WO2019079520A2 - ICOS VARIANT LIGAND IMMUNOMODULATORY IMMUNOMODULATORY PROTEINS, COMPOSITIONS AND METHODS THEREOF - Google Patents
ICOS VARIANT LIGAND IMMUNOMODULATORY IMMUNOMODULATORY PROTEINS, COMPOSITIONS AND METHODS THEREOF Download PDFInfo
- Publication number
- WO2019079520A2 WO2019079520A2 PCT/US2018/056381 US2018056381W WO2019079520A2 WO 2019079520 A2 WO2019079520 A2 WO 2019079520A2 US 2018056381 W US2018056381 W US 2018056381W WO 2019079520 A2 WO2019079520 A2 WO 2019079520A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- variant icosl
- variant
- seq
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70532—B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/48—Reproductive organs
- A61K35/54—Ovaries; Ova; Ovules; Embryos; Foetal cells; Germ cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
- A61K40/22—Immunosuppressive or immunotolerising
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/418—Antigens related to induction of tolerance to non-self
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4203—Receptors for growth factors
- A61K40/4205—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0681—Cells of the genital tract; Non-germinal cells from gonads
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/41—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/43—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag
Definitions
- the present disclosure relates to therapeutic compositions for modulating immune response in the treatment of cancer and immunological diseases.
- the present disclosure relates to particular variants of ICOS Ligand (ICOSL) that exhibit improved binding, such as improved affinity or selectivity for one or both of the cognate binding partner proteins ICOS or CD28.
- ICOSL ICOS Ligand
- IS immunological synapse
- APCs antigen-presenting cells
- target cells and lymphocytes are of increasing medical interest.
- cell surface proteins in the IS can involve the coordinated and often simultaneous interaction of multiple protein targets with a single protein to which they bind. IS interactions occur in close association with the junction of two cells, and a single protein in this structure can interact with both a protein on the same cell (cis) as well as a protein on the associated cell (trans), likely at the same time.
- immunomodulatory proteins including soluble proteins or transmembrane immunomodulatory proteins capable of being expressed on cells, that meet such needs.
- ICOSL ICOS Ligand
- IgSF immunoglobulin superfamily
- the variant ICOSL polypeptide exhibits altered binding to the ectodomain(s) of ICOS or CD28 compared to the binding of the ICOSL reference polypeptide for the same ectodomain(s). In some of any of the provided embodiments, the variant ICOSL polypeptide exhibits increased binding to the ectodomain(s) of ICOS or CD28 compared to the binding of the ICOSL reference polypeptide for the same ectodomain(s).
- the C-terminal truncation is of at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 125 amino acid residues.
- the ICOSL reference polypeptide is altered in or lacks a protease cleavage site set forth as amino acids 204-209 of SEQ ID NO:32.
- the ICOSL reference polypeptide contains the sequence of amino acids set forth in SEQ ID NO: 545.
- the ICOSL reference polypeptide consists of the sequence of amino acids set forth in SEQ ID NO: 545.
- ICOSL ICOSL Ligand
- IgSF immunoglobulin superfamily
- the variant ICOSL polypeptide exhibits altered binding to one or more of its binding partner(s) compared to the binding of the ICOSL reference polypeptide for the one or more binding partner(s). In some of any of the provided embodiments, the variant ICOSL polypeptide exhibits increased binding to one or more of its binding partner(s) compared to the binding of the ICOSL reference polypeptide for the one or more binding partner(s).
- the alteration includes a deletion of one or more contiguous amino acids corresponding to amino acids 204-209 with reference to SEQ ID NO: 32.
- the ICOSL reference polypeptide comprises the sequence of amino acids set forth in any of SEQ ID NOS: 600-605. In some of any of the provided embodiments, the ICOSL reference polypeptide consists of the sequence of amino acids set forth in any of SEQ ID NOS: 600-605.
- the alteration includes at least one amino acid substitution at one or both of position 207 and 208
- the at least one amino acid substitution is N207A, N207G or L208G, or a conservative amino acid substitution thereof.
- the reference ICOSL polypeptide contains the sequence of amino acids set forth in any of SEQ ID NOS: 623-628. In some of any of the provided embodiments, the reference ICOSL polypeptide consists of the sequence of amino acids set forth in any of SEQ ID NOS: 623-628.
- the variant ICOSL polypeptide exhibits reduced proteolytic cleavage when expressed from a cell.
- the cell is a mammalian cell.
- the cell is a Chinese Hamster Ovary (CHO) cell line or a derivative thereof.
- the amino acid modification is an amino acid substitution, insertion or deletion.
- the one or more amino acid modifications are in a position corresponding to position(s) selected from 10, 11, 13, 16, 18, 20, 25, 27, 30, 33, 37, 38, 42, 43, 47, 52, 54, 57, 61, 62, 67, 71, 72, 74, 75, 77, 78, 80, 84, 89, 90, 92, 93, 94, 96, 97, 98, 99, 100, 102, 103, 107, 109, 110, 111, 113, 115, 116, 117, 119, 120, 121, 122, 126, 129, 130, 132, 133, 135, 138, 139, 140, 142, 143, 144, 146, 148, 151, 152, 153, 154, 155, 156, 158, 161, 164, 166, 168,
- the one or more amino acid modifications are in a position corresponding to position(s) selected from 10, 11, 13, 16, 18, 20, 25, 26, 27, 30, 33, 37, 38, 42, 43, 47, 52, 54, 57, 61, 62, 67, 71, 72, 74, 75, 77, 78, 80, 84, 89, 90, 92, 93, 94, 96, 97, 98, 99, 100, 102, 103, 107, 109, 110, 111, 113, 115, 116, 117, 119, 120, 121, 122, 126, 129, 130, 132, 133, 135, 137, 138, 139, 140, 142, 143, 144, 146, 151, 152, 153, 154, 155, 156, 158, 161, 164, 166, 168, 172, 173, 175, 190, 192, 193, 194, 198, 201, 203,
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- modifications are selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20V, S25G, F27S, F27C, N30D, Y33del, Q37R, K42E, T43A, Y47H, N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54P, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57Y, N57W, R61S, R61C, Y62F, L67P, A71T, G72R, L74Q, R75Q, D77G, F78L, L80P, N84Q, E90A, K92R, F93L
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- modifications are selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20T, A20V, S25G, R26S, F27C, F27S, N30D, Y33del, Q37R, T38P, K42E, T43A, Y47H, N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M, N52P, N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54F, S54P, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, N57Y, R61C, R61S, Y62F, L67P, A71T, G72R, L74Q, R75Q, D77G, F78
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- the one or more amino acid modifications are selected from N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M, N52Q, N52R, N52S, N52T, N52V, N52Y, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57Y, N57W, Q100A, Q100D, Q100G, Q100K, Q100L, Q100M, Q100N, Q100P, Q100R, Q100S, Q100T or Q100V.
- the one or more amino acid modifications are selected from N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M, N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54P, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57Y, N57W, Q100A, Q100D, Q100G, Q100K, Q100L, Q100M, Q100N, Q100P, Q100R, Q100S, Q100T or Q100V.
- the one or more amino acid modifications are selected from among
- N52Y/N57Y/F138L/L203P N52H/N57Y/Q100P
- N52S/Y146C/Y152C N52H/C198R
- N52H/N57Y/Q100R N52H/N57Y/L74Q/Q100R/V110D
- N52H/Q100R N52H/S121G
- N52H/N57Y/R61C/Y62F/Q100R/V110N/F120S/C198R N52H/N57Y/Q100R/V110D/H115R/C198R
- N52H/N57Y/Q100R/V110D/N144D/F172S/C198R N52S/H94E/L98F/Q100R, N52S/E90A
- N52H/C140del/T225A N52H/F78L/Q100R/C198R, N52H/N57Y/R75Q/Q100P/V110D,
- N52H/N57Y/Q100R/V107I/V110D/I154F/C198R/R221G N52Q/N207Q, N52Q/N168Q, N52Q/N84Q, N52Q/N119Q, N52Q/N84Q/N168Q, N52Q/N84Q/N207Q, N52Q/N119Q/N155Q, N52H/N84Q/N119Q, N52H/N84Q, N52H/N84Q/N168Q/N207Q, N52Q/N84Q/N155Q/N168Q, N52Q/N84Q/N119Q/N168Q, N52Q/N84Q/N119Q/N207Q, N52Q/N84Q/N119Q/N155Q, N52Q/N84Q/N119Q/N155Q, N52Q/N84Q/N119Q/N155Q/N207Q, N52Y/F138L/L203P, N57Y/Q100
- N52H/N57Y/Q100R/F172S N52H/Q100R/H115R/I143T/F172S, N52H/N57Y/Q1 OOP/HI 15R/F172S, N52Y/N57Y/Q100P/F172S, E16V/N52H/N57Y/Q100R/V110D/H115R/C198R,
- N52S/H115R/F172S/C198R N52H/N57Y/Q100P/C198R, N52H/N57Y/Q100P H115R/F172S/C198R, N52H/N57Y/Q100P/F172S/C198R, N52H/N57Y/Q1 OOP/HI 15R, N52H/N57Y/Q100P/H115R/C198R, N52H/Q100R/C198R, N52H/Q100R/H115R/F172S, N52H/Q100R/F172S/C198R,
- N52A/N57H/Q100S N52A/N57Y/Q100A, N52D/N57A/Q100A, N52D/Q100S, N52G/Q100A,
- N52H/Q100A N52M/N57H/Q100S, N52M/N57W/Q100P, N52Q/N57F, N52Q/ N57S/Q100A,
- N52R/N57L/Q100A N52R/N57Y/Q100P
- N52R/N57Y/Q100S N52S/N57A/Q100A
- N52S/N57H/Q100E N52S/N57L/Q100S
- N52S/N57M/Q100S N52S/N57Y/Q100S
- N52S/N57Y/Q100M N52S/N57Y/Q100V, N52T/N57H/Q100S, N52T/N57H/Q100A,
- N52T/N57Y/Q100A N52V/N57L/Q100A, N52H/N57Y/Q100K, N52K/N57Y/Q100R,
- N52L/N57H/Q100R N52R/N57F/Q100N, N52R/N57F/Q100P, N52R/N57F/Q100R,
- N52R/N57F/Q100T N52R/N57H/Q100K, N52R/N57L/Q100S, N52R/N57W/Q100K, N52R/N57W, N52R/N57Y/Q100R, N52C/N57E/Q100S, N52G/N57P/Q100D, N52G/N57V/Q100G, N52G/N57V, N52L/N57V, N52P/N57P, N52P/N57S/Q100G, N52S/N57L/Q100G, N52T/N57K/Q100P,
- the one or more amino acid modifications are selected from among N52Y/N57Y/F138L/L203P, N52H/N57Y/Q100P, N52S/Y146C/Y152C,
- N52H/N57Y/R61C/Y62F/Q100R/V110N/F120S/C198R N52H/N57Y/Q100R V110D/H115R C198R, N52H/N57Y/Q100R/V110D/N144D/F172S/C198R, N52S/H94E/L98F/Q100R, N52S/E90A,
- N52H/C140del/T225A N52H/F78L/Q100R/C198R, N52H/N57Y/R75Q/Q100P/V110D,
- N52H/N57Y/Q100R/V110D/S132F/M175T N52H/N57Y/Q100R/V107I/V110D/I154F/C198R/R221G
- N52Q/N207Q N52Q/N168Q
- N52Q/N84Q N52Q/N119Q
- N52Q/N84Q/N168Q N52Q/N84Q/N207Q
- N52Q/N119Q/N155Q N52H/N84Q/N119Q, N52H/N84Q, N52H/N84Q/N168Q/N207Q,
- N52Q/N84Q/N119Q/N155Q N52Q/N84Q/N119Q/N155Q/N207Q, N52Y/F138L/L203P,
- N57Y/Q100R/C198R N57Y/F138L/L203P, Q100R/F138L, N52H/N57Y/Q100R/H115R/C198R, N52H/N57Y/Q100R/F172S/C198R, N52H/N57Y/Q100R/H115R/F172S/C198R,
- N52H/N57Y/Q100R/F172S N52H/Q100R/H115R/I143T/F172S, N52H/N57Y/Q1 OOP/HI 15R/F172S, N52Y/N57Y/Q100P/F172S, E16V/N52H/N57Y/Q100R/V110D/H115R/C198R,
- N52S/H115R/F172S/C198R N52H/N57Y/Q100P/C198R, N52H/N57Y/Q1 OOP/HI 15R/F172S/C198R, N52H/N57Y/Q100P/F172S/C198R, N52H/N57Y/Q1 OOP/HI 15R, N52H/N57Y/Q100P/H115R/C198R, N52H/Q100R/C198R, N52H/Q100R/H115R/F172S, N52H/Q100R/F172S/C198R,
- N52A/N57H/Q100S N52A/N57Y/Q100A, N52D/N57A/Q100A, N52D/Q100S, N52G/Q100A,
- N52H/Q100A N52M/N57H/Q100S, N52M/N57W/Q100P, N52Q/N57F, N52Q/N57S/Q100A,
- N52R/N57L/Q100A N52R/N57Y/Q100P, N52R/N57Y/Q100S, N52S/N57A/Q100A,
- N52S/N57H/Q100E N52S/N57L/Q100S, N52S/N57M/Q100S, N52S/N57Y/Q100S,
- N52S/N57Y/Q100M N52S/N57Y/Q100V, N52T/N57H/Q100S, N52T/N57H/Q100A,
- N52T/N57Y/Q100A N52V/N57L/Q100A, N52H/N57Y/Q100K, N52K/N57Y/Q100R,
- N52L/N57H/Q100R N52R/N57F/Q100N, N52R/N57F/Q100P, N52R/N57F/Q100R,
- N52R/N57F/Q100T N52R/N57H/Q100K, N52R/N57L/Q100S, N52R/N57W/Q100K, N52R/N57W, N52R/N57Y/Q100R, N52C/N57E/Q100S, N52G/N57P/Q100D, N52G/N57V/Q100G, N52G/N57V, N52L/N57V, N52P/N57P, N52P/N57S/Q100G, N52S/N57L/Q100G, N52T/N57K/Q100P, N52V/N57T/Q100L, N57Q/Q100P, or R26S/N52H/N57Y/V110D/T137A/C198R.
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO:567.
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- the variant ICOSL polypeptide contains the sequence set forth in SEQ ID NO:565.
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- the variant ICOSL polypeptide contains the sequence set forth in SEQ ID NO: 761.
- the one or more amino acid modifications is N52D.
- the variant ICOSL polypeptide contains the sequence set forth in SEQ ID NO: 548.
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- the variant ICOSL polypeptide contains the sequence set forth in SEQ ID NO: 570.
