more symptoms associated with the disorder
- the antibody or antibody fragment may, to some extent, prevent the growth and / or kill existing cancer cells, it may cause a cytostatic and / or cytotoxic effect.
- in vivo efficacy can be determined, for example, by assessing the duration life, time to disease progression (TTP), frequency from tumor response rate (RR), duration of response and / or quality of life.
- co-administration refers to a monoclonal antibody that specifically binds to GITR, one or more other therapeutic agents, are intended to mean, refer to, or include: 1) the simultaneous administration of such a combination of a monoclonal antibody, which specifically binds to GITR, according to this invention and a therapeutic agent to a patient in need of treatment, when such components are formulated together in a single dosage form, from which said components are released substantially simultaneously to said patient,
- a monoclonal antibody that specifically binds to GITR of the present invention can be administered without additional therapeutic treatment, i.e. as an independent therapy.
- treatment with a monoclonal antibody that specifically binds to GITR according to this invention may include at least one additional therapeutic treatment (combination therapy).
- a monoclonal antibody that specifically binds to GITR can be co-administered or formulated with another drug / cancer treatment.
- cytotoxic agent refers to a substance that inhibits or prevents cell function and / or causes cell destruction.
- the term is understood to include radioactive isotopes (for example, At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes Lu), chemotherapeutic agents and toxins such as low molecular weight toxins or enzymatically active toxins having origin from bacteria, fungi, plants or animals, including fragments and / or variants thereof.
- radioactive isotopes for example, At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes Lu
- chemotherapeutic agents and toxins such as low molecular weight toxins or enzymatically active toxins having origin from bacteria, fungi, plants or animals
- chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
- examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclophosphamide (CYTOXAN ®); alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquinone, meturedopa, and uredopa; ethyleneimines and methylmelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide, and trimethylmelamine; acetogenins (for example, bullatacin and bullatacinone); delta-9- tetrahydrocannabinol (dronabinol, MARINOL ®); beta lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN ®
- dynemycin including dynemycin A; esperamycin; as well as the neocarcinostatin chromophore and related chromoprotein chromophores enediin antibiotics, aclacinomisins, actinomycin, autramycin, azaserin, bleomycins, cactinomycin, carbicin, carminomycin, carzinomycin-oxo-dycin, dyacinomycin-5 L-norleucine, doxorubicin (including ADRIAMICIN ®, morfolinodoksorubitsin, tsianomorfolinodoksorubitsin, 2- pyrrolino, doksorubitsinoNS1 in injectable liposomes (DOXOL ®), liposomal doxorubicin TLC D-99 (MYOCET ®), peg
- topoisomerase 1 inhibitor e.g., LURTOTECAN ®
- rmRH e.g., ABARELIX ®
- BAY439006 sorafenib; Bayer
- SU-11248 Pfizer
- perifosin a COX-2 inhibitor (eg, celecoxib or etoricoxib), a proteosome inhibitor (eg, PS341); bortezomib (VELCADE ®); CCI-779; typifarnib (811577); orafenib, AVT510; Vs1-2 inhibitor such as oblimersen sodium (GENASENSE ®); pixantrone; EGFR inhibitors (see definition below); tyrosine kinase inhibitors (see definition below); and pharmaceutically acceptable salts, acids or derivatives of any of the above agents; as well as combinations of two or more of the above,
- protivogormonalnye agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens with mixed profile agonist / antagonist, including, tamoxifen (NOLVADEX ®), 4- hydroxytamoxifen, trioxifene, toremifene (FARESTON ®); idoxifene, droloxifene, raloxifene (EVISTA ®), trioxifene, keoxifene, and selective estrogen receptor modulators (SERM), such as SERM3; pure anti-estrogens without agonist properties, such as fulvestrant (FASLODEX ®), and EM800 (such agents may block estrogen receptor dimerization (ER), inhibit DNA binding, metabolism ER amplify and / or reduce the levels of ER); aromatase inhibitors, including steroidal aromatase inhibitors such as formestane and exemestane (AROMAS IN ®), and nonsteroidal aromat
- therapeutic agents that can be used in combination with an antibody that specifically binds to GITR according to this invention can be inhibitors of growth factor function, for example, such inhibitors include growth factor antibodies and growth factor receptor antibodies (e.g. anti-erbB2 antibody trastuzumab [Herceptin], anti-EGFR antibody panitumumab, anti-erbB1 antibody cetuximab [Erbitux, C225] and any growth factor or growth factor receptor antibodies disclosed by Stern et al . Critical reviews in oncology / haematology, 2005, Vol.
- growth factor antibodies and growth factor receptor antibodies e.g. anti-erbB2 antibody trastuzumab [Herceptin], anti-EGFR antibody panitumumab, anti-erbB1 antibody cetuximab [Erbitux, C225] and any growth factor or growth factor receptor antibodies disclosed by Stern et al . Critical reviews in oncology / haematology, 2005, Vol.
- anti-angiogenic agents such as the inhibitory effects of vascular endothelial growth factor [eg, anti-vascular endothelial cell growth factor antibody bevacizumab (Avastin)], anti-vascular endothelial growth factor receptor antibodies such as anti-KDR antibodies and anti-fltl antibodies; antisense therapies, for example, directed to the above-listed targets such as ISIS 2503, anti-ras antisense agents, or G3139 (Genasense), anti-bc12 antisense agents; gene therapy approaches, including, for example, aberrant gene replacement approaches such as aberrant p53 or aberrant BRCA1 or BRCA2, GDEPT (gene directed enzyme prodrug therapy) approaches using cytosine deaminase, thymidine kinase or bacterial nitroreductase enzyme, targeting patient tolerance to chemotherapy or radiation therapy, such as multidrug resistance gene therapy; immunotherapeutic approaches, including, for example, treatment with Alemtuzumab (Avastin)], anti
- Another therapeutic agent that can be used in combination with an antibody that specifically binds to GITR may be an antibody selected from the group: anti-PD1 antibodies, anti-PD-L1 antibodies, anti-CTLA4 antibodies, anti-4-1BB antibodies, anti-0X40 antibodies, or combinations thereof.
- Another therapeutic agent that can be used in combination with an antibody that specifically binds to GITR according to this invention can be a therapeutically active anticancer compound selected from the group of innate or acquired immunity activators.
- a monoclonal antibody that specifically binds to GITR of this invention can be used in methods of treatment as described above, can be used in treatment as described above, and / or can be used in the manufacture of a medicament for treatment as described above.
- a monoclonal antibody that specifically binds to GITR of the present invention will be administered in an amount effective to treat the condition in question, i.e. in doses and for periods of time necessary to achieve the desired result.
- the therapeutically effective amount can vary depending on factors such as the particular condition being treated, the age, sex, and weight of the patient, and whether administration of a monoclonal antibody that specifically binds to GITR is self-medication, or is given in combination with one or more additional drugs or treatments.
- Dosing regimens can be adjusted to provide the optimal desired response. For example, a single bolus can be administered, several divided doses can be administered over time, or the dose can be proportionally reduced or increased depending on the severity of the therapeutic situation. It is particularly useful to formulate parenteral compositions in unit dosage form for ease of administration and uniformity of dosage.
- Unit dosage form refers to physically discrete units suitable as dosage units for the patients / subjects to be treated; each unit contains a predetermined amount of active compound calculated to produce the desired therapeutic effect in combination with the required pharmaceutical carrier.
- unit dosage forms of the present invention is generally dictated by and directly dependent on (a) the unique characteristics of the chemotherapeutic agent and the particular therapeutic or prophylactic effect to be to be achieved, and (b) the limitations inherent in the technique of compounding such an active compound for treating sensitivity in subjects.