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- the one or more amino acid modifications are selected from C198R, D158G, E16V, E90A, F120S, F138L, F172S, H115R, H115X, I143T,
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- N52S/Y146C/Y152C N52H/C198R, N52H/C198R/T225A, N52H/K92R, N57Y, N52S/C198R,
- N52S/T113E S54A, N52D/S54P, N52K/L208P, N52H/I143T, N52S/R75Q/L203P, N52S/D158G, N52D/Q133H, N52H/N57Y/Q100R/V122A, N52H/N57Y/Q100R/F172S, N52H/N57Y/Q100R,
- N52S/N194D N52H/N57Y/Q100R/L102R/V110D/H115R/C198R, N52S/E90A,
- N52H/N57Y/Q100R H115R/F172S/C198R Q100R, N52Y/F138L/L203P, N57Y/Q100R/C198R , N57Y/F138L/L203P, N57Y/Q100P, Q100R/F138L, N52H/N57Y/Q100R H115R,
- N52S/E90A/H115R N30D/K42E/N52S/H115R C198R R221I, N30D/K42E/N52S/H115R/C198R, N30D/K42E/N52S/H115R F172S/N194D, N30D/K42E/N52S/H115R, N52S/E90A/H115R,
- N30D/K42E/N52S/H115R N52A/N57H/Q100S, N52A/N57Y/Q100A, N52D/Q100S, N52G/Q100A, N52M/N57H/Q100S, N52M/N57W/Q100P, N52Q/N57S/Q100A, N52R/N57L/Q100A, N52S/N57H/Q100E, N52S/N57L/Q100S, N52S/N57M/Q100S, N52S/N57Y/Q100M,
- N52T/N57H/Q100S N52R/N57F/Q100P, N52R/N57F/Q100T, N52R/N57W/Q100K, N52R/N57W, N52G/N57P/Q100D, N52G/N57V/Q100G, N52G/N57V, N52L/N57V, N52S/N57L/Q100G or
- N52T/N57K/Q100P N52S, N52H, N52D, N52Y/N57Y/F138L/L203P, N52H/N57Y/Q100P,
- N52Y/N57Y/Y152C N52Y/N57Y/H129P/C198R, N52H/L161P/C198R, N52S/T113E, S54A,
- N52D/S54P N52K/L208P, N52S/Y152H, N52H/I143T, N52S/L80P, N52S/D158G, N52D/Q133H, L70Q/A91G/N144D, L70Q/A91G/E117G/I118V/T120S/T130A,
- N52H/N57Y/Q100R/F172S N52H/N57Y/Q100R, N52S/F120S/N227K, N52S/N194D, N52S/F120S, N52S/G72R, N52S/A71T/A117T/T190A/C198R,
- N52H/Q100R H115R F172S N52H/Q100R H115X/F172S/C198R
- N52H/Q100R/H115R F172S/C198R N52H/N57Y/Q100R F172S/C198R
- N52H/N57Y/Q100R/H115R F172S/C198R N52H/N57Y/Q100R/H115R F172S/C198R
- N52H/N57Y/Q100R/H115R N52H/N57Y/Q100R/F172S, N52H/N57Y/Q100R/H115R/F172S/I224V, N52H/N57Y/Q100R/H115R/F172S, N52H/N57Y/Q100R/H115R/C198R,
- N52H/N57Y/Q100R/H115R/I143V/F172S/C198R N52H/N57Y/Q100R/L102R HI 15R/F172S/C198R, N52H/N57Y/Q100R/H115R F172S/N194D, N52H/N57Y/H115R/F172S/C198R,
- N52S/H115R/F172S/C198R N119Q, N207Q, N52Q/N207X, N168X/N207X, N52Q/N168Q,
- N84Q/N207Q N119Q N155X, N52Q/N119Q, N52Q/N84Q/N207Q, N119Q/N155Q/N168Q,
- N52H/N84Q/N119Q N52Q/N84Q/N155X/N168X, N52A/N57F/Q100S, N52A/N57H/Q100S,
- N52A/N57Y/Q100A N52D/N57A/Q100A, N52D/Q100S, N52G/Q100A, N52H/Q100A,
- N52M/N57H/Q100S N52M/N57W/Q100P, N52Q/N57F, N52Q/N57S/Q100A, N52R/N57L/Q100A, N52R/N57Y/Q100P, N52R/N57Y/Q100S, N52S/N57A/Q100A, N52S/N57H/Q100E,
- N52S/N57Y/Q100V N52T/N57H/Q100S, N52T/N57H/Q100A, N52T/N57Y/Q100A,
- N52V/N57L/Q100A N52H/N57Y/Q100K, N52K/N57Y/Q100R, N52L/N57H/Q100R,
- N52R/N57F/Q100N N52R/N57F/Q100P
- N52R/N57F/Q100R N52R/N57F/Q100T
- N52R/N57L/Q100S N52R/N57W/Q100K
- N52R/N57W N52G/N57V
- N52L/N57V N52S/N57L/Q100G
- the variant ICOSL polypeptide exhibits increased binding to the ectodomain of ICOS or CD28 compared to the binding of the reference ICOSL polypeptide to the same ectodomain.
- the one or more amino acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-amino
- modifications are selected from C198R, D158G, E16V, E90A, F120S, F138L, F172S, H115R, I143V, I224V, K156M, K42E, K92R, L102R, L203P, L208P, N194D, N30D, N52A, N52D, N52G, N52H, N52K, N52L, N52M, N52Q, N52R, N52S, N52T, N52Y, N57F, N57H, N57L, N57M, N57S, N57V, N57W, N57Y, Q100A, Q100E, Q100G, Q100K, Q100M, Q100P, Q100R, Q100S, Q133H, S212G, S54A, S54P, T113E, V110D, V122A, Y146C, Y152C, or T225A.
- the one or more amino acid modifications are selected from among N52A/N57Y/Q100A, N52D/Q100S, N52G/Q100A, N52M/N57H/Q100S, N52M/N57W/Q100P, N52Q/N57S/Q100A, N52R/N57L/Q100A, N52S/N57H/Q100E, N52S/N57L/Q100S,
- N52S/N57M/Q100S N52S/N57Y/Q100M, N52T/N57H/Q100S, N52R/N57F/Q100P, N52R/N57F/Q100T, N52R/N57W/Q100K, N52R/N57W, N52G/N57V, N52L/N57V,
- N52S/N57L/Q100G N52T/N57K/Q100P
- N52S N52H, N52D, N52Y/N57Y/F138L/L203P,
- N52H/N57Y/Q100P N52S/Y146C/Y152C, N52H/C198R, N52H/C198R/T225A, N52H/K92R, N57Y, N52S/C198R, N52S/T113E, S54A, N52D/S54P, N52K/L208P, N52H/I143T, N52S/D158G,
- N52D/Q133H N52H/N57Y/Q100R/V110D/C198R/S212G, N52H/N57Y/Q100R/V122A,
- N52Y/N57Y/Q100P/F172S E16V/N52H/N57Y/Q100R/V110D/H115R/Y152C/K156M/F172S/C198R, N52S/H115R/F120S/I143V/C198R, N52H/N57Y/Q100P/C198R,
- N52H/Q100R/H115R/F172S N52H/Q100R/H115X/F172S/C198R, N52H/Q100R/H115R/F172S/C198R, N52H/N57Y/Q100R/H115R/F172S/C198R, N52H/N57Y/Q100R/H115R/F172S,
- N52H/N57Y/Q100R/H115R/F172S/C198R Q100R, N52Y/F138L/L203P, N57Y/Q100R/C198R, N57Y/F138L/L203P, N52H, N57Y, N57Y/Q100P, Q100R/F138L, N52H/N57Y/Q100R/H115R, N52H/N57Y/Q100R/F172S, N52H/N57Y/Q100R/H115R/F172S/I224V,
- N52H/N57Y/Q100R/H115R/I143V/F172S/C198R N52H/N57Y/Q100R/L102R HI 15R/F172S/C198R, N52H/N57Y/Q100R/H115R F172S/N194D, N52H/N57Y/H115R/F172S/C198R,
- the variant ICOSL polypeptide exhibits increased binding to the ectodomain of ICOS and CD28 compared to the binding of the reference ICOSL polypeptide to the same ectodomains.
- the variant ICOSL polypeptide contains the sequence of amino acids set forth in any one of SEQ ID NOS: 546-599, 734-781, 783, 786, 788, 792, 796, 798, 800, 802, 804, 806, 808, 811, 813, 815, 817, 818, 820, 822, 824, 826, 827, 829, 831, 833, 834, 836, 838, 840-843, 845, 847, 848, 850-853, 855, 857, 907, 910, or a sequence of amino acids that exhibits at least 90%, 91%%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOS: 546-599, 734-781, 783, 786, 788, 792, 796, 798, 800, 802, 804, 806, 808, 811, 813,
- the variant ICOSL polypeptide consists of the sequence of amino acids set forth in any one of SEQ ID NOS: 546-599, 734-781, 783, 786, 788, 792, 796, 798, 800, 802, 804, 806, 808, 811, 813, 815, 817, 818, 820, 822, 824, 826, 827, 829, 831, 833, 834, 836, 838, 840-843, 845, 847, 848, 850-853, 855, 857, 907, 910, or a sequence of amino acids that exhibits at least 90%, 91%%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOS: 546-599, 734-781, 783, 786, 788, 792, 796, 798, 800, 802, 804, 806, 808, 811, 813, 815
- the variant ICOSL polypeptide contains one or more amino acid modifications in an ICOSL reference polypeptide or a specific binding fragment thereof corresponding to amino acid modifications are selected from N52A, N52C, N52D, N52G, N52K, N52L, N52M, N52R, N52T, N52V, N57A, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, Q100A, Q100D, Q100G, Q100L, Q100M, Q100N, Q100R, Q100S, Q100T or Q100V with reference to SEQ ID NO:32.
- the one or more amino acid modifications are selected from among N52A/N57F/Q100S, N52A,/N57H/Q100S, N52A/N57Y/Q100A, N52D/N57A/Q100A,
- N52D/Q100S N52G/Q100A, N52H/Q100A, N52M/ N57H/Q100S, N52M/N57W/Q100P, N52Q/N57F, N52Q/N57S/Q100A, N52R/N57L/Q100A, N52R/N57Y/Q100P,
- N52R/N57Y/Q100S N52S/N57A/Q100A, N52S/N57H/Q100E, N52S/N57L/Q100S,
- N52S/N57M/Q100S N52S/N57Y/Q100S, N52S/N57Y/Q100M, N52S/N57Y/Q100V,
- N52T/N57H/Q100S N52T/N57H/Q100A, N52T/N57Y/Q100A, N52V/N57L/Q100A,
- N52R/N57F/Q100P N52R/N57F/Q100R, N52R/N57F/Q100T, N52R/N57H/Q100K,
- N52R/N57L/Q100S N52R/N57W/Q100K, N52R/N57W, N52R/N57Y/Q100R,
- N52C/N57E/Q100S N52G/N57P/Q100D, N52G/N57V/Q100G, N52G/N57V, N52L/N57V, N52P/N57P, N52P/N57S/Q100G, N52S/N57L/Q100G, N52T/N57K/Q100P,
- the ICOSL reference polypeptide is a mammalian ICOSL or a specific binding fragment thereof. In some examples, the ICOSL reference polypeptide is a human ICOSL or a specific binding fragment thereof.
- the ICOSL reference polypeptide contains (i) the sequence of amino acids set forth in SEQ ID NO:32, (ii) a sequence of amino acids that has at least 95% sequence identity to SEQ ID NO:32; or (iii) a portion of (i) or (ii) comprising an IgV domain or IgC domain or specific binding fragments thereof or both.
- the specific binding fragment of the IgV domain or IgC domain has a length of at least 50, 60, 70, 80, 90, 100, 110 or more amino acids; or the specific binding fragment of the IgV domain contains a length that is at least 80% of the length of the IgV domain set for as amino acids 19-129 of SEQ ID NO:5 and/or the specific binding fragment of the IgC domain comprises a length that is at least 80% of the length of the IgC domain set forth as amino acids 141-227 of SEQ ID NO:5.
- the variant ICOSL polypeptide comprises the IgV domain or a specific fragment thereof and the IgC domain or a specific fragment thereof.
- the variant ICOSL polypeptide contains the sequence of amino acids set forth in any one of SEQ ID NOS: 638-685, or a sequence of amino acids that exhibits at least 90%, 91%%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOS: 638-685.
- the variant ICOSL polypeptide consists of the sequence of amino acids set forth in any one of SEQ ID NOS: 638-685, or a sequence of amino acids that exhibits at least 90%, 91%%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOS: 638-685.
- the variant ICOSL polypeptide contains the IgV domain or a specific binding fragment thereof. In some of any of the provided embodiments, the variant ICOSL polypeptide contains the sequence of amino acids set forth in any one of SEQ ID NOS: 686-781, or a sequence of amino acids that exhibits at least 90%, 91%%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOS: 686-781.
- the variant ICOSL polypeptide consists of the sequence of amino acids set forth in any one of SEQ ID NOS: 686-781, or a sequence of amino acids that exhibits at least 90%, 91%%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any one of SEQ ID NOS: 686-781.
- the IgV domain or specific binding fragment thereof is the only ICOSL portion of the variant ICOSL polypeptide.
- the IgC domain or specific binding fragment thereof is the only ICOSL portion of the variant ICOSL polypeptide.
- the variant ICOSL polypeptide exhibits altered binding to the ectodomain of ICOS or CD28 compared to the binding of the ICOSL reference polypeptide for the same ectodomain. In some aspects, the variant ICOSL polypeptide exhibits increased binding to the ectodomain(s) of ICOS or CD28 compared to the binding of the ICOSL reference polypeptide for the same ectodomain(s). In some examples, the binding is increased more than 1.2-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold or 60-fold.
- the ICOS is a human ICOS.
- the CD28 is a human CD28.
- the variant ICOSL polypeptide exhibits decreased binding to the ectodomain of CTLA-4 compared to the binding of the reference ICOSL polypeptide for the same ectodomain.
- the binding is decreased more than 1.2- fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30- fold, 40-fold, 50-fold or 60-fold.
- the CTLA-4 is a human CTLA-4.
- the altered (increased or decreased) binding is altered (increased or decreased) binding affinity.
- the variant ICOSL polypeptide comprises up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acid modifications, optionally amino acid substitutions, insertions and/or deletions. In some cases, the variant ICOSL polypeptide exhibits at least or at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,98% or 99% sequence identity to the ICOSL reference polypeptide.
- the variant ICOSL polypeptide is a soluble protein. In some of any of the provided embodiments, the variant ICOSL polypeptide lacks a transmembrane domain and intracellular signaling domain; and/or when expressed from a cell, the variant ICOSL polypeptide is not expressed on the surface of the cell.
- the variant ICOSL polypeptide further contains transmembrane domain.
- the transmembrane domain contains the sequence of amino acids set forth as residues 257-277 of SEQ ID NO:5 or a functional variant thereof that exhibits at least 85% sequence identity to residues 257-277 of SEQ ID NO:5.
- the variant ICOSL polypeptide further contains a cytoplasmic signaling domain linked to the transmembrane domain.
- the cytoplasmic signaling domain contains the sequence of amino acids set forth as residues 278-302 of SEQ ID NO:5 or a functional variant thereof that exhibits at least 85% sequence identity to residues 278-302 of SEQ ID NO:5.
- the variant ICOSL polypeptide is deglycosylated or partially deglycosylated compared to the ICOSL reference sequence.
- an immunomodulatory protein containing any of the provided variant ICOSL polypeptide and a half-life extending moiety.
- the half-life extending moiety comprises a multimerization domain, albumin, an albumin-binding polypeptide, Pro/Ala/Ser (PAS), a C-terminal peptide (CTP) of the beta subunit of human chorionic gonadotropin, polyethylene glycol (PEG), long unstructured hydrophilic sequences of amino acids (XTEN), hydroxyethyl starch (HES), an albumin-binding small molecule, or a combination thereof.
- the half-life extending moiety is or comprises Pro/Ala/Ser (PAS) and the variant ICOSL polypeptide is PASylated.
- the half-life extending moiety contains the sequence set forth in SEQ ID NO:904.
- the half-life extending moiety is or contains a multimerization domain.
- the multimerization domain is selected from an Fc region of an immunoglobulin, a leucine zipper, an isoleucine zipper or a zinc finger.