- dosages and dosage regimen are adjusted in accordance with methods well known in the therapeutic field. This means that the maximum tolerated dose can be readily established and the effective amount can also be determined to provide a detectable therapeutic effect for the patient, as well as the time requirements for administration of each agent to achieve a visible therapeutic effect for the patient.
- dosages and regimens of administration are given as examples in this document, these examples do not in any way limit the dosages and regimes of administration that may be needed for a patient in the practice of using the present invention.
- dosage values may vary depending on the type and severity of the condition to be alleviated, and may include one or more doses.
- specific administration regimens should be adjusted over time according to the individual need and at the discretion of the healthcare professional who administers or controls the administration of the compositions, and that the concentration ranges given in this description are given only by way of example and are not intended to limit the scope or practice of the claimed compositions.
- the dosage regimen with the compositions of this invention may be based on various factors, including the type of disease, age, weight, sex, health status of the patient, severity of the condition, route of administration, and the particular monoclonal antibody used that specifically binds to GITR.
- the dosage regimen can vary widely, but can be determined regularly using standard methods. For example, doses can be adjusted based on pharmacokinetic and pharmacodynamic parameters, which can include clinical effects such as toxic effects or laboratory values.
- the present invention encompasses individual dose escalation as determined by the skilled artisan. Determination of the required dose and regimens are well known in the relevant art and will be understood by the person skilled in the art upon reading the ideas disclosed herein.
- a suitable dose of a monoclonal antibody that specifically binds to GITR according to this invention will be in the range of 0.1-200 mg / kg, preferably 0.1-100 mg / kg, including about 0.5-50 mg / kg, for example about 1-20 mg / kg.
- a monoclonal antibody that specifically binds to GITR can be administered, for example, at a dose of at least 0.25 mg / kg, for example, at least 0.5 mg / kg, including at least 1 mg / kg, for example at least 1.5 mg / kg, for example, as well as at least 2 mg / kg, for example, at least 3 mg / kg, including at least 4 mg / kg, for example at least 5 mg / kg; and for example up to a maximum of 50 mg / kg, including up to a maximum of 30 mg / kg, for example up to a maximum of 20 mg / kg, including up to a maximum of 15 mg / kg.
- the administration will be repeated, usually at appropriate intervals, for example, once a week, once every two weeks, once every three weeks, or once every four weeks, and as long as deemed appropriate by the responsible physician, who may in some cases increase or reduce dose if necessary.
- a monoclonal antibody that specifically binds to GITR of the present invention is also used for diagnostic purposes (eg, in vitro, ex vivo).
- a given monoclonal antibody that specifically binds to GITR of the present invention can be used to detect or measure the level of GITR in samples obtained from a patient, for example, a tissue sample or body fluid sample such as inflammatory exudate, blood, serum, fluid bowel, saliva, or urine.
- Suitable detection and measurement methods include immunological methods such as flow cytometry, enzyme-linked immunosorbent assay (ELISA), chemiluminescence analysis, radioimmunoassay, and immunohistology.
- the invention further includes kits, eg, diagnostic kits, containing a monoclonal antibody that specifically binds to GITR of the present invention as described herein.
- the required gene segments were obtained from oligonucleotides created by chemical synthesis. Gene segments from 300 to 4000 kb in length, which are flanked by unique restriction sites, were collected by annealing and ligation of oligonucleotides, including PCR amplification and subsequent cloning through the indicated restriction sites. The DNA sequences of the subcloned gene fragments were confirmed by DNA sequencing.
- DNA sequences were determined by Sanger sequencing.
- variants of expression plasmids intended for expression in prokaryotic cells (E. coli) of short-term expression in eukaryotic cells (for example, in CHO cells) were used.
- the vectors contained: a replication initiation site providing replication of the said plasmid in E. coli, genes that confer resistance in E. coli to various antibiotics (for example, ampicillin and kanamycin).
- the fusion of genes containing the described antibody chains, as described below, was carried out by PCR and / or synthesis and assembly of genes using known recombination methods and procedures by linking the appropriate segments of nucleic acids, for example, using unique restriction sites in the corresponding vectors.
- the subcloned nucleotide sequences were confirmed by DNA sequencing.
- large numbers of plasmids were generated by obtaining plasmids from transformed E. coli cultures.
- GITR gene sequence was cloned into a plasmid for protein production in mammalian cells with the Fc IgGl Lama glama tag (Fig. 1) at the Sall / Notl restriction sites.
- the antigen sequence is separated from the Fc by the protease-labile site of the TEV protease, which was also used to cleave the Fc fragment by treatment with TEV protease and obtaining a tagless version of the antigen.
- the sequence was also cloned into a plasmid containing the FLAG-EPEA-tag (C-tag GE Healthcare) at the C-terminus of the protein (Fig. 2) at the Sall / Notl restriction sites.
- GITRL a similar cloning of the recombinant human GITR ligand
- Plasmids were produced in the required quantities in E. coli cells and purified using the Maxiprep Qiagen kit.
- Antibodies and antigens were produced in a permanent cell line derived from Chinese hamster ovary cells (CHO-K1 line) according to published protocols [Biotechnol Bioeng. 2005 Sep 20; 91 (6): 670-677, Liao Metal. 2004; Biotechnol Lett. 2006 Jun; 28 (11): 843-848; Biotechnol Bioeng. 2003 Nov 5; 84 (3): 332-342].
- Cells constitutively expressing the EBNA1 protein gene (Epstein-Barrvirus nuclear antigen 1) were used. Suspension culture was performed in flasks on an orbital shaker using serum-free media from Life Technologies Corporation and according to the manufacturer's instructions.
- Recombinant GITR and GITRL proteins containing EPEA-tag (glutamic acid-proline-glutamic acid-alanine) at the C-terminus of the protein were isolated and purified from the culture broth using the CaptureSelect C-tag Affinity Matrix sorbent.
- the culture liquid was passed through a chromatographic column pre-filled with 5 ml of C-tag sorbent, then the column was washed with 25 ml of PBS to wash out nonspecifically binding components.
- the bound antigen was eluted under mild conditions using 20mM Tris, 2M MgCl2 pH7.0-7.4. Then the protein was converted into PBS (pH 7.4) by dialysis using a semipermeable dialysis membrane, filtered (0.22 ⁇ m), transferred into tubes and stored at -70 ° C.
- the recombinant GITR-TEV-Fc antigen was isolated from the culture broth and purified using a protein A affinity chromatography column.
- the clarified culture broth was passed through a 5 ml HiTrap rProtein A Sepharose FF column (GE Healthcare) equilibrated with phosphate buffered saline (PBS, pH 7.4).
- PBS phosphate buffered saline
- the column was then washed with 5 column volumes of PBS to wash out non-specific binding components.
- the bound antigen was eluted using 0.1 M glycine buffer pH 3.
- Main the protein peak elution was collected and its pH adjusted to neutrality with 1 M Tris buffer (pH 8). All stages were carried out at a flow rate of 110 cm / h.
- the protein was converted into PBS (pH 7.4) by dialysis using SnakeSkin Dialysis Tubing technology, filtered (0.22 ⁇ m), transferred into tubes and stored at -70 ° C
- RNA of B-lymphocytes from individual blood samples of more than a thousand human donors was isolated using the RNeasy Mini Kit according to the proposed protocol (from QIAGEN). RNA concentration was determined using the Nanovue kit (from GE Healthcare) and the quality of the isolated RNA was checked by electrophoresis in 1.5% agarose gel.
- the reverse transcription reaction was performed using the MMLV RT kit (from Evrogen) according to the recommended protocol using MMuLV reverse transcriptase and random hexameric oligonucleotides as primer.
- Reverse transcription products were used as a template in a two-step polymerase chain reaction to obtain genes of variable domains flanked by restriction sites using a set of oligonucleotides according to the authors' protocols [J Biol Chem. 1999 Jun 25; 274 (26): 18218-30].