- the variant ICOSL polypeptide is linked, directly or indirectly via a linker, to the multimerization domain.
- the immunomodulatory protein is a multimer containing a first variant ICOSL polypeptide linked to a first multimerization domain and a second variant ICOSL polypeptide linked to a second multimerization domain, wherein the first and second multimerization domains interact to form a multimer comprising the first and second variant ICOSL polypeptide.
- the multimer is a dimer.
- the first variant ICOSL polypetide and the second variant ICOSL polypeptide are the same. In some of any of the provided embodiments, the first variant ICOSL polypetide and the second variant ICOSL polypeptide are the same. In some of any of the provided embodiments, the first variant ICOSL polypetide and the second variant ICOSL polypeptide are the same. In some of any of the provided embodiments, the first variant ICOSL polypetide and the second variant ICOSL polypeptide are the same.
- the dimer is a homodimer. In some instances, the dimer is a heterodimer.
- the multimerization domain is or contains an Fc region of an immunoglobulin. In some of any of the provided embodiments, the Fc region is of an immunoglobulin Gl (IgGl) or an immunoglobulin G2 (IgG2) protein. In some examples, the immunoglobulin protein is human and/or the Fc region is human.
- the Fc region contains the sequence of amino acids set forth in SEQ ID NO: 227 or a variant thereof that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:227. In some aspects, the Fc region contains the sequence of amino acids set forth in SEQ ID NO: 226 or a variant thereof that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to SEQ ID NO:226. In some of any of the provided embodiments, the Fc region exhibits one or more effector functions. In some of any of the provided embodiments, the Fc region exhibits one or more reduced effector function compared to a wildtype Fc region, optionally wherein the wildtype human Fc is of human IgGl.
- the one or more effector function is selected from among antibody dependent cellular cytotoxicity (ADCC), complement dependent cytotoxicity, programmed cell death and cellular phagocytosis.
- ADCC antibody dependent cellular cytotoxicity
- the Fc region is a variant Fc region comprising one or more amino acid substitutions compared to the wildtype Fc region.
- the one or more amino acid substitutions of the variant Fc region are selected from N297G, E233P/L234V/L235A/G236del/S267K or L234A/L235E/G237A, wherein the residue is numbered according to the EU index of Kabat.
- the variant Fc region further contains the amino acid substitution C220S, wherein the residues are numbered according to the EU index of Kabat.
- the Fc region contains the sequence of amino acid sequence set forth in any of SEQ ID NOS: 476-478 or a sequence of amino acids that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to any of SEQ ID NOS:476-478 and contains the amino acid substitutions.
- the Fc region contains K447del, wherein the residue is numbered according to the EU index of Kabat.
- the Fc region contains the sequence of amino acid sequence set forth in any of SEQ ID NOS: 632-634 or a sequence of amino acids that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to any of SEQ ID NOS: 632-634 and contains the amino acid substitutions.
- the Fc region contains the sequence of amino acid sequence set forth in SEQ ID NOS: 474 or 637, or a sequence of amino acids that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NOS: 474 or 637 and contains the amino acid substitutions.
- the Fc region contains the sequence of amino acids set forth in SEQ ID NO: 478 or SEQ ID NO: 634. In some of any of the provided embodiments, the Fc region contains the sequence of amino acids set forth in SEQ ID NO: 477. In some of any of the provided embodiments, the Fc region contains the sequence of amino acids set forth in SEQ ID NO: 633. In some of any of the provided embodiments, the Fc region contains the sequence of amino acids set forth in SEQ ID NO: 474. In some of any of the provided embodiments, the Fc region contains the sequence of amino acids set forth in SEQ ID NO:637.
- an immunomodulatory protein containing (a) a variant ICOSL polypeptide containing one or more amino acid modifications in an immunoglobulin superfamily (IgSF) domain of an ICOSL reference polypeptide, wherein the variant ICOSL polypeptide exhibits altered binding to the ectodomain(s) of ICOS or CD28 compared to the binding of the ICOSL reference polypeptide for the same ectodomain(s); and (b) a variant Fc region containing amino acid substitutions selected from N297G/K447del,
- the immunomodulatory protein is a dimer.
- the variant Fc region further contains the amino acid substitution C220S, wherein the residues are numbered according to the EU index of Kabat.
- the Fc region contains the sequence of amino acid sequence set forth in any of SEQ ID NOS: 632-634 or a sequence of amino acids that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to any of SEQ ID NOS:632-634 and contains the amino acid substitutions.
- the Fc region contains the sequence of amino acid sequence set forth in SEQ ID NOS: 474 or 637, or a sequence of amino acids that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NOS: 474 or 637 and contains the amino acid substitutions.
- the variant ICOSL polypeptide is linked, directly or indirectly via a linker, to the variant Fc region.
- the linker contains 1 to 10 amino acids.
- the linker is selected from AAA, G4S (SEQ ID NO: 636), (G 4 S) 2 (SEQ ID NO: 229) or GSGGGGS linker (SEQ ID NO: 635).
- the linker is (G 4 S) 3 (SEQ ID NO: 228).
- the linker is AAA. In some of any of the provided embodiments, the linker is G4S (SEQ ID NO:636). In some of any of the provided embodiments, the linker is (G 4 S) 2 (SEQ ID NO:229). In some of any of the provided
- the linker is GSGGGGS linker (SEQ ID NO: 635).
- the variant ICOSL polypeptide is or comprise an IgV domain.
- the variant ICOSL polypeptide contains amino acid modifications N52H/Q100R.
- the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO: 567.
- the variant ICOSL polypeptide comprises amino acid modifications
- the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO: 565. In some of any of the provided embodiments, the variant ICOSL polypeptide comprises amino acid modifications are
- the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO: 761. In some of any of the provided embodiments, the variant ICOSL polypeptide comprises amino acid modifications
- the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO: 570. In some of any of the provided embodiments, the variant ICOSL polypeptide comprises the amino acid modification is N52D. In some of any of the provided embodiments, the polypeptide has the sequence set forth in SEQ ID NO: 548.
- a variant ICOSL-Fc fusion protein that has the sequence of amino acids set forth in SEQ ID NO: 928.
- a variant ICOSL-Fc fusion protein that has a sequence of amino acids that has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the sequence set forth in SEQ ID NO: 928.
- the provided immunomodulatory proteins such as fusion proteins, e.g. variant ICOSL-Fc fusion proteins, binds CD28 and ICOS.
- the variant ICOSL-Fc fusion protein exhibits increased binding affinity to CD28 and/or ICOS compared to a human wild-type ICOSL-Fc fusion protein, e.g. containing an ICOSL IgV portion set forth in SEQ ID NO:545 linked via a linker, e.g. set forth in SEQ ID NO:229, to an Fc region.
- the Fc region is an inert or effectorless Fc containing the mutations L234A, L235E and L235E in a human IgGl Fc, e.g. set forth in SEQ ID NO:637,
- an immunomodulatory protein containing any of the variant ICOSL polypeptides linked to a second polypeptide comprising an immunoglobulin superfamily (IgSF) domain.
- IgSF domain is affinity modified and exhibits altered binding to one or more of its cognate binding partner(s) compared to the unmodified or wild-type IgSF domain.
- the IgSF domain exhibits increased binding to one or more of its cognate binding partner(s) compared to the unmodified or wild-type IgSF domain.
- the variant ICOSL polypeptide is a first ICOSL variant polypeptide and the IgSF domain of the second polypeptide is an IgSF domain from a second variant ICOSL polypeptide provided herein, wherein the first and second ICOSL variant are the same or different.
- the variant ICOSL polypeptide is capable of specifically binding to CD28 or ICOS and the IgSF domain of the second polypeptide is capable of binding to a binding partner other than one specifically bound by the ICOSL variant polypeptide.
- the IgSF domain is from a member of the B7 family.
- the IgSF domain is a tumor-localizing moiety that binds to a ligand expressed on a tumor or is an inflammatory-localizing moiety that binds to a ligand expressed on a cell or tissue of an inflammatory environment.
- the ligand is B7H6.
- the IgSF domain is from NKp30.
- the IgSF domain of the second polypeptide is or comprises an IgV domain. In some of any of the provided embodiments, the IgSF domain of the second polypeptide is a variant NKp30 molecule containing
- the IgSF domain of the second polypeptide has the sequence set forth in SEQ ID NO: 504.
- the IgSF domain is or comprises an IgV domain.
- the variant ICOSL polypeptide is or contains an IgV domain.
- the variant ICOSL polypeptide is or comprise an IgV domain.
- the variant ICOSL polypeptide contains amino acid modifications N52H/Q100R.
- the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO: 567.
- the variant ICOSL polypeptide comprises amino acid modifications N52H/N57Y/Q100R.
- the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO: 565. In some of any of the provided embodiments, the variant ICOSL polypeptide comprises amino acid modifications are N52L/N57H/Q100R. In some of any of the provided embodiments, the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO: 761. In some of any of the provided embodiments, the variant ICOSL polypeptide comprises amino acid modifications
- the variant ICOSL polypeptide has the sequence set forth in SEQ ID NO: 570. In some of any of the provided embodiments, the variant ICOSL polypeptide comprises the amino acid modification is N52D. In some of any of the provided embodiments, the polypeptide has the sequence set forth in SEQ ID NO:548.
- the immunomodulatory protein comprises a multimerization domain linked to one or both of the variant ICOSL polypeptide or the second polypeptide comprising the IgSF domain.
- the multimerization domain is an Fc domain or a variant thereof with reduced effector function.
- the immunomodulatory protein is dimeric. In some cases, the immunomodulatory protein is homodimeric. In some aspects, the immunomodulatory protein is heterodimeric.
- a conjugate containing any of the provided variant ICOSL polypeptides or any of the provided immunomodulatory protein and a heterologous moiety is linked, directly or indirectly via a linker, to the heterologous moiety.
- the targeting moiety is a protein, a peptide, nucleic acid, small molecule or nanoparticle.
- the target moiety is a protein or a peptide.
- the conjugate is a fusion protein.
- a fusion protein containing any of the provided variant ICOSL is provided.
- the moiety is a targeting moiety that specifically binds to a molecule on the surface of a cell. In some examples, the targeting moiety specifically binds to a molecule on the surface of an immune cell. In some of any of the provided embodiments, the immune cell is an antigen presenting cell or a lymphocyte. In some cases, the targeting moiety is a tumor-localizing moiety that binds to a molecule on the surface of a tumor.
- the targeting moiety binds to a molecule HER1/EGFR, HER2/ERBB2, CD20, CD25 (IL-2Ra receptor), CD33, CD52, CD133, CD206, CEA, CEACAM1, CEACAM3, CEACAM5, CEACAM6, cancer antigen 125 (CA125), alpha- fetoprotein (AFP), Lewis Y, TAG72, Caprin-1, mesothelin, PDGF receptor (PDGFR; such as PDGF-R a), PD-1, PD-L1, CTLA-4, IL-2 receptor, vascular endothelial growth factor (VEGF), CD30, EpCAM, EphA2, Glypican-3, gpA33, mucins, CAIX, PSMA, folate-binding protein, gangliosides (such as GD2, GD3, GM1 and GM2), VEGF receptor ( VEGFR) , VEGFR2, VEGF- A,
- the targeting moiety binds to PD-L1.
- the targeting moiety is an antibody or antigen -binding fragment.
- the antibody is selected from cetuximab, panitumumab, zalutumumab, nimotuzumab, trastuzumab, Ado-trastuzumab emtansine, Tositumomab (Bexxar ®), Rituximab (Rituxan, Mabthera), Ibritumomab tiuxetan (Zevalin), Daclizumab (Zenapax), Gemtuzumab (Mylotarg), Alemtuzumab, CEA-scan Fab fragment, OC125 monoclonal antibody, ab75705, B72.3, Bevacizumab (Avastin ®), Afatinib, Axitinib, Bosutinib, Cabozantinib, Ceritini
- Ramucirumab (Cyramza®), Regorafenib, Ruxolitinib, Sorafenib, Sunitinib, Temsirolimus, Trametinib, Vandetanib, Vemurafenib, Vismodegib, Basiliximab, Ipilimumab, Nivolumab, pembrolizumab, MPDL3280A, Pidilizumab (CT-011), AMP-224, MSB001078C, or MEDI4736, BMS-935559, LY3300054, atezolizumab, avelumab or durvalumab or is an antigen-binding fragment thereof.
- the variant ICOSL polypeptide is linked, directly or indirectly via a linker, to the N-terminus of the heavy and/or light chain of the antibody or antigen-binding fragment. In some cases, the variant ICOSL polypeptide is linked, directly or indirectly via a linker, to the C-terminus of the heavy and/or light chain of the antibody or antigen binding fragment.
- the conjugate is divalent, tetravalent, hexavalent or octavalent.
- the heterologous moiety is or contains a label for detection or purification of the variant ICOSL polypeptide.
- a monovalent fusion protein containing a variant ICOSL polypeptide containing one or more amino acid modifications in an immunoglobulin superfamily (IgSF) domain of an ICOSL reference polypeptide, wherein the variant ICOSL polypeptide exhibits altered binding to the ectodomain(s) of ICOS or CD28 compared to the binding of the ICOSL reference polypeptide for the same ectodomain(s); and a label for detection or purification of the variant ICOSL polypeptide.
- the label for detection or purification is selected from a poly-histidine (His) tag, a FLAG-tag, a Myc- tag, or a fluorescent protein-tag.
- the variant ICOSL polypeptide contains one or more amino acid modifications in a position corresponding to position(s) selected from 10, 11, 13, 16, 18, 20, 25, 27, 30, 33, 37, 38, 42, 43, 47, 52, 54, 57, 61, 62, 67, 71, 72, 74, 75, 77, 78, 80, 84, 89, 90, 92, 93, 94, 96, 97, 98, 99, 100, 102, 103, 107, 109, 110, 111, 113, 115, 116, 117, 119, 120, 121, 122, 126, 129, 130, 132, 133, 135, 138, 139, 140, 142, 143, 144, 146, 148, 151, 152, 153, 154, 155, 156, 158, 161, 164, 166, 168, 172, 173, 175, 190, 192, 193, 194,
- the variant ICOSL polypeptide contains one or more amino acid modifications are in a position corresponding to position(s) selected from 10, 11, 13, 16, 18, 20, 25, 26, 27, 30, 33, 37, 38, 42, 43, 47, 52, 54, 57, 61, 62, 67, 71, 72, 74, 75, 77, 78, 80, 84, 89, 90, 92, 93, 94, 96, 97, 98, 99, 100, 102, 103, 107, 109, 110, 111, 113, 115, 116, 117, 119, 120, 121, 122, 126, 129, 130, 132, 133, 135, 137, 138, 139, 140, 142, 143, 144, 146, 151, 152, 153, 154, 155, 156, 158, 161, 164, 166, 168, 172, 173, 175, 190, 192, 193, 194, 198
- the one or more amino acid modifications are selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20V, S25G, F27S, F27C, N30D, Y33del, Q37R, K42E, T43A, Y47H, N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M, N52Q, N52R, N52S, N52T, N52V, N52Y, N52K, S54A, S54P, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57Y, N57W, R61S, R61C, Y62F, L67P, A71T, G72R, L74Q, R75Q, D77G, F78L, L
- the one or more amino acid modifications are selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20T, A20V, S25G, R26S, F27C, F27S, N30D, Y33del, Q37R, T38P, K42E, T43A, Y47H, N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M, N52P, N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54F, S54P, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, N57Y, R61C, R61S, Y62F, L67P, A71T, G72R, L74Q, R
- the ICOSL reference polypeptide contains (i) the sequence of amino acids set forth in SEQ ID NO:32, (ii) a sequence of amino acids that has at least 95% sequence identity to SEQ ID NO:32; or (iii) a portion of (i) or (ii) comprising an IgV domain or IgC domain or specific binding fragments thereof or both.
- the ICOSL reference polypeptide comprises the sequence of amino acids set forth in any of SEQ ID NOS: 196, 545, 600-605 and 623-628. In some aspects, the ICOSL reference polypeptide consists of the sequence of amino acids set forth in any of SEQ ID NOS: 32, 196, 545, 600-605 and 623-628.
- nucleic acid molecule(s) encoding any of the provided variant ICOSL polypeptides, immunomodulatory proteins, or fusion proteins.
- the nucleic acid molecules(s) is synthetic nucleic acid.
- the nucleic acid molecule(s) is cDNA.
- the vector containing any of the provided the nucleic acid molecule(s).
- the vector is an expression vector.
- the vector is a mammalian expression vector or a viral vector.
- the cell containing any of the provided vectors.
- the cell is a mammalian cell.
- the cell is a Chinese Hamster Ovary (CHO) cell or a derivative thereof.
- the method further includes isolating or purifying the protein from the cell.
- the protein or immunomodulatory protein is purified from Chinese Hamster Ovary Cells or a derivative thereof.
- the recombinant antigen receptor is a chimeric antigen receptor (CAR) or an engineered T cell receptor (TCR).
- each of the nucleic acid encoding the variant ICOSL polypeptide and the one or more nucleic acid encoding one or more chain of the recombinant receptor is separated by a nucleic acid encoding a self-cleaving peptide or a peptide that causes ribosome skipping.
- the polynucleotide contains the nucleic acid encoding the variant ICOSL polypeptide, a nucleic acid encoding a self-cleaving peptide or a peptide that causes ribosome skipping and a nucleic acid encoding a CAR.
- the polynucleotide comprises the nucleic acid encoding the variant ICOSL polypeptide, a nucleic acid encoding a first self-cleaving peptide or a peptide that causes ribosome skipping, a nucleic acid encoding one of an engineered TCRalpha chain or an engineered TCRbeta chain, a nucleic acid encoding a second self-cleaving peptide or a peptide that causes ribosome skipping, and a nucleic acid encoding the other of the engineered TCRalpha chain or the engineered TCRbeta chain.
- the encoded first and second self-cleaving peptide is the same.
- the self-cleaving peptide or the peptide that causes ribosome skipping is a T2A, a P2A, a E2A or a F2A.
- the vector is a viral vector.
- the viral vector is a retroviral vector or a lentiviral vector.
- an engineered cell containing any of the provided polynucleotides or vectors is also provided. Also provided is an engineered cell containing any of the provided variant ICOSL polypeptides, immunomodulatory proteins, or fusion proteins.
- an engineered cell containing any of the provided nucleic acid molecules or the vectors.
- the nucleic acid encoding the variant ICOSL polypeptide, immunomodulatory protein or fusion protein encodes a signal peptide.
- the variant ICOSL polypeptide, immunomodulatory protein or fusion protein does not contain a transmembrane domain and/or is not expressed on the surface of the cell.
- the variant ICOSL polypeptide, immunomodulatory protein or fusion protein does not contain a transmembrane domain and/or is not expressed on the surface of the cell.
- the immunomodulatory protein or fusion protein is secreted from the engineered cell.
- the engineered cell contains a variant ICOSL polypeptide containing a transmembrane domain.
- the variant ICOSL polypeptide is expressed on the surface of the cell.
- the cell is an immune cell.
- the immune cell is an antigen presenting cell (APC) or a lymphocyte.
- the engineered cell is primary cell.
- the cell is a mammalian cell.
- the cell is a human cell.
- the lymphocyte is a T cell.
- the engineered cell is an APC and the APC is an artificial APC.
- the engineered cell further contains a chimeric antigen receptor (CAR) or an engineered T-cell receptor.
- CAR chimeric antigen receptor
- an infectious agent containing a nucleic acid molecule encoding a provided variant ICOSL polypeptide or a provided immunomodulatory protein, a provided the fusion protein.
- the encoded variant ICOSL polypeptide, immunomodulatory protein or fusion protein does not contain a transmembrane domain and/or is not expressed on the surface of a cell in which it is expressed.
- the encoded variant ICOSL polypeptide, immunomodulatory protein or fusion protein is secreted from the infectious agent when it is expressed.
- the encoded variant ICOSL polypeptide comprises a transmembrane domain.
- the encoded variant ICOSL polypeptide is expressed on the surface of a cell in which it is expressed.
- the infectious agent is a bacteria or a virus.
- the virus is an oncolytic virus.
- the oncolytic virus is an adenoviruses, adeno-associated viruses, herpes viruses, Herpes Simplex Virus, Vesticular Stomatic virus, Reovirus, Newcastle Disease virus, parvovirus, measles virus, vesticular stomatitis virus (VSV), Coxsackie virus or a Vaccinia virus.
- the virus specifically targets dendritic cells (DCs) and/or is dendritic cell-tropic.
- DCs dendritic cells
- the virus is a lentiviral vector that is pseudotyped with a modified Sindbis virus envelope product.
- the infectious agent further contains a nucleic acid molecule encoding a further gene product that results in death of a target cell or that can augment or boost an immune response.
- the further gene product is selected from an anticancer agent, anti-metastatic agent, an antiangiogenic agent, an immunomodulatory molecule, an immune checkpoint inhibitor, an antibody, a cytokine, a growth factor, an antigen, a cytotoxic gene product, a pro-apoptotic gene product, an anti-apoptotic gene product, a cell matrix degradative gene, genes for tissue regeneration or a reprogramming human somatic cells to pluripotency.
- a pharmaceutical composition containing any of the variant ICOSL polypeptides, immunomodulatory proteins, conjugates or fusion proteins or any of the provided engineered cells or infectious agents.
- the pharmaceutical composition contains a pharmaceutically acceptable excipient.
- the pharmaceutical composition is sterile.
- an article of manufacture containing the pharmaceutical composition in a vial.
- the vial is sealed.
- kits containing any of the provided compositions and instructions for use are also provided. Also provided is a kit containing any of the provided articles of manufacture and instructions for use.
- a method of modulating an immune response in a subject including administering the pharmaceutical composition to the subject. Also provided is a method of modulating an immune response in a subject including administering the engineered cells.
- the engineered cells are autologous to the subject. In some of any of the provided embodiments, the engineered cells are allogenic to the subject.
- the modulating the immune response treats a disease or condition in the subject.
- the immune response is increased.
- an immunomodulatory protein or conjugate containing a variant ICOSL polypeptide linked to a tumor-localizing moiety is administered to the subject.
- the tumor-localizing moiety is or comprises a binding molecule that recognizes a tumor antigen.
- the binding molecule contains an antibody or an antigen-binding fragment thereof or comprises a wild-type IgSF domain or variant thereof.
- the immunomodulatory protein or the conjugate or fusion protein is administered to the subject.
- a variant ICOSL polypeptide that is a transmembrane immunomodulatory protein is administered to the subject.
- the engineered cell containing a variant ICOSL polypeptide that is a transmembrane immunomodulatory protein is administered to the subject.
- the disease or condition is a tumor or cancer.
- the disease or condition is selected from melanoma, lung cancer, bladder cancer, a hematological malignancy, liver cancer, brain cancer, renal cancer, breast cancer, pancreatic cancer, colorectal cancer, spleen cancer, prostate cancer, testicular cancer, ovarian cancer, uterine cancer, gastric carcinoma, a musculoskeletal cancer, a head and neck cancer, a gastrointestinal cancer, a germ cell cancer, or an endocrine and neuroendocrine cancer.
- the immune response is decreased.
- a variant ICOSL polypeptide or immunomodulatory protein that is soluble is administered to the subject.
- the soluble immunomodulatory protein is an immunomodulatory Fc fusion protein.
- a provided variant ICOSL polypeptide, immunomodulatory protein, or fusion protein is administered to the subject.
- an engineered cell containing a secretable variant ICOSL polypeptide is administered to the subject.
- a provided engineered cell is administered to the subject.
- an infectious agent encoding a variant ICOSL polypeptide that is a secretable immunomodulatory protein is administered to the subject, optionally under conditions in which the infectious agent infects a tumor cell or immune cell and the secretable immunomodulatory protein is secreted from the infected cell.
- the disease or condition is an inflammatory or autoimmune disease or condition.
- the disease or condition is an Antineutrophil cytoplasmic antibodies (ANCA)-associated vasculitis, a vasculitis, an autoimmune skin disease, transplantation, a Rheumatic disease, an inflammatory gastrointestinal disease, an inflammatory eye disease, an inflammatory
- ANCA Antineutrophil cytoplasmic antibodies
- the disease or condition is selected from inflammatory bowel disease, transplant, Crohn's disease, ulcerative colitis, multiple sclerosis, asthma, rheumatoid arthritis, or psoriasis.
- FIG. 1 depicts impedance results reflecting cytotoxic killing activity of cells engineered with an anti-CD 19 chimeric antigen receptor (CAR) alone or with an exemplary transmembrane immunomodulatory TIP (CD80-TIP or ICOSL-TIP) or the corresponding CD80 or ICOSL wild-type transmembrane protein following co-culture with target antigen-expressing cells. Impedance was assessed using the Acea Real-Time Cell Analyzer (RTCA), which measures the impedance variations in the culture media of a 96-well microelectronic plate (E- plate).
- RTCA Acea Real-Time Cell Analyzer
- FIG. 2A depicts that primary T cells are effectively transduced with viruses encoding both the CAR and ⁇ proteins.
- Primary human T cells activated 48 hours with anti-CD3 plus anti-CD28 beads and were then tranduced with a Lenti-virus encoding an anti-CD 19 CAR with a BFP reporter, plus a second Lenti-virus encoding and ICOSL TIP with a GFP reporter.
- the FACs plot shows BFP expression on the y-axis and GFP expression on the x-axis and the percentage of T cells that fall into each quadrant are indicated.
- Results show that the cultures include CAR only transduced cells (upper left quadrant), TIP only transduced cells (lower right quadrant), cells transduced with both viruses (upper right quadrant) and cells that were not transduced with either (lower left).
- TIPs expressed on CAR-T cells provide co- stimulation to the CAR-T cells.
- CAR-T cells with or without TIP co-transduction were labeled with Cell-Trace Far Red and incubated with the CD 19+ NALM6 cell line to engage the CAR. Proliferation was assessed by the percentage of CAR-expressing cells that had diluted out the fluorescent dye.
- FIG. 3A-3B demonstrate, via cytokine release, the costimulatory capacity of wild- type (WT) or variant ICOSL when coimmobilized with anti-CD3.
- 10 nM anti-CD3 was wet coated to the wells of 96-well flat bottomed polystyrene tissue culture plates with 40 nM (arrows) or 10 nM WT or variant ICOSL. 100,000 purified CD4 + and CD8 + (pan) T-cells cells were added and supernatant was harvested 72 hours later for ELISA analysis for cytokine release.
- FIG. 3A shows IFN-gamma and
- FIG. 3B shows IL-17 protein levels secreted from pan T-cells.
- Graphs are representative of typical IFN-gamma and IL-17 responses from pan T-cell co stimulation.
- FIG. 4A-4B demonstrate, via proliferation, the costimulatory capacity of wild-type (WT) or variant ICOSL when coimmobilized with anti-CD3.
- WT wild-type
- CFSE-labeled pan T-cells were incubated in anti-CD3 and ICOSL coated plates as previously described for 72 hours. Cells were harvested, washed, stained with fluorescently conjugated anti-CD4 or anti-CD8 antibodies, and analyzed by flow cytometry. Gates and cytometer voltages were set using non-stimulated control CFSE-labeled T-cells. Proliferation was determined by CFSE dilution from control.
- FIG. 4A shows percent of total proliferating (arrows), CD4 + (solid bar), and CD8 + cells (hatched bar) T- cells following 40 nM ICOSL co stimulation.
- FIG. 4B shows percent of total pan T-cell proliferation following 10 nM ICOSL costimulation. Graphs are representative of typical proliferative response from pan T-cell costimulation.
- FIG. 5 depicts ICOSL vlgD candidate function in a human Mixed-Lymphocyte- Reation (MLR).
- ICOSL variants and their mutations are listed on the x-axis, along with wild- type ICOSL, negative controls PDL2-Fc and human IgG, as well as the positive control benchmark molecule CTLA-Ig Belatacept.
- the line across the graph represents the baseline amount of IFN-gamma detected in the supernatants of negative control cultures.
- three different concentrations were tested with arrows indicating the highest concentration of protein in cultures at 40nM.
- the majority of ICOSL variant candidates show superior antagonistic activity at all three concentrations tested compared to belatacept as reflected by the lower concentration of IFN-gamma in those cultures.
- FIG. 6A-6D depicts the inhibition of soluble ICOSL Fc-fusion proteins on B and T cell responses in a B-T co-culture assay.
- FIG. 6A depicts soluble ICOSL Fc-fusion proteins inhibition of T cell-driven B cell proliferation.
- Purified CD4+ T cells and B cells from a single donor were CFSE-labeled and co-incubated at a 1: 1 ration in the presence or absence of the indicated mitogens with or without the indicated ICOSL Fc-fusion proteins.
- Cells were stimulated with Staph enterotoxin B (SEB) at 100 ng/mL, Pokeweed mitogen (PWM) at 1 mg/mL, or both.
- SEB Staph enterotoxin B
- PWM Pokeweed mitogen
- ICOSL Fc-fusion proteins were included at a final concentration of 40 nM and cultures were incubated for 7 days and subjected to FACS analysis. The number of divided B cells was determined from the number of cells in the cultures that had diluted their CFSE. All of the ICOSL Fc-fusion proteins tested except for wild-type reduced B cell proliferation.
- FIG. 6B- 6D show ICOSL Fc-fusion proteins inhibited cytokine T cell cytokine production in B-T co- cultures. Supernatants from the cultures described above were harvested on day 7 and analyzed for cytokine content using a LEGENDplex Human Th Cytokine Panel (Biolegend). T cell production of IL-5 (FIG. 6B), IL-13 (FIG. 6C) and IL-21 (FIG. 6D) is attenuated by inclusion of ICOSL Fc-fusion proteins.
- FIG 7A-7F depicts different endpoints in a mouse model of Graft Verse Host Disease (GVHD) where human PBMC cells were adoptively transferred into immunodeficient NSG murine hosts.
- FIG. 7A shows survival curves of the treated animals. Aggressive disease course and subsequent mortality was observed in the saline control animals, with similar survival observed in the animals treated with wild-type ICOSL-Fc, as well as the N52H/I143T ICOSL variant. Variant N52H/N57Y/Q100P had improved survival rates comparable to the clinical benchmark belatacept.
- FIG. 7A shows survival curves of the treated animals. Aggressive disease course and subsequent mortality was observed in the saline control animals, with similar survival observed in the animals treated with wild-type ICOSL-Fc, as well as the N52H/I143T ICOSL variant. Variant N52H/N57Y/Q100P had improved survival rates comparable to the clinical benchmark belatacept.
- FIG. 7B shows similar trends in body weight loss, with ICOSL variant N52H/N57Y/Q100P demonstrating similar weight maintenance as animals treated with belatacept, even though all other groups experienced rapid weight loss.
- FIG. 7C shows clinical scores from standardized GVHD Disease Activity Index (DAI) observations, again showing lower scores in animals treated with the ICOSL variant N52H/N57Y/Q100P that are comparable to the clinical benchmark belatacept while the other groups of animals experienced higher DAI scores.