- the resulting DNA preparation VL-CK-VH (Fig. 6) was treated with restriction endonucleases NheI / Eco91I and ligated into the original phagemid pH5 (Fig. 7).
- the ligation products were transformed into electrocompetent strain SS320 cells prepared according to the protocols [Methods Enzymol. 2000; 328: 333-63.].
- the repertoire of the MeganLibTM combinatorial phage Fab display library consisted of 10 11 transformants. Phage Fab-library preparations were prepared according to the procedure described previously [J Mol Biol. 1991 Dec 5; 222 (3): 581-97].
- RNA of B-lymphocytes from individual blood samples immunized with recombinant GITR antigens Lama Glama, which demonstrated the maximum specific titer sera were isolated using the RNeasy Mini Kit according to the proposed protocol (from QIAGEN). RNA concentration was determined using the Nanovue kit (from GE Healthcare) and the quality of the isolated RNA was checked by electrophoresis in 1.5% agarose gel.
- the reverse transcription reaction was performed using the MMLV RT kit (from Evrogen) according to the recommended protocol using MMuLV reverse transcriptase and random hexameric oligonucleotides as primer.
- Reverse transcription products were used as a template in a two-step polymerase chain reaction to obtain genes of variable domains flanked by restriction sites using a set of oligonucleotides according to the authors' protocols [J Biol Chem. 1999 Jun 25; 274 (26): 18218-30].
- the selection of immune phage libraries was performed on an EIA / RIA Tube High Binding 5 ml immunotube.
- the antigen (0.5 ml, 2 ⁇ g / ml) was sorbed in a carbonate buffer (0.1 M NaHCO3, pH 9.5) overnight at + 4C.
- the tubes were washed with PBST (10 mM phosphate-buffered saline pH7.3-7.5, 137mM NaCl and 2.7 mM KC1, 0.1% Polysorbate 20) and added the total volume (5 ml) of 0.5% milk powder in PBST for driving.
- PBST mM phosphate-buffered saline pH7.3-7.5, 137mM NaCl and 2.7 mM KC1, 0.1% Polysorbate 20
- the hammering alternates from round to round, for example, if in the 1st round it was 0.5% milk on PBST, then on the 2nd - 1% BSA on PBST. Incubated for an hour at room temperature on a shaker. We washed PBST tubes and added 2 ml of driving buffer and phage libraries to a concentration of approximately 2 * 10 12 phage particles per ml. Incubated with phages for 1-2 hours at room temperature. In subsequent rounds, 4 ml of phage supernatant from the previous round, preliminarily clarified in a centrifuge at 1700 OD 10-15 minutes, was used. The tubes were washed 20 times with PBST.
- Phages were eluted from the surface of the tubes with 0.5 ml of 0.1M glycine buffer pH 2.2: glycine buffer was added to the tubes and stirred slightly for 15 minutes at room temperature. Then the phage solution was transferred into clean non-sorbing tubes with 100 ⁇ l of 1M TrisHC1 pH 8.0 for neutralization. The tubes were kept on ice until the cells were infected. After selection, bacteriophage M13 is cultured using E. coli TG1 strain as a host. Amplification is carried out by infection of the host strain culture with phages and subsequent growth for 12-15 hours.
- Helper phage K07 was added at the rate of 1 ⁇ l per 10 ml of culture (10 10 particles per ml) and incubated at 37C for 1.5 hours without rocking. Then, an equal volume of medium with a single ampicillin (100 ⁇ g / ml) and double kanamycin (40 ⁇ g / ml) and double IPTG (0.2 MM) was added to the cell culture. They were transferred to a rocking chair and the phage was accumulated for 4-5 hours at AIA. The cell culture was centrifuged for 25-30 minutes 17000 g and the supernatant was collected in test tubes. The resulting supernatant was then used in the next round of selection, or the phage was isolated by precipitation for subsequent storage.
- Phages were isolated in the following way: 1/6 volume of a solution containing 20% polyethylene glycol and 2.5 M sodium chloride was added to the supernatant, and vigorously mixed. The solution was incubated on ice for at least 3 hours. Then the solution was centrifuged for 10 minutes at 8000g, the resulting precipitate containing phages was dissolved in 1 ml of TBS buffer (Tris - Borate Buffer).
- TBS buffer Tris - Borate Buffer
- Bacteriophages were isolated after two to three rounds and analysis of specific binding of polyclonal phage to human GITR and nonspecific antigens was performed.
- PBST mM phosphate-buffered saline pH7.3-7.5, 137mM NaCl and 2.7 mM KC1, 0.1% Polysorbate 20
- 300 ⁇ l / well of 0.5% dry milk in PBST for hammering Incubated for an hour at room temperature on a shaker.
- the PBST plates were washed and 50 ⁇ l of phage solutions obtained after 2 and 3 rounds of selection, diluted with plugging buffer from 2 to 256 times, were added to them. Incubated for an hour at room temperature on a shaker. Washed plates with PBST and applied horseradish peroxidase-conjugated anti-M13 antibody in driving buffer. After incubation for an hour, the plates were washed and 50 ⁇ l of the reaction substrate (H2O2 - 0.02% and TMB) in acetate buffer pH 5.0 were added. They were incubated at room temperature in the dark until a slight background appeared in negative controls (but not more than 20 min). The reaction was stopped by adding 25 ⁇ l / well of 10% H2SO4, and the OD in the wells was measured at 450 nm.
- the reaction substrate H2O2 - 0.02% and TMB
- variable domains of antibodies from these libraries were recloned into the expression vector pLL-Fab (Fig. 8) to produce a secreted soluble form of Fab in E. coli cells.
- ELISA was used to search for Fab secreted into the medium from monoclones of E. coli producers obtained from example 5, which specifically bind human GITR.
- Fab with published sequence Fab-gitr3215 (patent pending) was used as a positive control.
- wells of ELISA plates (medium binding from Greiner bio one) were coated with 50 ⁇ l of GITR (0.2 ⁇ g / ml in 1 * carbonate buffer), sealed and incubated overnight at 4 ° C. All subsequent steps were performed according to the standard ELISA protocol using a high-performance automated platform based on robotic systems Genetix Qpix2xt (from Molecular Device) and Tecan Freedom EVO 200 (from Tecan).
- Blocking buffer BB (200 ⁇ l 0.5% nonfat milk in PBS) was added to block non-specific binding. The plates were incubated on a shaker for one hour at room temperature. After washing with PBS-Tween, 50 ⁇ l per well of the test cell supernatant containing the test Fab mixed with an equal volume of BB was added. The plates were again incubated with shaking for one hour at room temperature, after which each well of the plates was washed three times with PBS-Tween buffer. After washing, anti-human Fab HRP-conjugated secondary antibody (from Pierce-ThermoScientific) was added (50 ⁇ l / well) at a ratio of 1: 5000 in PBS-Tween.
- the plates were shaken on a rotary shaker (50 min, room temperature) and washed three times with PBS-Tween buffer, as described above.
- the colorimetric signal was developed by adding TMB (50 ⁇ l / well) until saturation (3-5 min on average), then further development was stopped by adding a stop solution (30 ⁇ l / well, 10% sulfuric acid).
- the color signal was measured at 450 nm using a suitable Tesap-Sunrise plate reader (from Tesap). The degree of antibody binding was proportional to the production of a color signal. Clones in which the 5X color signal exceeded the background signal and was comparable to the signal of the control antibody Fab-gitr3215 were tested in ELISA for non-specific binding.