- FIG. 7D depicts a flow cytometric measurement of CD4 and CD8 percentages in blood from experimental animals measured on day 14. The percentage of CD8 cells between experimental groups was largely the same, however, animals treated with ICOSL variant N52H/N57Y/Q100P and belatacept have lower percentages of CD4 cells compared to the other experimental groups.
- FIG. 7E depicts survival curves from a similar experiment testing additional ICOSL variant molecules.
- FIG. 7F depicts clinical scores from a similar experiment testing additional ICOSL variant molecules.
- FIG. 8 shows localized costimulatory activity conveyed by the indicated variant stack molecule vlgD C-L, where C represents an ICOSL costimulatory domain and L represents a NKp30 localizing domain.
- target K562 cells expressing the localizing surface protein, B7-H6, were cultured in the presence of anti-CD3 with human T cells and T cell activation was assessed by IFN-gamma levels in culture supernatants. Including anti-CD3 alone or no stack variant Fc molecules did not induce T cell activation. Similarly, cells cultured with only the wild-type localizing NKp30 domain alone or the wild-type costimulatory ICOSL domain alone as Fc fusion proteins did not result in T cell activation.
- a stacked domain containing the wild-type version of both the costimulatory domain and localizing domain induced measurable IFN-gamma at the highest concentration tested, however, the variant localizing costimulatory stack induced greater than two fold higher IFN-gamma levels at the highest concentration, and IFN-gamma levels that were still observed as the concentrations were titrated down.
- FIG. 9 summarizes changes in ear thickness in mice from a standard model of Delay ed-Type Hypersensitivity (DTH).
- DTH Delay ed-Type Hypersensitivity
- FIG. lOA-lOC depicts various exemplary configurations of a variant IgSF domain (vlgD) conjugated to an antibody (V-Mab).
- FIG. 10A shows various configurations in which a vlgD is linked, directly or indirectly, to the N- and/or C-terminus of the light chain of an antibody.
- FIG. 10B shows various configurations in which a vlgD is linked, directly or indirectly, to the N- and/or C-terminus of the heavy chain of an antibody.
- FIG. IOC depicts the resulting V-Mab configurations when a light chain of FIG. 10A and a heavy chain of FIG. 10B are co-expressed in a cell.
- FIG. 11A-11B demonstrate V-Mab specificity for cognate binding partners. Binding assays were performed on Expi293 cells transiently transfected with DNA for mammalian surface expression of human HER2, CD28, CTLA-4, or ICOS. 200,000 transfected cells were incubated with 100,000 pM to 100 pM parental antibody (CI) or various V-Mabs (C2-9).
- FIG. 11A shows binding of the V-Mabs to HER2 transfectants at levels similar to the parental antibody. Binding to mock transfected cells is observed with all V-Mabs, though not WT ICOSL, due to low levels of endogenous HER2 expression on Expi293 parental cells.
- FIG. 11B shows binding of the parental IgSF-domain (N52H/N57Y/Q100P) to its cognate partners is maintained or increased (C2, C3, C4, C5, C6, C8, C9) by V-Mabs.
- FIG. 12 demonstrates V-Mab costimulatory and proliferative capacity when coimmobilized with anti-CD3.
- 10 nM anti-CD3 was wet coated to the wells of 96-well flat bottomed polystyrene tissue culture plates with 30 nM to 3 nM parental antibody, V-Mabs, or Fc controls.
- CFSE-labeled pan T-cells were added for 72 hours.
- IFN-gamma secretion was measured by ELISA and total T-cell proliferation was measured by flow cytometric analysis of CFSE-dilution.
- IFN-gamma secretion and proliferation of IgSF-domain (N52H/N57Y/Q100P) isgreater than WT ICOSL.
- V-Mabs demonstrate increased cytokine and proliferative
- FIG. 13A-13C depicts various formats of the provided variant IgSF domain molecules.
- FIG. 13A depicts soluble molecules, including: (1) a variant IgSF domain (vlgD) fused to an Fc chain; (2) a stack molecule containing a first variant IgSF domain (first vlgD) and a second IgSF domain, such as a second variant IgSF domain (second vlgD); (3) a tumor targeting IgSF molecule containing a first variant IgSF domain (vlgD) and an IgSF domain that targets to a tumor antigen, such as an NKp30 IgSF domain; and (4) a variant IgSF domain (vlgD) linked to an antibody (V-Mab).
- FIG. 13A depicts soluble molecules, including: (1) a variant IgSF domain (vlgD) fused to an Fc chain; (2) a stack molecule containing a first variant IgSF domain (first vlgD) and a second IgSF
- FIG. 13B depicts a transmembrane immunomodulatory protein (TIP) containing a variant IgSF domain (vlgD), e.g., variant ICOSL, expressed on the surface of a cell.
- TIP transmembrane immunomodulatory protein
- vlgD variant IgSF domain
- the cognate binding partner of the transmembrane bound vlgD is a costimulatory receptor, e.g. CD28
- the TIP containing the vlgD e.g. ICOSL vlgD
- FIG. 13C depicts a secreted immunomodulatory protein (SIP) in which a variant IgSF domain (vlgD), e.g., variant ICOSL, is secreted from a cell, such as a first T cell (e.g. CAR T cell).
- vlgD variant IgSF domain
- the cognate binding partner of the secreted vlgD is an activating receptor, e.g., CD28, which can be expressed on the first cell (e.g., T cell, such as a CAR T cell) and/or on a second cell (e.g. T cell; either endogenous or engineered, such as a CAR T cell).
- the vlgD can be a V-domain (IgV) only, the combination of the V-domain (IgV) and C-domain (IgC), including the entire extracellular domain (ECD), or any combination of Ig domains of the IgSF superfamily member.
- FIG. 14 depicts an exemplary schematic of the activity of a variant IgSF domain (vlgD) fused to an Fc (vlgD-Fc) in which the vlgD is a variant of an IgSF domain of ICOSL.
- vlgD variant IgSF domain
- Fc Fc
- a soluble vlgD of ICOSL interacts with its cognate binding partners to block interactions of CD80 (B7-1)/CD86 (B7-2) or ICOSL with CD28 or ICOS, respectively, thereby blocking costimulation by the CD28 and/or ICOS costimulatory receptors.
- FIG. 15 depicts an exemplary schematic of a stack molecule for localizing the variant IgSF domain (vlgD) to a tumor cell.
- the stack molecule contains a first variant IgSF domain (first vlgD) and a second IgSF domain (e.g. a second vlgD) in which the second IgSF domain (e.g a second vlgD) is a tumor-targeted IgSF domain that binds to a tumor antigen.
- An exemplary tumor-targeted IgSF domain is an IgSF domain of NKp30, which binds to the tumor antigen B7-H6.
- the vlgD is a variant of an IgSF domain of ICOSL.
- binding of tumor- targeted IgSF domain to the surface of the tumor cell localizes the first vlgD on the tumor cell surface where it can interact with one or more of its cognate binding partners (e.g. CD28 or ICOS) expressed on the surface of an adjacent immune cell (e.g. T cell) to stimulate the costimulatory receptor.
- FIG. 16A depicts various exemplary configurations of a stack molecule containing a first variant IgSF domain (first vIgD), e.g. variant ICOSL, and a second IgSF domain, such as a second variant IgSF domain (second vIgD).
- the first vIgD and second IgSF domain are independently linked, directly or indirectly, to the N- or C-terminus of an Fc region.
- the Fc region is one that is capable of forming a homodimer with a matched Fc subunit by co-expression of the individual Fc regions in a cell.
- the individual Fc regions contain mutations (e.g. "knob-into-hole" mutations in the CH3 domain), such that formation of the heterodimer is favored compared to homodimers when the individual Fc regions are co-expressed in a cell.
- FIG. 16B depicts various exemplary configurations of a stack molecule containing a first variant IgSF domain (first vIgD), a second IgSF domain, such as a second variant IgSF domain (second vIgD), and a third IgSF domain, such as a third variant IgSF domain (third vIgD).
- first vIgD, second IgSF, and third IgSF domains are independently linked, directly or indirectly, to the N- or C-terminus of an Fc region.
- the Fc region is one that is capable of forming a homodimer with a matched Fc region by co-expression of the individual Fc regions in a cell.
- FIG. 17 depicts an exemplary schematic of the activity of a variant IgSF domain (vIgD) conjugated to an antibody (V-Mab) in which the antibody (e.g. anti-HER2 antibody) binds to an antigen on the surface of the tumor cell.
- the vIgD is a variant of an IgSF domain of ICOSL.
- binding of the antibody to the surface of the tumor cell localizes the vIgD on the tumor cell surface where it can interact with one or more of its cognate binding partners expressed on the surface of an adjacent immune cell (e.g. T cell) to agonize receptor signaling.
- the variant IgSF domain (vIgD) is a variant of an IgSF domain of ICOSL. Binding of the ICOSL vIgD to CD28 or ICOS
- costimulatory receptors provides an agonist or costimulatory signal.
- FIG. 18 depicts the Nanostring transcriptional signature of primary human T cells when incubated 10 nM anti-CD3 with 40 nM of an Fc-control protein, wild-type ICOSL-Fc, wild-type CD80-Fc, both of these proteins, or a variant ICOSL Fc-fusion proteins with mutations as indicated.
- Total RNA from samples was prepared from harvested cells and the RNA was transferred to Nanostring and a Cancer Immune chip was used to quantitate transcripts of 750 gene in each sample. Altered transcripts include those whose level is above or below the diagonal line, including the noted transcripts.
- FIG. 19 depicts transcript levels of exemplary transcripts upon incubation as described in FIG. 18 for the indicated times in the presence of the various immunomodulatory proteins.
- FIG. 20A-20B demonstrates VmAb mediated T-cell proliferation when co-cultured with HER2 expressing targets.
- CFSE-labeled pan T-cells were activated with K562-derived artificial target cells displaying cell surface anti-CD3 single chain Fv (OKT3) and HER2 in the presence of VmAbs or control proteins. Proliferation was measured by flow cytometric analysis of CFSE-dilution on CD4 + (left panel) or CD8 + (right panel) stained T-cells.
- K562 cells were titrated and plated with T-cells for an effectontarget (E:T) ratio of 40 to 1280: 1.
- VmAbs, parental IgSF domain, or WT ICOSL were added at lOOOpM.
- K562 cells were added to T-cells for an E:T ratio of 160: 1.
- VmAbs or control proteins were titrated and added at 3000 to 37pM.
- FIG. 21 depicts the proliferation studies for T cells transduced with various IgSF domain-containing transmembrane immunomodulatory proteins (TIPs) and an exemplary recombinant E6- specific TCRs in primary human T cells.
- TIPs IgSF domain-containing transmembrane immunomodulatory proteins
- FIG. 22A-22G shows SEC analysis of proteolysis in variant ICOSL Fc-fusion molecules containing mutations N52H/N57Y/Q100R/F172S generated in various reference sequences, such as truncated ICOSL ECD Fc-fusion, an ICOSL IgV domain alone Fc-fusion, and/or ICOSL variant Fc fusion proteins with mutations at N207G/L208G with reference to the reference ICOSL extracellular domain (ECD) sequence set forth in SEQ ID NO:32. Molecules were expressed using ExpiCHO-S derived cells.
- ECD extracellular domain
- FIG. 23A-23B depicts the proliferation of CD4 and CD8 human T cells stimulated with K652 cells expressing variant ICOSL TIPs containing an ECD containing an affinity- modified IgSF with amino acid mutations corresponding to N52H/N57Y/Q100P (SEQ ID NO: 288), N52H/N57Y/Q100R (SEQ ID NO: 283), and
- FIG. 24A depicts binding of V-mAbs to HER2 and CD28.
- FIG. 24B -24F depicts results of VmAb costimulation of T cells using a transfected cell system using Jurkat cells with an IL-2 promoter luciferase reporter, showing that V-mAbs provided a significant costimulatory signal in the presence of HER2+ K562/OKT3 cells.
- FIG. 25A-25D depicts binding of stack Fc-fusion molecules to cells expressing cognate binding partners B7H6 (FIG. 25A), ICOS (FIG. 25B), CD28 (FIG. 25C), and CTLA-4 (FIG. 25D).
- FIG. 26A-26B depicts bioactivity studies for exemplary tested ICOSL/NKp30 stack proteins.
- FIG. 27 depicts proliferation induced by ICOSL/NKp30 stack proteins as measured by flow cytometric analysis of CFSE-dilution on CD4+ or CD8+ stained T-cells.
- FIG. 28 depicts anti-tumor effects of the combination of the tested ICOSL/NKp30 stack protein and mPD-1 mAb.
- FIG. 29A-29E depicts anti-inflammatory activity of prophylactic dosing of the exemplary ICOSL IgV-Fc fusion molecule in the collagen-induced arthritis (CIA) model, including mean sum paw score (FIG. 29A), detected CII IgG (FIG. 29B), serum cytokine levels (FIG. 29C), CD44+ activated T cells or T FH cells (FIG. 29D), and fraction of B cells in the draining lymph node (FIG. 29E).
- CIA collagen-induced arthritis
- FIG. 30A-30D depicts anti-inflammatory activity of delayed dosing of the exemplary ICOSL IgV-Fc fusion molecule in the collagen-induced arthritis (CIA) model, including mean sum paw score (FIG. 30A) and serum cytokine levels (FIG. 30C-30D).
- FIG. 31A-31D depicts anti-inflammatory activity of delayed dosing of the exemplary ICOSL IgV-Fc fusion molecule in the experimental autoimmune encephalomyelitis (EAE) model, including EAE score (FIG. 31A), flow cytometric analysis of inguinal lymph node T cells (FIG. 31C), and proinflammatory cytokines (FIG. 31D).
- EAE experimental autoimmune encephalomyelitis
- FIG. 32A-32B depicts survival and DAI score of Graft-versus-Host-Disease (GvHD) mice treated with various doses (20, 100, or 500 ⁇ g) of a variant ICOSL IgV-Fc molecule.
- GvHD Graft-versus-Host-Disease
- FIG. 33A-33F depicts results from flow cytometric analysis of Graft-versus-Host- Disease (GvHD) ratio of human cells/mouse cells in blood collected (FIG. 33A) or in total T cell count (FIG. 33B) at the end of the study, and assessment of ICOS+ CD4+ or CD8+ cells (FIG. 33C-33D), or CD28+ CD4+ or CD8+ cells (FIG. 33E-33F) from Graft-versus-Host-Disease (GvHD) mice treated with various doses (20, 100, or 500 ⁇ g) of a variant ICOSL IgV-Fc molecule.
- GvHD Graft-versus-Host- Disease
- FIG. 34A-34B depicts expression of activation or exhaustion markers of T cells from Graft-versus-Host-Disease (GvHD) mice treated with various doses (20, 100, or 500 ⁇ g) of a variant ICOSL IgV-Fc molecule.
- FIG. 34C depicts the ratio of T effector cells (Teff) to T regulatory cells (Treg) from Graft-versus-Host-Disease (GvHD) mice treated with various doses (20, 100, or 500 ⁇ g) of a variant ICOSL IgV-Fc molecule.
- FIG. 35A-35D depicts serum proinflammatory cytokines from Graft-versus-Host- Disease (GvHD) mice treated with various doses (20, 100, or 500 ⁇ g) of a variant ICOSL IgV-Fc molecule.
- FIG. 35E depicts serum exposure of variant ICOSL IgV-Fc (N52H/N57Y/Q100R) in the GVHD model compared to normal mice.