- ELISA also used the analysis of nonspecific binding of the studied Fab-fragments with other antigens. The study was carried out as described above, but IL6R-Fc, INF 2b, PCSK9-VG-FE, PD-1-Fc (2.5 ⁇ g / ml in 1 c carbonate buffer) were used as antigens for immobilization. GITR-TEV-Fc (0.2 ⁇ g / ml in 1 c carbonate buffer) was used as a control for specific binding. All subsequent steps were carried out according to a standard ELISA protocol using a high-performance automated platform based on robotic systems Genetix Qpix2xt (from Molecular Device) and Tesap Freedom EVO 200 (from Tesap).
- the cloning of the antibody variable domain genes from Example 7 was performed according to a standard procedure. For this, we have developed PCR products containing genes of variable domains of heavy and light chains of antibodies.
- the variable domain of the heavy chain was cloned into the vector pEE-Hc IgGl at the Sall / Nhel restriction sites, a schematic map of which is shown in FIG. 9).
- the variable domain of the light chain was ligated into the vector pEE-CK at the Sall / BsiWI restriction sites, a schematic map of which is shown in (Fig. 10).
- Antibodies were produced in cells of a permanent cell line derived from Chinese hamster ovary cells (CHO-K1 line) according to published protocols [Biotechnol Bioeng.
- CHO-K1-S cells were used for the production of antibodies in the transient expression system.
- the cells were cultured in bumpers (125, 250, 500, 1000 and 3000 ml) in a mixture of CHO-S-SEM II and Freestyle CHO media (1: 1) with 4 mM glutamine, 0.05 mg / ml gentamicin and 10 ⁇ g / ml with ciprofloxacin in orbital shakers-incubators at + 37C in the presence of 5% CO2, at 110 or 150 rpm, depending on the size of the flask.
- the cells were subcultured 3 times a week, the seeding density was 0.2 * 106 cells / ml.
- the cells were seeded the day before with a density of 0.8 * 106 cells / ml, transfection was carried out every other day, in a cell culture with a density of 2 * 106 cells / ml.
- To prepare the transfection mixture we used RPMI-1640 medium with 2 mM glutamine and 0.05 mg / ml gentamicin.
- the vectors were diluted separately in the medium at the rate of 0.75 ⁇ g / ml, separately - the transfection agent polyethyleneimine (PEI), at the rate of PEI: DNA 7: 1 by weight. Dilutions of vectors and PEI were mixed and incubated for 10 minutes at room temperature, after which the transfection mixture was added to the cells and the cells were cultured under standard conditions.
- PEI polyethyleneimine
- the main protein elution peak was collected and adjusted to pH neutral with 1 M Tris buffer (pH 8). All stages were carried out at a flow rate of 110 cm / h.
- the protein was transferred to PBS (pH 7.4) using dialysis, using the SnakeSkin Dialysis Tubing technology, filtered (0.22 ⁇ m), transferred to tubes and stored at - 70 ° C.
- the binding constants of anti-GITR antibodies to human, rhesus, and cynomolgus GITR were obtained using an OctetRed 96 device according to ForteBio instructions.
- Antigen 25 ⁇ g / ml was nonspecifically immobilized on the surface of second generation amino-reactive sensors (from AR2G) (ForteBio according to the standard protocol according to the manufacturer's instructions for preparation and immobilization of AR2G sensors).
- anti-GITR antibodies Antibodies were added at concentration. The assay was performed at 30 ° C using PBS containing 0.1% Tween-20 and 0.1% BSA as a working buffer.
- the test used the cell line HEK293-GITR-NFkB-Luc, created on the basis of the cell line Nek-293, stably expressing GITR on the surface and containing the gene encoding firefly luciferase under the control of the NFkB promoter.
- the test was performed in a 96-well culture plate.
- the suspension in each well contained HEK293-GITR-NFkB-Luc cells and the test antibody at the concentration indicated on the graph. All components of the suspension were prepared in a nutrient medium for cell culture. After the addition of all components, the plate was incubated at 37 ° C, 5% CO2, and then, using a kit for assessing luminescence and a plate reader, the intensity of luciferase in the wells was measured.
- ELISA was used to measure the comparative affinity of antibodies to GITR-Fc of different organisms.
- ELISA plate binding assay (medium binding from Greiner bio one) was coated with 50 ⁇ l of human, cynomolgus, mouse GITR-Fc (0.5 ⁇ g / ml in 1 c carbonate buffer), sealed and incubated overnight at 4 ° C. All subsequent steps were carried out according to the standard ELISA protocol described in example b.
- Anti-GITR antibody BCD166-01-01 specifically bound to human and monkey cynomolgus GITR and did not bind to murine GITR (FIG. 14).
- the BCD166-01-011 antibody specifically bound to human GITR, but did not bind to Cynomolgus monkey and mouse GITR (FIG. 15).
- the BCD166-01-014 antibody specifically binds to human GITR, binding to the cynomolgus monkey GITR was much weaker and completely absent for mouse GITR (Fig. 16).
- candidate BCD166-01-011 was excluded from further work due to the lack of apparent specificity for macaque GITR.
- the candidates BCD166-01-01 and BCD166-01-014 have been finalized for further development.
- the binding constants of anti-GITR antibodies to GITR from rhesus and cynomolgus monkeys were obtained using an OctetRed 96 device according to ForteBio instructions.
- Antigen 25 ⁇ g / ml was nonspecifically immobilized on the surface of second generation amino-reactive sensors (from AR2G) (ForteBio according to the standard protocol according to the manufacturer's instructions for preparation and immobilization of AR2G sensors).
- anti-GITR antibodies Antibodies were added at concentration. The assay was performed at 30 ° C using PBS containing 0.1% Tween-20 and 0.1% BSA as a working buffer.
- the E345R mutation was selected and introduced into the IgGl Fc region of the antibody. It has been shown that such a mutation can lead to oligomerization of the antibody on the cell surface after binding to the antigen, and enhancement of various effector abilities of ADCC, ADCP, CDC, and also pharmacokinetics (PK).
- BCD166-02-01 Two parental antibodies BCD166-01-01, BCD166-01-014 were also taken in the test.
- Fig. 17 indicate a 5-fold increase in the level of activation in the cell agonist test of the studied BCD166-02-01 in comparison with the precursor BCD166-01-01, in which the E345R mutation was introduced, which is caused by antigen-dependent anti-GITR oligomerization BCD166-02-01 antibodies on the target cell. Moreover, not only the level of the upper activation plateau increased naturally, but also the EC50 value changed more than 20 times in the direction of increase.
- ADCC antibody dependent cellular cytotoxicity
- the test examined the ADCC activity for candidates BCD166-02-01. Two antibodies BCD166-01-01, BCD166-01-014 were also taken in the test. In addition, similar to candidate BCD166-01-01, the mutation E345R was introduced into candidate BCD166-01-014 (which was named BCD166-02-014) to increase ADCC activity compared to the wild form.
- the test used the cell line Jurkat-NFAT-Luc-CDl 6, created on the basis of the Jurkat cell line, stably expressing CD16 on the surface and containing the gene encoding firefly luciferase under the control of the NFAT promoter; as well as the Hek-293-GITR cell line, created on the basis of the Nek-293 cell line, stably expressing GITR on the surface.
- the test was performed in a 96-well culture plate.
- Jurkat-NFAT-Luc-CDl 6 and Hek-293-GITR target cells as well as assay antibodies at the concentration shown in the graph. All components of the suspension were prepared in a nutrient medium for cell culture. After adding all the components, the plates were incubated at 37 ° C, 5% CO2, and then, using a kit for the assessment of Lucifer and a plate reader, the intensity of luminescence in the wells was measured.
- Fig. 18 indicate a 40-fold increase in the EC50 value in the cellular ADCC test of the studied BCD166-02-01 in comparison with the precursor BCD166-01-01, in which the E345R mutation was introduced, which is caused by antigen-dependent anti-GITR oligomerization BCD166-02-01 antibodies on the target cell.
- the cumulative data clearly indicate a significant positive effect of replacing the E345R in the Fc portion of IgGl antibodies on the various effector characteristics required to create a highly active GITR agonist.
- the test was performed in a 96-well culture plate.
- the suspension in each well contained HEK-293-GITR cells, as well as the analyzed antibodies at the indicated concentration and the complement of human blood serum.
- the plate with the described suspension was incubated for 4 h at 37 ° C, 5% COg.
- a solution of alamar blue was added to each well, and then incubated at 37 ° C, 5% CO2.
- the fluorescence value was measured in the wells (excitation wavelength 544 nm, emission wavelength 590 nm),
- Fig. 19 indicate an insignificant CDC activity, those not more than 10% up to a concentration of 1 ⁇ g / ml, which is the boundary for the estimated therapeutic dose expected for humans, for antibodies BCD166-01-01, BCD166-02-01 and the control antibody anti-GITR-3215.
- candidate BCD166-01-14 the activity at a concentration of 1 ⁇ g / ml CDC was about 30% lysis, which indicates a visible effect, but possibly weakly manifested in vivo.
- the cumulative data clearly indicate a negligible effect of substitution of E345R in the Fc portion of the IgGl of anti-GITR candidates.
- PBMCs were isolated from whole blood of healthy donors by Ficoll density gradient centrifugation in a 96-well culture plate.
- the suspension in each well contained PBMCs and the plotted antibody at 25, 1 and 0 ⁇ g / ml.
- the plate was incubated for 16 hours at 37 ° C, 5% CO2.
- the proportion of CD56 +, CD19 +, CD3 +, CD4 +, and CD8 + subpopulations of PBMCs in suspensions was assessed by direct staining of suspensions with fluorescently labeled antibodies against the corresponding CDs and subsequent analysis of cells on a flow cytometer.
- the graphs show the proportion of all cells of the analyzed suspension, for CD4 +, CD8 + - the proportion of CD3 + cells.
- results shown in FIG. 20-24 indicate an insignificant negative effect of the studied anti-GITR candidates, ie no more than 10% decrease in the number of immunoreactive cells in comparison with the negative control.
- the control antibody anti-CD20 also showed an increase in the percentage of NK cells, but almost a natural complete depletion of the population of CD20 + B cells.
- all the candidates under consideration do not exhibit nonspecific cytotoxicity in vitro on human blood cells.
- ADCC-dependent depletion of GITR + cells in the nTreg population is assumed to be one of the main putative mechanisms of the therapeutic anti-oncogenic action of anti-GITR antibodies.
- antibodies BCD166-01-01, BCD166-01-014, BCD166-02-01 and a control antibody anti-CTLA4 (ipilimumab) were tested.
- PBMCs Peripheral blood mononuclear cells
- NK cells were isolated from PBMCs using the NK Cell Isolation Kit, human (Miltenyi Biotec, Germany).
- Antibody solutions, NK cell suspension, and nTreg suspension were added to the culture plate.
- the plate was incubated at 37 ° C with 5% CO2 for 16 hours.
- Samples of cell suspensions were stained using fluorescently labeled antibodies against CBZ, CB4, CB25, FoxP3 (Biolegend, USA). Samples of stained cell suspensions were analyzed using flow cytometry.
- Fig. 25 results of the analysis of antibody-dependent nTreg depletion under the action of the studied antibodies are shown in Fig. 25 for the cell material of donor 1 and in FIG. 26 donor 2 indicate a significant 70-100% decrease in the cell population, i.e. depleting activity of the studied anti-GITR candidates, especially for donor material 2.
- a comparative analysis with the control anti-CTLA4 antibody ipilimumab demonstrates greater activity in favor of anti-GITR antibodies, especially for the final candidate BCB166-02-01.
- Antibodies BCD166-01-01, BCD166-01-014, BCD166-02-01 were tested in this test.
- PBMCs were isolated from whole blood of healthy donors by Ficoll density gradient centrifugation. Monocytes were isolated from PBMCs as a population of cells that bind to culture plastic. To obtain dendritic cells, monocytes were incubated in the presence of 1000 U / ml GM-CSF (Peprotech, USA) and 500 U / ml IL-4 (Thermo Scientific, USA) at 37 ° C 5% CO2 for 120 hours. LPS solution (Sigma, USA) was added to the culture medium to a concentration of 0.5 ⁇ g / ml, the cells were incubated at 37 ° C with 5% CO2 for 48 hours. Antibody dilution solutions, dendritic cell suspension and PBMC were added to the culture plate. The plate was incubated at 37 ° C with 5% CO2 for 120 hours.
- Samples of cell suspensions were stained using fluorescently labeled antibodies against CD3, CD4, CD25, FoxP3 (Biolegend, USA). Samples of stained cell suspensions were analyzed using flow cytometry. Anti-GITR antibodies BCD166-01-01, BCD166-01-14, and BCD166-02-01 cause iTreg depletion in vitro.
- PBMCs were isolated from whole blood of healthy donors by Ficoll density gradient centrifugation.
- AntiC 3 and aHTHGITR antibodies were immobilized in the wells of a 96-well plate. For this, 100 ⁇ l of a DPBS solution containing aHTHGITR antibody BCD166-02-01 in the concentration indicated on the graph and anti-SBZ antibody in a suboptimal concentration were added to the corresponding wells of the plate, the plate was incubated for 16 hours at room temperature.
- the test was carried out in a 96-well plate with anti-CBZ and anti-GITR antibodies pre-immobilized in the wells.
- the suspension in each well contained 40,000 PBMCs and anti-CB28 antibody at a suboptimal concentration. All suspension components were prepared in RPMI-1640 medium containing 10% FBS. After adding the cell suspension, the plate was incubated for 6 days at 37 ° C, 5% CO2. On the 4th day of incubation, aliquots of the culture liquid were taken from the wells. Next, the concentration of IL-2 and IFN-g in the culture fluid of the 4th and 6th days of incubation was determined using ELISA.
- the binding affinity constants of the antibody BCD166-02-01 for FcRn, FcgRIIIal58V, FcgRIIIal58F, FcgRIIal31H, FcgRIIal31R, FcgRIIb and human FcgRIa were obtained using an OctetRed 96 instrument (from ForteBio). Biotinylated receptors were immobilized on the surface of streptavidin sensors (SA). Conducted and analyzed the association and dissociation of receptors and antibodies in a working buffer (PBS containing 0.1% Tween-20 and 0.1% BSA: with the FcRn receptor with pH6, with the rest of the receptors in buffer with pH7.4.) At 30 ° C. The resulting sensograms were analyzed according to 1: 1 or 2: 1 models and the affinity constants were calculated using Octet Data Analysis Software 8.0 User Guide Copyright 2011 ⁇ .
- FIG. 29 The results of the affinity analysis of BCD166-02-01 for FcRn, FcgRIIIal58V, FcgRIIIal58F, FcgRIIal31H, FcgRIIal31R, FcgRIIb and human FcgRIa are shown in FIG. 29. They show values that are multiplied in comparison with the literature data and the data repeatedly measured in our company for antibodies of the IgGl isotype, which indicates a noticeable but not qualitative effect of the E345R mutation in the Fc fragment on the kinetics of monomeric antibodies adsorbed on these receptors from solution.
- mice were subcutaneously transplanted with 3x10 6 A2058 cells mixed with Matrigel®. On day 7 after cell inoculation, the animals were assigned to groups as shown in Table 9.
- the drugs were administered intraperitoneally at a dose of 20 mg / kg on days 1, 5, 8, 12 after the distribution of animals into groups.
- the negative control group received histidine buffer.
- the body weight of the mice and the linear dimensions of the tumor were measured.
- the formula V LxWxHxn / 6 was used.