- FIG. 36A depicts DAI results and FIG. 36B depicts histology results from treatment with an exemplary variant ICOSL IgV-Fc on disease activity index (DAI) calculated from body weight and stool scores in a CD4+CD45RBhigh-induced colitis model.
- DAI disease activity index
- immunomodulatory proteins that are or comprise variants or mutants of ICOS ligand (ICOSL) or specific binding fragments thereof that exhibit activity to bind to at least one target ligand cognate binding partner (also called counter-structure protein).
- the variant ICOSL polypeptides contain one or more amino acid modifications (e.g. amino acid substitutions, deletions or additions) compared to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the one or more amino acid modifications e.g. amino acid substitutions, deletions or additions
- IgSF immunoglobulin superfamily
- the variant ICOSL polypeptide exhibits altered, such as increased or decreased, binding activity or affinity for at least one cognate binding partner, such as at least one of ICOS, CD28, or CTLA-4.
- the immunomodulatory proteins are soluble.
- the immunomodulatory proteins are transmembrane immunomodulatory proteins capable of being expressed on the surface of cells.
- also provided herein are one or more other immunomodulatory proteins that are conjugates or fusions containing a variant ICOSL polypeptide provided herein and one or more other moiety or polypeptide.
- the variant ICOSL polypeptides and immunomodulatory proteins modulate an immunological immune response, such as an increased or decreased immune response.
- the variant ICOSL polypeptides and immunomodulatory proteins provided herein can be used for the treatment of diseases or conditions that are associated with a dysregulated immune response.
- the provided variant ICOSL polypeptides modulate T cell activation via interactions with costimulatory signaling molecules.
- costimulatory signaling molecules In general, antigen specific T-cell activation requires two distinct signals. The first signal is provided by the interaction of the T-cell receptor (TCR) with major histocompatibility complex (MHC) associated antigens present on antigen presenting cells (APCs). The second signal is costimulatory to TCR engagement and necessary to avoid T-cell apoptosis or anergy.
- TCR T-cell receptor
- MHC major histocompatibility complex
- the T cell-mediated immune response is initiated by antigen recognition by the T cell receptor (TCR) and is regulated by a balance of co- stimulatory and inhibitory signals (e.g., immune checkpoint receptors).
- TCR T cell receptor
- co- stimulatory and inhibitory signals e.g., immune checkpoint receptors
- immunomodulatory proteins can be dysregulated in diseases and conditions, including tumors, as a mechanism for evading the immune system.
- CD28 which is the T-cell costimulatory receptor for the ligands B7-1 (CD80) and B7-2 (CD86) both of which are present on APCs.
- CTLA4 cytotoxic T-lymphocyte-associated protein 4
- CTLA-4 acts to down-modulate the immune response.
- ICOS inducible costimulator
- ICOSL ICOS ligand
- CD28 and CTLA-4 also are known to interact with ICOSL at a binding site that overlaps with the binding of ICOSL to the T-cell costimulatory receptor ICOS (Yao et al. (2011) Immunity, 34:729-740).
- CD28 and ICOS are related CD28 family activating receptors and share some intracellular signaling motifs, costimulatory effects between CD28 and ICOS differ.
- CD28 is expressed on both unactivated and activated T cells and its signaling is important for IL-2 production and subsequent T cell effector function.
- ICOS is generally not expressed on the surface of T cells until after T cell activation, and signaling through ICOS on activated T cells supports specialized T cell subset differentiation.
- T cells express the costimulatory molecules CD28 and ICOS, which interact with CD80/CD86 and ICOSL respectively, on antigen presenting cells (APC).
- APC antigen presenting cells
- professional APC i.e. dendritic cells, macrophages, and B cells
- CD80, CD86, and ICOSL express CD80, CD86, and ICOSL and engage CD28+/ICOS+ T cells.
- activated T cells can then differentiate into effector cells such as CD8+ cytotoxic T cells (CTL), IL-17A/F- secreting CD4+ Thl7 cells, or CD4+ follicular helper (T FH ) cells.
- CTL cytotoxic T cells
- T FH CD4+ follicular helper
- TpH_expressing CD40L engage B cells in lymphoid follicles and release cytokines (e.g. IL-21) inducing differentiation of B cells to antibody (Ab)-secreting plasma cells.
- Plasma cells can produce tissue-damaging antibodies, e.g., rheumatoid factor (RF) and anti-citrullinated peptide antibodies (ACPA) in humans, and anti-collagen (CII) antibodies in mice, which can form immune complexes and deposits in the joints and other tissues.
- ICOSL can also be expressed on non-professional APCs, leading to T cell activation in non-lymphoid tissues and further damage to the tissues and joints.
- CD4+Thl-, Th9-and Thl7-cells are implicated as key contributors to multiple sclerosis (MS) by increasing inflammation within the CNS in both multiple sclerosis and experimental autoimmune encephalomyelitis and CD4+ICOS+CXCR5+ T follicular helper cells are increased in PBMC in relapsing-remitting and correlate with disease progression in secondary progressive MS.
- ICOS gene expression in cerebrospinal fluid cells, in secondary progressive MS, and an increased percentage of total monocytes and monocytes expressing ICOSL is observed.
- ICOSL also expressed on non-professional APCs, leading to T cell activation in non-lymphoid tissues and further tissue damage
- ICOSL polypeptide are polypeptides that, when modified by one or more amino acid modifications of an IgSF domain of a reference ICOSL polypeptide, exhibit enhanced binding affinity for CD28 and/or ICOS.
- the overall increase in ICOS binding in provided variants is less than the increase in CD28 binding because wild-type ICOSL already demonstrates substantially more binding affinity for ICOS than CD28.
- various formats of the provided variant polypeptides As shown herein, alternative formats can facilitate manipulation of the immune response, and hence the therapeutic application. For example, delivery of enhanced ICOSL proteins in soluble formats is shown herein to antagonize T cell activation by inhibiting CD28 and/or ICOS signaling.
- tethering of the variant ICOSL molecules to a surface facilitates T cell activation by providing a costimulatory signal.
- Various tethering strategies are provided to localize delivery of a T cell costimulatory signal including, but not limited to, direct coating to plastic, use of another variant IgSF domain to localize to a plate-bound or cell surface expressed protein target, or fusion of the variant ICOSL to a tumor- specific monoclonal antibody.
- the modulation of immune signaling achieved by the provided variant ICOSL polypeptides and immunomodulatory polypeptides offers advantages for treatment of inflammatory and autoimmune disorders and other diseases and conditions compared to other treatments.
- therapies to intervene and alter the costimulatory effects of both receptors are constrained by the spatial orientation requirements as well as size limitations imposed by the confines of the immunological synapse.
- existing therapeutic drugs, including antibody drugs may not be able to interact simultaneously with the multiple target proteins involved in modulating these interactions.
- existing therapeutic drugs may only have the ability to antagonize but not agonize an immune response. Additionally, pharmacokinetic differences between drugs that independently target one or the other of these two receptors can create difficulties in properly maintaining a desired blood concentration of such drug combinations throughout the course of treatment.
- immunomodulatory proteins modulate (e.g. increase or decrease) immunological activity induced by costimulatory receptors CD28 or ICOS.
- the provided polypeptides overcome these constraints by providing variant ICOSL (inducible costimulator ligand) with altered (e.g. increased or decreased) binding affinities to both CD28 and ICOS, and, in some cases, CTLA-4, thereby agonizing or antagonizing the complementary effects of costimulation by receptors.
- Methods of making and using these variant ICOSL are also provided.
- the provided molecules may also be more effective than other soluble therapeutic protein agents.
- abatacept CLA-4-Fc
- CTLA-4-Fc abatacept
- a variant CTLA-4-Fc molecule for transplant rejection.
- CTLA-4- Fc proteins bind to CD80 and CD86 and prevent these costimulatory ligands from engaging and triggering only CD28.
- Variant ICOSL polypeptides provided herein exhibit binding affinity and enhanced activity for both CD28 and ICOS.
- the ability to format the variant polypeptides in various configurations to, depending on the context, antagonize or agonize an immune response offers flexibility in therapeutic applications based on the same increased binding and activity of a variant ICOSL for binding partners.
- the particular format can be chosen for the desired therapeutic application.
- an immunomodulatory polypeptide comprising a variant ICOSL polypeptide is provided in a format, e.g. as an Fc-fusion protein, to antagonize or block activity of its cognate binding partner, e.g. ICOS and/or CD28.
- blocking or inhibiting costimulatory signaling via CD28 or ICOS may be useful to suppresses an immune response, which can be useful in the treatment of inflammatory or autoimmune disorders (e.g., multiple sclerosis or brain inflammation), or organ transplantation.
- tethering variant ICOSL proteins to a surface can deliver a localized
- costimulatory signal which, in some aspects, can be used to target tumor tissue to deliver localized costimulation to tumor infiltrating T cells.
- Most primary tumors lack expression of costimulatory molecules such as CD80, CD86 or ICOSL, and thus T cell anti-tumor responses can be compromised by a lack of costimulation (Yu et al. (1998) Int. Immunol. 10:791-797).
- a tumor-localizing moiety such as Nkp30 localized to B7H6 tumor cells or a tumor- specific antibody, T cell responses can be enhanced in the absence of tumor-expressed costimulatory proteins.
- immunoglobulin superfamily domain means a mammalian immunoglobulin superfamily (IgSF) domain having an altered amino acid sequence (relative to the corresponding wild-type parental or unmodified IgSF domain) such that it has an increased or decreased binding affinity or avidity to at least one of its cognate binding partners (alternatively "counter-structures") compared to the parental wild-type or unmodified (i.e., non-affinity modified) IgSF control domain. Included in this context is an affinity modified ICOSL IgSF domain.
- IgSF immunoglobulin superfamily
- the affinity-modified IgSF domain can contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid differences, such as amino acid substitutions, in a reference (e.g., unmodified) or wild-type IgSF domain.
- An increase or decrease in binding affinity or avidity can be determined using well known binding assays such as flow cytometry. Larsen et al., American Journal of Transplantation, Vol 5: 443-453 (2005). See also, Linsley et al., Immunity, Vol 1: 793-801 (1994).
- An increase in a protein's binding affinity or avidity to its cognate binding partner(s) is to a value at least 10% greater than that of the wild-type IgSF domain control and in some embodiments, at least 20%, 30%, 40%, 50%, 100%, 200%, 300%, 500%, 1000%, 5000%, or 10000% greater than that of the wild-type IgSF domain control value.
- a decrease in a protein's binding affinity or avidity to at least one of its cognate binding partner is to a value no greater than 90% of the control but no less than 10% of the wild-type IgSF domain control value, and in some embodiments no greater than 80%, 70% 60%, 50%, 40%, 30%, or 20% but no less than 10% of the wild-type IgSF domain control value.
- affinity- modified protein is altered in primary amino acid sequence by substitution, addition, or deletion of amino acid residues.
- affinity modified IgSF domain is not be construed as imposing any condition for any particular starting composition or method by which the affinity- modified IgSF domain was created.
- the affinity modified IgSF domains of the present invention are not limited to wild type IgSF domains that are then transformed to an affinity modified IgSF domain by any particular process of affinity modification.
- An affinity modified IgSF domain polypeptide can, for example, be generated starting from wild type mammalian IgSF domain sequence information, then modeled in silico for binding to its cognate binding partner, and finally recombinantly or chemically synthesized to yield the affinity modified IgSF domain composition of matter.
- an affinity modified IgSF domain can be created by site-directed mutagenesis of a wild-type IgSF domain.
- affinity modified IgSF domain denotes a product and not necessarily a product produced by any given process.
- a variety of techniques including recombinant methods, chemical synthesis, or combinations thereof, may be employed.
- allogeneic means a cell or tissue that is removed from one organism and then infused or adoptively transferred into a genetically dissimilar organism of the same species.
- the species is murine or human.
- autologous means a cell or tissue that is removed from the same organism to which it is later infused or adoptively transferred.
- An autologous cell or tissue can be altered by, for example, recombinant DNA methodologies, such that it is no longer genetically identical to the native cell or native tissue which is removed from the organism.
- a native autologous T-cell can be genetically engineered by recombinant DNA techniques to become an autologous engineered cell expressing a transmembrane
- immunomodulatory protein and/or chimeric antigen receptor which in some cases involves engineering a T-cell or TIL (tumor infiltrating lymphocyte).
- TIL tumor infiltrating lymphocyte
- the engineered cells are then infused into a patient from which the native T-cell was isolated.
- the organism is human or murine.
- binding affinity and “binding avidity” as used herein means the specific binding affinity and specific binding avidity, respectively, of a protein for its counter- structure under specific binding conditions.
- avidity refers to the accumulated strength of multiple affinities of individual non-covalent binding interactions, such as between ICOSL and its counter-structures ICOS and/or CD28. As such, avidity is distinct from affinity, which describes the strength of a single interaction.
- An increase or attenuation in binding affinity of a variant ICOSL containing an affinity modified ICOSL IgSF domain to its counter-structure is determined relative to the binding affinity of the unmodified ICOSL, such as an unmodified ICOSL containing the native or wild-type IgSF domain, such as IgV domain.
- Methods for determining binding affinity or avidity are known in art. See, for example, Larsen et al.,
- a variant ICOSL of the invention i.e. a ICOSL protein containing an affinity modified IgSF domain
- a variant ICOSL of the invention specifically binds to CD28 and/or ICOS measured by flow cytometry with a binding affinity that yields a Mean Fluorescence Intensity (MFI) value at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% greater than a wild-type ICOSL control in a binding assay such as described in Example 6.
- MFI Mean Fluorescence Intensity
- biological half-life refers to the amount of time it takes for a substance, such as an immunomodulatory polypeptide comprising a variant ICOSL of the present invention, to lose half of its pharmacologic or physiologic activity or concentration.
- Biological half-life can be affected by elimination, excretion, degradation (e.g., enzymatic) of the substance, or absorption and concentration in certain organs or tissues of the body.
- biological half-life can be assessed by determining the time it takes for the blood plasma concentration of the substance to reach half its steady state level (“plasma half-life").
- Conjugates that can be used to derivatize and increase the biological half-life of polypeptides of the invention are known in the art and include, but are not limited to, polyethylene glycol (PEG), hydroxyethyl starch (HES), XTEN (extended recombinant peptides; see, WO2013130683), human serum albumin (HSA), bovine serum albumin (BSA), lipids (acylation), and poly-Pro-Ala-Ser (PAS), polyglutamic acid (glutamylation).
- PEG polyethylene glycol
- HES hydroxyethyl starch
- XTEN extended recombinant peptides
- HSA human serum albumin
- BSA bovine serum albumin
- lipids acylation
- PAS poly-Pro-Ala-Ser
- chimeric antigen receptor or "CAR” as used herein refers to an artificial (i.e., man-made) transmembrane protein expressed on a mammalian cell comprising at least an ectodomain, a transmembrane, and an endodomain.
- the CAR protein includes a "spacer" which covalently links the ectodomain to the transmembrane domain.
- a spacer is often a polypeptide linking the ectodomain to the transmembrane domain via peptide bonds.
- the CAR is typically expressed on a mammalian lymphocyte.
- the CAR is expressed on a mammalian cell such as a T-cell or a tumor infiltrating lymphocyte (TIL).
- TIL tumor infiltrating lymphocyte
- a CAR expressed on a T-cell is referred to herein as a "CAR T-cell” or "CAR-T.”
- the CAR-T is a T helper cell, a cytotoxic T-cell, a natural killer T-cell, a memory T-cell, a regulatory T-cell, or a gamma delta T-cell.