- the indicator of tumor growth inhibition (TPO) was used as a criterion for the effectiveness of the study drug, which is calculated taking into account the average tumor volume in the negative control group (V c ) and the drug group (V t ) according to the formula:
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Enzymes And Modification Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020217038209A KR20220010501A (ko) | 2019-04-23 | 2020-04-23 | Gitr에 특이적으로 결합하는 단일클론 항체 |
| MX2021012962A MX2021012962A (es) | 2019-04-23 | 2020-04-23 | Anticuerpo monoclonal que se une especificamente a gitr. |
| AU2020261207A AU2020261207A1 (en) | 2019-04-23 | 2020-04-23 | Monoclonal antibody that specifically binds to GITR |
| PE2021001765A PE20220144A1 (es) | 2019-04-23 | 2020-04-23 | Anticuerpo monoclonal que se une especificamente a gitr |
| MA54969A MA54969B2 (fr) | 2019-04-23 | 2020-04-23 | Anticorps monoclonal se liant spécifiquement à gitr |
| EP20794288.9A EP3964525A4 (en) | 2019-04-23 | 2020-04-23 | MONOCLONAL ANTIBODY SPECIFIC TO GITR BINDING |
| US17/605,933 US12410257B2 (en) | 2019-04-23 | 2020-04-23 | Monoclonal antibody that binds specifically to GITR |
| EA202192907A EA202192907A1 (ru) | 2019-04-23 | 2020-04-23 | Моноклональное антитело, которое специфически связывается с gitr |
| MYPI2021006363A MY210018A (en) | 2019-04-23 | 2020-04-23 | Monoclonal antibody that binds specifically to gitr |
| BR112021021281A BR112021021281A2 (pt) | 2019-04-23 | 2020-04-23 | Anticorpo monoclonal que se liga especificamente ao gitr |
| JP2021563239A JP7695200B2 (ja) | 2019-04-23 | 2020-04-23 | Gitrに特異的に結合するモノクローナル抗体 |
| CA3137822A CA3137822A1 (en) | 2019-04-23 | 2020-04-23 | Monoclonal antibody that binds specifically to gitr |
| CONC2021/0014153A CO2021014153A2 (es) | 2019-04-23 | 2021-10-22 | Anticuerpo monoclonal que se une específicamente a gitr |
| IL287531A IL287531A (en) | 2019-04-23 | 2021-10-24 | Monoclonal antibody that binds specifically to gitr |
| JOP/2021/0286A JOP20210286A1 (ar) | 2019-04-23 | 2021-10-24 | جسم مضاد أحادي النسيلة يرتبط نوعياً مع gitr |
| ZA2021/09374A ZA202109374B (en) | 2019-04-23 | 2021-11-22 | Monoclonal antibody that binds specifically to gitr |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2019112296A RU2734432C1 (ru) | 2019-04-23 | 2019-04-23 | Моноклональное антитело, которое специфически связывается с GITR |
| RU2019112296 | 2019-04-23 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2020218951A2 true WO2020218951A2 (ru) | 2020-10-29 |
| WO2020218951A3 WO2020218951A3 (ru) | 2020-12-24 |
Family
ID=69821666
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/RU2020/050080 Ceased WO2020218951A2 (ru) | 2019-04-23 | 2020-04-23 | Моноклональное антитело, которое специфически связывается с gitr |
Country Status (24)
| Country | Link |
|---|---|
| US (1) | US12410257B2 (https=) |
| EP (1) | EP3964525A4 (https=) |
| JP (1) | JP7695200B2 (https=) |
| KR (1) | KR20220010501A (https=) |
| CN (1) | CN110903392B (https=) |
| AR (1) | AR118763A1 (https=) |
| AU (1) | AU2020261207A1 (https=) |
| BR (1) | BR112021021281A2 (https=) |
| CA (1) | CA3137822A1 (https=) |
| CL (1) | CL2021002792A1 (https=) |
| CO (1) | CO2021014153A2 (https=) |
| EA (1) | EA202192907A1 (https=) |
| IL (1) | IL287531A (https=) |
| JO (1) | JOP20210286A1 (https=) |
| MA (2) | MA54969B2 (https=) |
| MX (1) | MX2021012962A (https=) |
| MY (1) | MY210018A (https=) |
| PE (1) | PE20220144A1 (https=) |
| PY (1) | PY2018606A (https=) |
| RU (1) | RU2734432C1 (https=) |
| TW (1) | TWI803718B (https=) |
| UY (1) | UY38672A (https=) |
| WO (1) | WO2020218951A2 (https=) |
| ZA (1) | ZA202109374B (https=) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2724470C1 (ru) * | 2019-11-11 | 2020-06-23 | Автономная некоммерческая образовательная организация высшего образования Сколковский институт науки и технологий | Применение cas9 белка из бактерии pasteurella pneumotropica для модификации геномной днк в клетках |
| CN111732658B (zh) * | 2020-06-28 | 2022-04-26 | 英诺湖医药(杭州)有限公司 | 一组gitr单克隆抗体及其医药用途 |
| CN112540179B (zh) * | 2020-08-06 | 2023-07-07 | 武汉天德生物科技有限公司 | 一种测试ApoE4蛋白含量的ELISA试剂盒 |
| CN112362876B (zh) * | 2020-08-06 | 2023-12-15 | 武汉天德生物科技有限公司 | 一种检测早期老年痴呆症的胶体金试纸条及其制备方法 |
| CN111763257B (zh) * | 2020-09-01 | 2020-12-15 | 北京百奥赛图基因生物技术有限公司 | 抗gitr抗体及其用途 |
| CN114891111A (zh) * | 2020-12-31 | 2022-08-12 | 中元汇吉生物技术股份有限公司 | 特异性结合人IgG4的蛋白及其应用 |
Citations (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| EP0216846A1 (en) | 1985-04-01 | 1987-04-08 | Celltech Ltd | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same. |
| EP0256055A1 (en) | 1986-01-23 | 1988-02-24 | Celltech Ltd | RECOMBINANT DNA SEQUENCES, THESE VECTORS, AND METHODS OF USE THEREOF. |
| US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0323997A1 (en) | 1987-07-23 | 1989-07-19 | Celltech Limited | Recombinant dna expression vectors |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
| US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
| US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
| WO1997017852A1 (de) | 1995-11-15 | 1997-05-22 | Hoechst Schering Agrevo Gmbh | Synergistische herbizide mischungen |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6517529B1 (en) | 1999-11-24 | 2003-02-11 | Radius International Limited Partnership | Hemodialysis catheter |
| WO2005047327A2 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| WO2006104989A2 (en) | 2005-03-29 | 2006-10-05 | Verenium Corporation | Altered antibody fc regions and uses thereof |
| WO2007005612A2 (en) | 2005-07-01 | 2007-01-11 | Medimmune, Inc. | An integrated approach for generating multidomain protein therapeutics |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
| WO2015187835A2 (en) | 2014-06-06 | 2015-12-10 | Bristol-Myers Squibb Company | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
| WO2017068186A1 (en) | 2015-10-22 | 2017-04-27 | Ablynx Nv | Gitr agonists |
| WO2017096189A1 (en) | 2015-12-02 | 2017-06-08 | Agenus Inc. | Anti-gitr antibodies and methods of use thereof |
| WO2017214548A1 (en) | 2016-06-10 | 2017-12-14 | Regeneron Pharmaceuticals, Inc. | Anti-gitr antibodies and uses thereof |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
| JP4638876B2 (ja) * | 2003-05-23 | 2011-02-23 | ワイス | Gitrリガンド及びgitrリガンド関連分子及び抗体及びその使用 |
| EP2473531A4 (en) * | 2009-09-03 | 2013-05-01 | Merck Sharp & Dohme | Anti-gitr antibodies |
| SG10201912986PA (en) * | 2014-05-28 | 2020-02-27 | Agenus Inc | Anti-gitr antibodies and methods of use thereof |
| EP3244926B8 (en) * | 2015-01-14 | 2024-08-21 | The Brigham and Women's Hospital, Inc. | Treatment of cancer with anti-lap monoclonal antibodies |
| CN109641967A (zh) | 2016-07-01 | 2019-04-16 | 戊瑞治疗有限公司 | 用GITR激动剂和CpG的组合的抗肿瘤疗法 |
| CN109843916B (zh) | 2016-08-12 | 2023-10-31 | 詹森生物科技公司 | 具有增强的激动活性的Fc工程化抗TNFR超家族成员抗体及其使用方法 |
| CA3042727A1 (en) * | 2016-11-19 | 2018-05-24 | Potenza Therapeutics, Inc. | Anti-gitr antigen-binding proteins and methods of use thereof |
| JP7231549B2 (ja) | 2017-02-06 | 2023-03-01 | デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド | 抗体媒介性受容体シグナル伝達を増強するための組成物及び方法 |
| RU2019127550A (ru) * | 2017-03-03 | 2021-04-05 | Ринат Ньюросайенс Корп. | Анти-gitr антитела и способы их использования |
| TWI788340B (zh) * | 2017-04-07 | 2023-01-01 | 美商必治妥美雅史谷比公司 | 抗icos促效劑抗體及其用途 |
-
2019
- 2019-04-23 RU RU2019112296A patent/RU2734432C1/ru active
- 2019-12-03 CN CN201911222245.8A patent/CN110903392B/zh active Active
- 2019-12-03 TW TW108144110A patent/TWI803718B/zh active
-
2020
- 2020-04-22 UY UY0001038672A patent/UY38672A/es unknown
- 2020-04-23 MA MA54969A patent/MA54969B2/fr unknown
- 2020-04-23 JP JP2021563239A patent/JP7695200B2/ja active Active
- 2020-04-23 BR BR112021021281A patent/BR112021021281A2/pt unknown
- 2020-04-23 CA CA3137822A patent/CA3137822A1/en active Pending
- 2020-04-23 US US17/605,933 patent/US12410257B2/en active Active
- 2020-04-23 MX MX2021012962A patent/MX2021012962A/es unknown
- 2020-04-23 MY MYPI2021006363A patent/MY210018A/en unknown
- 2020-04-23 EP EP20794288.9A patent/EP3964525A4/en active Pending
- 2020-04-23 EA EA202192907A patent/EA202192907A1/ru unknown
- 2020-04-23 PE PE2021001765A patent/PE20220144A1/es unknown
- 2020-04-23 WO PCT/RU2020/050080 patent/WO2020218951A2/ru not_active Ceased
- 2020-04-23 AR ARP200101146A patent/AR118763A1/es unknown
- 2020-04-23 KR KR1020217038209A patent/KR20220010501A/ko active Pending
- 2020-04-23 AU AU2020261207A patent/AU2020261207A1/en active Pending
- 2020-05-06 PY PY202002018606A patent/PY2018606A/es unknown
- 2020-06-30 MA MA55390A patent/MA55390B1/fr unknown
-
2021
- 2021-10-22 CL CL2021002792A patent/CL2021002792A1/es unknown
- 2021-10-22 CO CONC2021/0014153A patent/CO2021014153A2/es unknown
- 2021-10-24 JO JOP/2021/0286A patent/JOP20210286A1/ar unknown
- 2021-10-24 IL IL287531A patent/IL287531A/en unknown
- 2021-11-22 ZA ZA2021/09374A patent/ZA202109374B/en unknown
Patent Citations (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| EP0216846A1 (en) | 1985-04-01 | 1987-04-08 | Celltech Ltd | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same. |
| US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
| EP0256055A1 (en) | 1986-01-23 | 1988-02-24 | Celltech Ltd | RECOMBINANT DNA SEQUENCES, THESE VECTORS, AND METHODS OF USE THEREOF. |
| US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| EP0323997A1 (en) | 1987-07-23 | 1989-07-19 | Celltech Limited | Recombinant dna expression vectors |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| WO1997017852A1 (de) | 1995-11-15 | 1997-05-22 | Hoechst Schering Agrevo Gmbh | Synergistische herbizide mischungen |
| US6517529B1 (en) | 1999-11-24 | 2003-02-11 | Radius International Limited Partnership | Hemodialysis catheter |
| WO2005047327A2 (en) | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| WO2006104989A2 (en) | 2005-03-29 | 2006-10-05 | Verenium Corporation | Altered antibody fc regions and uses thereof |
| WO2007005612A2 (en) | 2005-07-01 | 2007-01-11 | Medimmune, Inc. | An integrated approach for generating multidomain protein therapeutics |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
| WO2015187835A2 (en) | 2014-06-06 | 2015-12-10 | Bristol-Myers Squibb Company | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
| WO2017068186A1 (en) | 2015-10-22 | 2017-04-27 | Ablynx Nv | Gitr agonists |
| WO2017096189A1 (en) | 2015-12-02 | 2017-06-08 | Agenus Inc. | Anti-gitr antibodies and methods of use thereof |
| WO2017214548A1 (en) | 2016-06-10 | 2017-12-14 | Regeneron Pharmaceuticals, Inc. | Anti-gitr antibodies and uses thereof |
Non-Patent Citations (50)
| Title |
|---|
| "Genetics Computer Group", UNIVERSITY AVE., article "Sequence Analysis Software Package" |
| AGNEW, CHEM. INTL. ED. ENGL., vol. 33, 1994, pages 183 - 186 |
| AGOSTINI ET AL., INFECT. IMMUN., vol. 73, 2005, pages 7502 - 7508 |
| BALTZ ET AL., BLOOD, vol. 112, 2008, pages 3735 - 3743 |
| BIOTECHNOL BIOENG, vol. 84, no. 3, 5 November 2003 (2003-11-05), pages 332 - 342 |
| BIOTECHNOL BIOENG, vol. 91, no. 6, 20 September 2005 (2005-09-20), pages 670 - 677 |
| BIOTECHNOL BIOENG., vol. 91, no. 6, 20 September 2005 (2005-09-20), pages 670 - 677 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BURKS ET AL., PROC NATL ACAD SCI USA, vol. 94, 1997, pages 412 - 417 |
| CARTER ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 163 - 167 |
| CHATTOPADHYAY ET AL., PROC. NATL. ACAD. SCI., vol. 104, 2007, pages 19452 - 19457 |
| CHEN, Y. ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CLYNES ET AL., PNAS (USA, vol. 95, 1998, pages 652 - 656 |
| DAERON, ANNU. REV. IMMUNOL., vol. 15, 1997, pages 203 - 234 |
| EDELMAN, G.M. ET AL., PROC. NATL. ACAD. SCI. NATL. ACAD. SCI. USA, vol. 63, 1969, pages 78 - 85 |
| GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| HAARD HJVAN NEER NREURS AHUFTON SEROOVERS RCHENDERIKX P ET AL.: "A large non-immunized human Fab fragment phage library that permits rapid isolation and kinetic analysis of high affinity antibodies", J BIOL CHEM, vol. 274, 1999, pages 18218 - 18230, XP002128301, DOI: 10.1074/jbc.274.26.18218 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| J BIOL CHEM., vol. 274, no. 26, 25 June 1999 (1999-06-25), pages 18218 - 30 |
| J MOL BIOL, vol. 222, 1991, pages 581 - 597 |
| J MOL BIOL., vol. 222, no. 3, 5 December 1991 (1991-12-05), pages 581 - 97 |
| KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001 |
| LEFRANC ET AL., DEV. COMP IMMUNOL., vol. 27, 2003, pages 55 - 77 |
| LIAO METAL., BIOTECHNOL LETT, vol. 28, no. 11, 2004, pages 843 - 848 |