- a CAR-T with antigen binding specificity to the patient's tumor is typically engineered to express on a native T-cell obtained from the patient.
- the engineered T-cell expressing the CAR is then infused back into the patient.
- the CAR-T is thus often an autologous CAR-T although allogeneic CAR-T are included within the scope of the invention.
- the ectodomain of a CAR comprises an antigen binding region, such as an antibody or antigen binding fragment thereof (e.g. scFv), that specifically binds under physiological conditions with a target antigen, such as a tumor specific antigen.
- a biochemical chain of events i.e., signal transduction results in modulation of the immunological activity of the CAR-T.
- CD3-z CD3-zeta chain
- IBB immunoreceptor tyrosine -based activation motif
- the term "collectively” or “collective” when used in reference to cytokine production induced by the presence of two or more variant ICOSL of the invention in an in vitro assay, means the overall cytokine expression level irrespective of the cytokine production induced by individual variant ICOSL.
- the cytokine being assayed is IFN-gamma in an in vitro primary T-cell assay such as described in Example 6 and Example 7.
- cognate binding partner in reference to a polypeptide, such as in reference to an IgSF domain of a variant ICOSL, refers to at least one molecule (typically a native mammalian protein) to which the referenced polypeptide specifically binds under specific binding conditions.
- a variant ICOSL containing an affinity modified IgSF domain specifically binds to the counter- structure of the corresponding native or wild-type ICOSL but with increased or attenuated affinity.
- a species of ligand recognized and specifically binding to its cognate receptor under specific binding conditions is an example of a counter-structure or cognate binding partner of that receptor.
- a "cognate cell surface binding partner” is a cognate binding partner expressed on a mammalian cell surface.
- a "cell surface molecular species” is a cognate binding partner of ligands of the immunological synapse (IS), expressed on and by cells, such as mammalian cells, forming the immunological synapse.
- conjugate refers the joining or linking together of two or more compounds resulting in the formation of another compound, by any joining or linking methods known in the art. It can also refer to a compound which is generated by the joining or linking together two or more compounds.
- a variant ICOSL polypeptide linked directly or indirectly to one or more chemical moieties or polypeptide is an exemplary conjugate.
- conjugates include fusion proteins, those produced by chemical conjugates and those produced by any other methods.
- competitive binding means that a protein is capable of specifically binding to at least two cognate binding partners but that specific binding of one cognate binding partner inhibits, such as prevents or precludes, simultaneous binding of the second cognate binding partner. Thus, in some cases, it is not possible for a protein to bind the two cognate binding partners at the same time. Generally, competitive binders contain the same or overlapping binding site for specific binding but this is not a requirement. In some embodiments, competitive binding causes a measurable inhibition (partial or complete) of specific binding of a protein to one of its cognate binding partner due to specific binding of a second cognate binding partner. A variety of methods are known to quantify competitive binding such as ELISA (enzyme linked immunosorbent assay) assays.
- ELISA enzyme linked immunosorbent assay
- the term "conservative amino acid substitution” as used herein means an amino acid substitution in which an amino acid residue is substituted by another amino acid residue having a side chain R group with similar chemical properties (e.g., charge or hydrophobicity).
- groups of amino acids that have side chains with similar chemical properties include 1) aliphatic side chains: glycine, alanine, valine, leucine, and isoleucine; 2) aliphatic-hydroxyl side chains: serine and threonine; 3) amide-containing side chains: asparagine and glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; 5) basic side chains: lysine, arginine, and histidine; 6) acidic side chains: aspartic acid and glutamic acid; and 7) sulfur- containing side chains: cysteine and methionine.
- Conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamate- aspartate, and asparagine-glutamine.
- corresponding to with reference to positions of a protein, such as recitation that nucleotides or amino acid positions "correspond to" nucleotides or amino acid positions in a disclosed sequence, such as set forth in the Sequence listing, refers to nucleotides or amino acid positions identified upon alignment with the disclosed sequence based on structural sequence alignment or using a standard alignment algorithm, such as the GAP algorithm.
- corresponding residues can be determined by alignment of a reference sequence with the sequence set forth in SEQ ID NO: 32 (ECD domain) or set forth in SEQ ID NOs: 196 or 545 (IgV domain) by structural alignment methods as described herein. By aligning the sequences, one skilled in the art can identify corresponding residues, for example, using conserved and identical amino acid residues as guides.
- the terms “decrease” or “attenuate” “or suppress” as used herein means to decrease by a statistically significant amount.
- a decrease can be at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% of a control value, such as a non-zero control value.
- the terms "decreased” or “reduced” as used herein in the context of decreasing immunological activity of a mammalian lymphocyte means to decrease one or more activities of the lymphocyte, as compared to a control, such as an untreated control or a control in which a treatment using an unmodified or non-variant control was employed under the same conditions.
- a decreased activity can refer to one or more of cell cycle inhibition, reduced cell survival, reduced cell proliferation, reduced cytokine production, or reduced T-cell cytotoxicity, such as by a statistically significant amount.
- reference to reduced immunological activity means to reduce interferon gamma (IFN-gamma) production compared to in the absence of treatment, such as by a statistically significant amount.
- IFN-gamma interferon gamma
- an enhancement can be a decrease by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%, as compared to a control value, such as an untreated control value or a non-zero control value.
- derivatives or “derivatized” refer to modification of a protein by covalently linking it, directly or indirectly, to a composition so as to alter such characteristics as biological half-life, bioavailability, immunogenicity, solubility, toxicity, potency, or efficacy while retaining or enhancing its therapeutic benefit.
- Derivatives of immunomodulatory polypeptides of the invention are within the scope of the invention and can be made by, for example, glycosylation, pegylation, lipidation, or Fc-fusion.
- domain refers to a portion of a molecule, such as a protein or encoding nucleic acid, that is structurally and/or functionally distinct from other portions of the molecule and is identifiable.
- domains include those portions of a polypeptide chain that can form an independently folded structure within a protein made up of one or more structural motifs and/or that is recognized by virtue of a functional activity, such as binding activity.
- a protein can have one, or more than one, distinct domains.
- a domain can be identified, defined or distinguished by homology of the primary sequence or structure to related family members, such as homology to motifs.
- a domain can be distinguished by its function, such as an ability to interact with a biomolecule, such as a cognate binding partner.
- a domain independently can exhibit a biological function or activity such that the domain independently or fused to another molecule can perform an activity, such as, for example binding.
- a domain can be a linear sequence of amino acids or a non-linear sequence of amino acids.
- Many polypeptides contain a plurality of domains. Such domains are known, and can be identified by those of skill in the art. For exemplification herein, definitions are provided, but it is understood that it is well within the skill in the art to recognize particular domains by name. If needed appropriate software can be employed to identify domains.
- ectodomain refers to the region of a membrane protein, such as a transmembrane protein, that lies outside the vesicular membrane. Ectodomains often comprise binding domains that specifically bind to ligands or cell surface receptors, such as via a binding domain that specifically binds to the ligand or cell surface receptor.
- the ectodomain of a cellular transmembrane protein is alternately referred to as an extracellular domain.
- an effective amount refers to a quantity and/or concentration of a therapeutic composition of the invention, including a protein composition or cell composition, that when administered ex vivo (by contact with a cell from a patient) or in vivo (by administration into a patient) either alone (i.e., as a monotherapy) or in combination with additional therapeutic agents, yields a statistically significant decrease in disease progression as, for example, by ameliorating or eliminating symptoms and/or the cause of the disease.
- An effective amount may be an amount that relieves, lessens, or alleviates at least one symptom or biological response or effect associated with a disease or disorder, prevents progression of the disease or disorder, or improves physical functioning of the patient.
- the effective amount is an effective dose or number of cells administered to a patient by adoptive cell therapy.
- the patient is a mammal such as a non- human primate or human patient.
- endodomain refers to the region found in some membrane proteins, such as transmembrane proteins, that extends into the interior space defined by the cell surface membrane.
- the endodomain In mammalian cells, the endodomain is the cytoplasmic region of the membrane protein. In cells, the endodomain interacts with intracellular constituents and can be play a role in signal transduction and thus, in some cases, can be an intracellular signaling domain.
- the endodomain of a cellular transmembrane protein is alternately referred to as a cytoplasmic domain, which, in some cases, can be a cytoplasmic signaling domain.
- the terms "enhanced” or “increased” as used herein in the context of increasing immunological activity of a mammalian lymphocyte means to increase one or more activities the lymphocyte, as compared to a control, such as an untreated control or a control in which a treatment using an unmodified or non-variant control was employed under the same conditions.
- An increased activity can be one or more of increase cell survival, cell proliferation, cytokine production, or T-cell cytotoxicity, such as by a statistically significant amount.
- reference to increased immunological activity means to increase interferon gamma (IFN-gamma) production, such as by a statistically significant amount.
- the immunological activity can be assessed in a mixed lymphocyte reaction (MLR) assay.
- MLR mixed lymphocyte reaction
- an enhancement can be an increase of at least 10%, 20%, 30%, 40%, 50%, 75%, 100%, 200%, 300%, 400%, or 500% greater than a non-zero control value.
- engineered cell refers to a mammalian cell that has been genetically modified by human intervention such as by recombinant DNA methods or viral transduction.
- the cell is an immune cell, such as a lymphocyte (e.g. T cell, B cell, NK cell) or an antigen presenting cell (e.g. dendritic cell).
- the cell can be a primary cell from a patient or can be a cell line.
- an engineered cell of the invention comprises a variant ICOSL provided herein.
- the variant ICOSL is a transmembrane immunomodulatory protein (hereinafter referred to as "TIP”) that is expressed on the engineered cell.
- TIP transmembrane immunomodulatory protein
- the TIP contains the extracellular domain or a portion thereof containing the IgV domain linked to a transmembrane domain (e.g., a ICOSL transmembrane domain) and, optionally, an intracellular signaling domain.
- the TIP is formatted as a chimeric receptor containing a heterologous cytoplasmic signaling domain or endodomain.
- an engineered cell is capable of expressing and secreting a immunomodulatory protein as described herein.
- provided engineered cells also are cells further containing an engineered T-cell receptor (TCR) or chimeric antigen receptor (CAR).
- engineered T-cell refers to a T-cell such as a T helper cell, cytotoxic T-cell (alternatively, cytotoxic T lymphocyte or CTL), natural killer T-cell, regulatory T-cell, memory T-cell, or gamma delta T-cell, that has been genetically modified by human intervention such as by recombinant DNA methods or viral transduction methods.
- An engineered T-cell comprises a variant ICOSL transmembrane immunomodulatory protein (TIP) or secreted immunodulatory protein (SIP) of the present invention that is expressed on the T-cell and is engineered to modulate immunological activity of the engineered T-cell itself, or a mammalian cell to which the variant ICOSL expressed on the T-cell specifically binds.
- An engineered T-cell can comprise a variant ICOSL secreted immunomodulatory protein (SIP) of the present invention that is expressed by and/or secreted by the T-cell and is engineered to modulate immunological activity of the engineered T-cell itself, or a mammalian cell to which the variant ICOSL when secreted by the T-cell, specifically binds.
- engineered T-cell receptor refers to a T-cell receptor (TCR) engineered to specifically bind with a desired affinity to a major histocompatibility complex (MHC)/peptide target antigen that is selected, cloned, and/or subsequently introduced into a population of T-cells, often used for adoptive immunotherapy.
- MHC major histocompatibility complex
- CARs are engineered to bind target antigens in a MHC independent manner.
- the term "expressed on” as used herein is used in reference to a protein expressed on the surface of a cell, such as a mammalian cell.
- the protein is expressed as a membrane protein.
- the expressed protein is a transmembrane protein.
- the protein is conjugated to a small molecule moiety such as a drug or detectable label.
- Proteins expressed on the surface of a cell can include cell-surface proteins such as cell surface receptors that are expressed on mammalian cells.
- half-life extending moiety refers to a moiety of a polypeptide fusion or chemical conjugate that extends the half-life of a protein circulating in mammalian blood serum compared to the half-life of the protein that is not so conjugated to the moiety. In some embodiments, half-life is extended by greater than or greater than about 1.2-fold, 1.5-fold, 2.0- fold, 3.0-fold, 4.0-fold, 5.0-fold, or 6.0-fold. In some embodiments, half-life is extended by more than 6 hours, more than 12 hours, more than 24 hours, more than 48 hours, more than 72 hours, more than 96 hours or more than 1 week after in vivo administration compared to the protein without the half-life extending moiety.
- the half-life refers to the amount of time it takes for the protein to lose half of its concentration, amount, or activity.
- Half-life can be determined for example, by using an ELISA assay or an activity assay.
- Exemplary half-life extending moieties include an Fc domain, a multimerization domain, polyethylene glycol (PEG), hydroxyethyl starch (HES), XTEN (extended recombinant peptides; see, WO2013130683), human serum albumin (HSA), bovine serum albumin (BSA), lipids (acylation), and poly-Pro-Ala-Ser (PAS), and polyglutamic acid (glutamylation).
- immunological synapse or “immune synapse” as used herein means the interface between a mammalian cell that expresses MHC I (major histocompatibility complex) or MHC II, such as an antigen-presenting cell or tumor cell, and a mammalian lymphocyte such as an effector T cell or Natural Killer (NK) cell.
- MHC I major histocompatibility complex
- MHC II such as an antigen-presenting cell or tumor cell
- a mammalian lymphocyte such as an effector T cell or Natural Killer (NK) cell.
- NK Natural Killer
- Fc fragment crystallizable region or domain of an immunoglobulin molecule (also termed an Fc polypeptide) corresponds largely to the constant region of the immunoglobulin molecule
- the Fc domain contains part or all of a hinge domain of an immunoglobulin molecule plus a CH2 and a CH3 domain.
- the Fc domain can form a dimer of two polypeptide chains joined by one or more disulfide bonds.
- the Fc is a variant Fc that exhibits reduced (e.g. reduced greater than 30%, 40%, 50%, 60%, 70%, 80%, 90% or more) activity to facilitate an effector function.
- reference to amino acid substitutions in an Fc region is by EU numbering system unless described with reference to a specific SEQ ID NO.
- EU numbering is known and is according to the most recently updated IMGT Scientific Chart (IMGT®, the international ImMunoGeneTics information system® http://www.imgt.org/IMGTScientificChart/Numbering/Hu_IGHGnber.html (created: 17 May 2001, last updated: 10 Jan 2013) and the EU index as reported in Kabat, E.A. et al. Sequences of Proteins of Immunological interest. 5th ed. US Department of Health and Human Services, NIH publication No. 91-3242 (1991).
- An immunoglobulin Fc fusion such as an immunomodulatory Fc fusion protein, is a molecule comprising one or more polypeptides (or one or more small molecules) operably linked to an Fc region of an immunoglobulin.
- An Fc-fusion may comprise, for example, the Fc region of an antibody (which facilitates effector functions and pharmacokinetics) and a variant ICOSL.
- An immunoglobulin Fc region may be linked indirectly or directly to one or more variant ICOSL or small molecules (fusion partners).
- Various linkers are known in the art and can optionally be used to link an Fc to a fusion partner to generate an Fc-fusion.
- Fc-fusions of identical species can be dimerized to form Fc-fusion homodimers, or using non-identical species to form Fc-fusion heterodimers.
- the Fc is a mammalian Fc such as a murine or human Fc.
- the term "host cell” refers to a cell that can be used to express a protein encoded by a recombinant expression vector.
- a host cell can be a prokaryote, for example, E. coli, or it can be a eukaryote, for example, a single-celled eukaryote (e.g., a yeast or other fungus), a plant cell (e.g., a tobacco or tomato plant cell), an animal cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell) or a hybridoma.