| MAHESH ET AL., EUR. J. IMMUNOL., vol. 36, 2006, pages 2128 - 2138 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553 |
| METHODS ENZYMOL., vol. 328, 2000, pages 333 - 63 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 |
| MUNSON ET AL., ANAL. BIOCHEM., vol. 107, 1980, pages 220 |
| NAT BIOTECHNOL., vol. 14, no. 3, March 1996 (1996-03-01), pages 309 - 14 |
| NOCENTINI ET AL., E. J. IMMUNOL., vol. 37, 2007, pages 11651169 |
| NOCENTINI ET AL., EUR. J. IMMUNOL., vol. 37, 2007, pages 1165 - 1169 |
| NOCENTINI ET AL., PROC. NATL. ACAD. SCI., vol. 94, 1997, pages 6216 - 6221 |
| NOCENTINIRICCARDI, E. J. IMMUNOL., vol. 35, 2005, pages 1016 - 1022 |
| RAVETCHKINET, ANNU. REV. IMMUNOL, vol. 9, 1991, pages 457 - 92 |
| SAMBROOK, J. ET AL.: "Molecular cloning: A laboratory manual;", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCHAER ET AL., CURR. OPIN. IMMUNOL., vol. 24, 2012, pages 217224 |
| SCIENCE, vol. 343, no. 6176, 14 March 2014 (2014-03-14), pages 1260 - 3 |
| SHEETS MDAMERSDORFER PFINNERN RSARGENT PLINDQUIST ESCHIER R ET AL.: "Efficient construction of a large nonimmune phage antibody library: the production of high-affinity human single-chain antibodies to protein antigens", PROC NATL ACAD SCI USA, vol. 95, 1998, pages 6037 6042 - 6162 |
| SMITH GP: "Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface", SCIENCE, vol. 228, 1985, pages 1315 - 1317, XP002464311, DOI: 10.1126/science.4001944 |
| STERN ET AL., CRITICAL REVIEWS IN ONCOLOGY/HAEMATOLOGY, vol. 54, 2005 |
| VAUGHAN TJWILLIAMS AJPRITCHARD KOSBOURN JKPOPE AREARNSHAW JC ET AL.: "Human antibodies with sub-nanomolar affinities isolated from a large non-immunized phage display library", NAT BIOTECHNOL, vol. 14, 1996, pages 309 - 314, XP000196144, DOI: 10.1038/nbt0396-309 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WATERHOUSE ET AL., NUCL. ACIDS. RES., vol. 21, 1993, pages 2265 - 2266 |
| WOOF J.BURTON D., NAT REV IMMUNOL, vol. 4, 2004, pages 89 - 99 |
| ZHOU ET AL., PROC. NATL. ACAD. SCI., vol. 105, 2008, pages 635 - 640 |
Also Published As
| Publication number | Publication date |
|---|---|
| CN110903392B (zh) | 2024-02-13 |
| MA55390A1 (fr) | 2022-05-31 |
| PE20220144A1 (es) | 2022-01-27 |
| JP7695200B2 (ja) | 2025-06-18 |
| CL2021002792A1 (es) | 2022-06-24 |
| TW202100554A (zh) | 2021-01-01 |
| MY210018A (en) | 2025-08-21 |
| US20220213209A1 (en) | 2022-07-07 |
| RU2734432C1 (ru) | 2020-10-16 |
| TWI803718B (zh) | 2023-06-01 |
| ZA202109374B (en) | 2022-12-21 |
| EP3964525A4 (en) | 2022-12-28 |
| AR118763A1 (es) | 2021-10-27 |
| MA55390B1 (fr) | 2022-10-31 |
| IL287531A (en) | 2021-12-01 |
| JOP20210286A1 (ar) | 2021-10-24 |
| MA54969A1 (fr) | 2022-08-31 |
| MX2021012962A (es) | 2021-12-15 |
| CA3137822A1 (en) | 2020-10-29 |
| JP2022532991A (ja) | 2022-07-21 |
| PY2018606A (es) | 2023-09-15 |
| UY38672A (es) | 2020-10-30 |
| AU2020261207A1 (en) | 2021-12-23 |
| BR112021021281A2 (pt) | 2022-03-08 |
| KR20220010501A (ko) | 2022-01-25 |
| WO2020218951A3 (ru) | 2020-12-24 |
| EP3964525A2 (en) | 2022-03-09 |
| CN110903392A (zh) | 2020-03-24 |
| MA54969B2 (fr) | 2025-10-31 |
| EA202192907A1 (ru) | 2022-01-25 |
| CO2021014153A2 (es) | 2021-10-29 |
| US12410257B2 (en) | 2025-09-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7676474B2 (ja) | Cd47およびpd-l1に特異的な抗体 | |
| RU2734432C1 (ru) | Моноклональное антитело, которое специфически связывается с GITR | |
| AU2018255132B2 (en) | Monoclonal antibody to PD-L1 | |
| IL282742B1 (en) | Monoclonal antibody that binds uniquely to CD20 | |
| RU2779652C2 (ru) | АНТИТЕЛА, СПЕЦИФИЧНЫЕ К CD47 и PD-L1 | |
| EA044786B1 (ru) | Моноклональное антитело, которое специфически связывается с gitr | |
| TW202003038A (zh) | 特異性結合人her2的細胞外結構域的亞結構域iv和ii的雙特異性抗體 | |
| EA044757B1 (ru) | Моноклональное антитело, которое специфически связывается с cd20 | |
| HK40061004B (zh) | 与cd20特异性结合的单克隆抗体 | |
| HK40061004A (en) | Monoclonal antibody that specifically binds to cd20 | |
| EA041915B1 (ru) | Моноклональное антитело к pd-l1 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| ENP | Entry into the national phase |
Ref document number: 3137822 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2021/0014153 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2021563239 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2021/0014153 Country of ref document: CO |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112021021281 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2021000726 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 2020794288 Country of ref document: EP Effective date: 20211123 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20794288 Country of ref document: EP Kind code of ref document: A2 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112021021281 Country of ref document: BR Free format text: COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 870210097928 DE 22/10/2021 NAO POSSUI TODOS OS CAMPOS OBRIGATORIOS INFORMADOS, NAO CONSTANDO OS CAMPOS 140 / 141 . ALEM DISSO, APRESENTE TRADUCAO DA FOLHA DE ROSTO DA PRIORIDADE. |
|
| ENP | Entry into the national phase |
Ref document number: 2020261207 Country of ref document: AU Date of ref document: 20200423 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01Y Ref document number: 112021021281 Country of ref document: BR Free format text: ANULADA A PUBLICACAO CODIGO 1.5 NA RPI NO 2658 DE 14/12/2021 PARA ADEQUACAO DO CONTEUDO EM NOVA EXIGENCIA. |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112021021281 Country of ref document: BR Free format text: COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 870210103475 DE 09/11/2021 POSSUI INFORMACOES DIVERGENTES DO PEDIDO EM QUESTAO NO CAMPO 110 , FORMATO DE DATA ERRADO NO CAMPO 151 E AUSENCIA DO CAMPO OBRIGATORIO 140 / 141 UMA VEZ QUE O DEPOSITANTE JA POSSUIA O NUMERO DO PEDIDO NO BRASIL NO MOMENTO DO PETICIONAMENTO DA MESMA. |
|
| ENP | Entry into the national phase |
Ref document number: 112021021281 Country of ref document: BR Kind code of ref document: A2 Effective date: 20211022 |
|
| WWG | Wipo information: grant in national office |
Ref document number: NC2021/0014153 Country of ref document: CO |
|
| WWG | Wipo information: grant in national office |
Ref document number: 17605933 Country of ref document: US |