- host cells examples include Chinese hamster ovary (CHO) cells or their derivatives such as Veggie CHO and related cell lines which grow in serum- free media or CHO strain DX-B 11, which is deficient in DHFR.
- a host cell is a mammalian cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell).
- immunoglobulin refers to a mammalian immunoglobulin protein including any of the five human classes of antibody: IgA (which includes subclasses IgAl and IgA2), IgD, IgE, IgG (which includes subclasses IgGl, IgG2, IgG3, and IgG4), and IgM.
- immunoglobulins that are less than full- length, whether wholly or partially synthetic (e.g., recombinant or chemical synthesis) or naturally produced, such as antigen binding fragment (Fab), variable fragment (Fv) containing V H and V L , the single chain variable fragment (scFv) containing V H and V L linked together in one chain, as well as other antibody V region fragments, such as Fab', F(ab) 2 , F(ab') 2 , dsFv diabody, Fc, and Fd polypeptide fragments.
- Fab', F(ab) 2 , F(ab') 2 , dsFv diabody, Fc, and Fd polypeptide fragments bispecific antibodies, homobispecific and heterobispecific, are included within the meaning of the term.
- immunoglobulin superfamily or "IgSF” as used herein means the group of cell surface and soluble proteins that are involved in the recognition, binding, or adhesion processes of cells. Molecules are categorized as members of this superfamily based on shared structural features with immunoglobulins (i.e., antibodies); they all possess a domain known as an immunoglobulin domain or fold. Members of the IgSF include cell surface antigen receptors, co-receptors and co-stimulatory molecules of the immune system, molecules involved in antigen presentation to lymphocytes, cell adhesion molecules, certain cytokine receptors and intracellular muscle proteins. They are commonly associated with roles in the immune system. Proteins in the immunological synapse are often members of the IgSF. IgSF can also be classified into
- subfamilies based on shared properties such as function. Such subfamilies typically consist of from 4 to 30 IgSF members.
- IgSF domain or "immunoglobulin domain” or “Ig domain” as used herein refers to a structural domain of IgSF proteins. Ig domains are named after the
- immunoglobulin molecules contain about 70-110 amino acids and are categorized according to their size and function.
- Ig-domains possess a characteristic Ig-fold, which has a sandwich-like structure formed by two sheets of antiparallel beta strands. Interactions between hydrophobic amino acids on the inner side of the sandwich and highly conserved disulfide bonds formed between cysteine residues in the B and F strands, stabilize the Ig-fold.
- One end of the Ig domain has a section called the complementarity determining region that is important for the specificity of antibodies for their ligands.
- the Ig like domains can be classified (into classes) as: IgV, IgCl, IgC2, or Igl.
- Ig domains are either variable (IgV) or constant (IgC). IgV domains with 9 beta strands are generally longer than IgC domains with 7 beta strands. Ig domains of some members of the IgSF resemble IgV domains in the amino acid sequence, yet are similar in size to IgC domains. These are called IgC2 domains, while standard IgC domains are called IgCl domains. T-cell receptor (TCR) chains contain two Ig domains in the extracellular portion; one IgV domain at the N-terminus and one IgCl domain adjacent to the cell membrane. ICOSL contains two Ig domains: IgV and IgC.
- TCR T-cell receptor
- IgSF species as used herein means an ensemble of IgSF member proteins with identical or substantially identical primary amino acid sequence.
- Each mammalian immunoglobulin superfamily (IgSF) member defines a unique identity of all IgSF species that belong to that IgSF member.
- each IgSF family member is unique from other IgSF family members and, accordingly, each species of a particular IgSF family member is unique from the species of another IgSF family member. Nevertheless, variation between molecules that are of the same IgSF species may occur owing to differences in post-translational modification such as glycosylation, phosphorylation, ubiquitination, nitrosylation, methylation, acetylation, and lipidation.
- a "cell surface IgSF species” is an IgSF species expressed on the surface of a cell, generally a mammalian cell.
- immunological activity refers to one or more cell survival, cell proliferation, cytokine production (e.g. interferon-gamma), or T-cell cytotoxicity activities.
- an immunological activity can mean the cell expression of cytokines, such as chemokines or interleukins.
- Assays for determining enhancement or suppression of immunological activity include the MLR (mixed lymphocyte reaction) assays measuring interferon-gamma cytokine levels in culture supernatants (Wang et al., Cancer Immunol Res.
- An immunomodulatory protein such as a variant ICOSL polypeptide containing an affinity modified IgSF domain, as provided herein can in some embodiments increase or, in alternative embodiments, decrease IFN-gamma (interferon-gamma) expression in a primary T-cell assay relative to a wild-type IgSF member or IgSF domain control.
- IFN-gamma interferon-gamma
- MLR Mixed Lymphocyte Reaction
- a soluble form of an affinity modified IgSF domain of the invention can be employed to determine its ability to antagonize and thereby decrease the IFN-gamma expression in a MLR as likewise described in Example 6.
- a co-immobilization assay can be used in assaying for the ability of an immunomodulatory protein or affinity modified IgSF domain of the invention to increase IFN- gamma expression in a primary T-cell assay.
- a T-cell receptor signal in some embodiments by anti-CD3 antibody, is used in conjunction with a co-immobilized affinity modified IgSF domain, such as variant ICOSL, to determine the ability to increase IFN-gamma expression relative to a wild-type IgSF domain control.
- a co-immobilized affinity modified IgSF domain such as variant ICOSL
- Methods to assay the immunological activity of engineered cells including to evaluate the activity of a variant ICOSL transmembrane immunomodulatory protein, are known in the art and include, but are not limited to, the ability to expand T cells following antigen stimulation, sustain T cell expansion in the absence of re- stimulation, and anti-cancer activities in appropriate animal models.
- Assays also include assays to assess cytotoxicity, including a standard 51 Cr-release assay (see e.g. Milone et al., (2009) Molecular Therapy 17: 1453-1464) or flow based cytotoxicity assays, or an impedance based cytotoxicity assay (Peper et al. (2014) Journal of Immunological Methods, 405: 192-198).
- assays to assess cytotoxicity including a standard 51 Cr-release assay (see e.g. Milone et al., (2009) Molecular Therapy 17: 1453-1464) or flow based cytotoxicity assays, or an impedance based cytotoxicity assay (Peper et al. (2014) Journal of Immunological Methods, 405: 192-198).
- an "immunomodulatory polypeptide” or “immunomodulatory protein” is a polypeptide or protein molecule that modulates immunological activity. By “modulation” or “modulating” an immune response is meant that immunological activity is either increased or decreased.
- An immunomodulatory protein can be a single polypeptide chain or a multimer (dimers or higher order multimers) of at least two polypeptide chains covalently bonded to each other by, for example, interchain disulfide bonds. Thus, monomeric, dimeric, and higher order multimeric polypeptides are within the scope of the defined term. Multimeric polypeptides can be homomultimeric (of identical polypeptide chains) or heteromultimeric (of non-identical polypeptide chains).
- An immunomodulatory protein of the invention comprises a variant ICOSL.
- the term "increase” as used herein means to increase by a statistically significant amount. An increase can be at least 5%, 10%, 20%, 30%, 40%, 50%, 75%, 100%, or greater than a non-zero control value.
- an "isoform" of ICOSL is one of a plurality of naturally occurring ICOSL polypeptides that differ in amino acid sequence. Isoforms can be the product of splice variants of an RNA transcript expressed by a single gene, or the expression product of highly similar but different genes yielding a functionally similar protein such as may occur from gene duplication. As used herein, the term “isoform” of ICOSL also refers to the product of different alleles of an ICOSL gene (e.g., ICOSLG).
- lymphocyte means any of three subtypes of white blood cell in a mammalian immune system. They include natural killer cells (NK cells) (which function in cell-mediated, cytotoxic innate immunity), T cells (for cell-mediated, cytotoxic adaptive immunity), and B cells (for humoral, antibody-driven adaptive immunity). T cells include: T helper cells, cytotoxic T-cells, natural killer T-cells, memory T-cells, regulatory T- cells, or gamma delta T-cells. Innate lymphoid cells (ILC) are also included within the definition of lymphocyte.
- NK cells natural killer cells
- T cells for cell-mediated, cytotoxic adaptive immunity
- B cells for humoral, antibody-driven adaptive immunity
- T cells include: T helper cells, cytotoxic T-cells, natural killer T-cells, memory T-cells, regulatory T- cells, or gamma delta T-cells.
- ILC Innate lymphoid cells
- mammal or “patient” specifically includes reference to at least one of a: human, chimpanzee, rhesus monkey, cynomolgus monkey, dog, cat, mouse, or rat.
- membrane protein as used herein means a protein that, under
- a lipid bilayer that forms a membrane can be a biological membrane such as a eukaryotic (e.g., mammalian) cell membrane or an artificial (i.e., man-made) membrane such as that found on a liposome.
- a biological membrane such as a eukaryotic (e.g., mammalian) cell membrane or an artificial (i.e., man-made) membrane such as that found on a liposome.
- Attachment of a membrane protein to the lipid bilayer can be by way of covalent attachment, or by way of non-covalent interactions such as hydrophobic or electrostatic interactions.
- a membrane protein can be an integral membrane protein or a peripheral membrane protein.
- Membrane proteins that are peripheral membrane proteins are non-covalently attached to the lipid bilayer or non-covalently attached to an integral membrane protein.
- a peripheral membrane protein forms a temporary attachment to the lipid bilayer such that under the range of conditions that are physiological in a mammal, peripheral membrane protein can associate and/or disassociate from the lipid bilayer.
- integral membrane proteins form a substantially permanent attachment to the membrane's lipid bilayer such that under the range of conditions that are physiological in a mammal, integral membrane proteins do not disassociate from their attachment to the lipid bilayer.
- a membrane protein can form an attachment to the membrane by way of one layer of the lipid bilayer (monotopic), or attached by way of both layers of the membrane (polytopic).
- An integral membrane protein that interacts with only one lipid bilayer is an "integral monotopic protein".
- An integral membrane protein that interacts with both lipid bilayers is an "integral polytopic protein” alternatively referred to herein as a "transmembrane protein”.
- modulating or “modulate” as used herein in the context of an immune response, such as a mammalian immune response, refer to any alteration, such as an increase or a decrease, of existing or potential immune responses that occurs as a result of administration of an immunomodulatory polypeptide comprising a variant ICOSL of the present invention or as a result of administration of engineered cells expresses an immunomodulatory protein, such as a variant ICOSL transmembrane immunomodulatory protein of the present invention.
- an alteration such as an increase or decrease, of an immune response as compared to the immune response that occurs or is present in the absence of the administration of the immunomodulatory protein comprising the variant ICOSL or cells expressing such an immunomodulatory polypeptide.
- modulation includes any induction, activation, suppression or alteration in degree or extent of immunological activity of an immune cell.
- Immune cells include B cells, T cells, NK (natural killer) cells, NK T cells, professional antigen- presenting cells (APCs), and non-professional antigen-presenting cells, and inflammatory cells (neutrophils, macrophages, monocytes, eosinophils, and basophils).
- Modulation includes any change imparted on an existing immune response, a developing immune response, a potential immune response, or the capacity to induce, regulate, influence, or respond to an immune response. Modulation includes any alteration in the expression and/or function of genes, proteins and/or other molecules in immune cells as part of an immune response.
- Modulation of an immune response or modulation of immunological activity includes, for example, the following: elimination, deletion, or sequestration of immune cells; induction or generation of immune cells that can modulate the functional capacity of other cells such as autoreactive lymphocytes, antigen presenting cells, or inflammatory cells; induction of an unresponsive state in immune cells (i.e., anergy); enhancing or suppressing the activity or function of immune cells, including but not limited to altering the pattern of proteins expressed by these cells. Examples include altered production and/or secretion of certain classes of molecules such as cytokines, chemokines, growth factors, transcription factors, kinases, costimulatory molecules, or other cell surface receptors or any combination of these modulatory events.
- Modulation can be assessed, for example, by an alteration in IFN-gamma (interferon gamma) expression relative to the wild-type ICOSL control in a primary T cell assay (see, Zhao and Ji, Exp Cell Res. 2016 Janl; 340(1) 132- 138). Modulation can be assessed, for example, by an alteration of an immunological activity of engineered cells, such as an alteration in in cytotoxic activity of engineered cells or an alteration in cytokine secretion of engineered cells relative to cells engineered with a wild-type ICOSL transmembrane protein.
- molecular species as used herein means an ensemble of proteins with identical or substantially identical primary amino acid sequence.
- immunoglobulin superfamily (IgSF) member defines a collection of identical or substantially identical molecular species.
- human ICOSL is an IgSF member and each human ICOSL molecule is a molecule species of ICOS. Variation between molecules that are of the same molecular species may occur owing to differences in post-translational modification such as glycosylation, phosphorylation, ubiquitination, nitrosylation, methylation, acetylation, and lipidation.
- a "cell surface molecular species” is a molecular species expressed on the surface of a mammalian cell. Two or more different species of protein, each of which is present exclusively on one or exclusively the other (but not both) of the two mammalian cells forming the IS, are said to be in "cis” or "cis configuration" with each other.
- Two different species of protein are said to be in "trans" or "trans configuration."
- Two different species of protein each of which is present on both of the two mammalian cells forming the IS are in both cis and trans configurations on these cells.
- a "multimerization domain” refers to a sequence of amino acids that promotes stable interaction of a polypeptide molecule with one or more additional polypeptide molecules, each containing a complementary multimerization domain (e.g. a first
- multimerization domain and a second multimerization domain which can be the same or a different multimerization domain.
- the interactions between complementary multimerization domains e.g. interaction between a first multimerization domain and a second multimerization domain, form a stable protein-protein interaction to produce a multimer of the polypeptide molecule with the additional polypeptide molecule.
- the multimerization domain is the same and interacts with itself to form a stable protein-protein interaction between two polypeptide chains.
- a polypeptide is joined directly or indirectly to the
- multimerization domains include the immunoglobulin sequences or portions thereof, leucine zippers, hydrophobic regions, hydrophilic regions, and compatible protein-protein interaction domains.
- the multimerization domain can be an immunoglobulin constant region or domain, such as, for example, the Fc domain or portions thereof from IgG, including IgGl, IgG2, IgG3 or IgG4 subtypes, IgA, IgE, IgD and IgM and modified forms thereof.
- nucleic acid and “polynucleotide” are used interchangeably to refer to a polymer of nucleic acid residues (e.g., deoxyribonucleotides or ribonucleotides) in either single- or double-stranded form. Unless specifically limited, the terms encompass nucleic acids containing known analogues of natural nucleotides and that have similar binding properties to it and are metabolized in a manner similar to naturally-occurring nucleotides.
- nucleic acid or polynucleotide encompasses cDNA or mRNA encoded by a gene.
- non-competitive binding means the ability of a protein to specifically bind simultaneously to at least two cognate binding partners.
- the protein is able to bind to at least two different cognate binding partners at the same time, although the binding interaction need not be for the same duration such that, in some cases, the protein is specifically bound to only one of the cognate binding partners.
- the binding occurs under specific binding conditions.
- the simultaneous binding is such that binding of one cognate binding partner does not substantially inhibit simultaneous binding to a second cognate binding partner.
- noncompetitive binding means that binding a second cognate binding partner to its binding site on the protein does not displace the binding of a first cognate binding partner to its binding site on the protein.
- the first cognate binding partner specifically binds at an interaction site that does not overlap with the interaction site of the second cognate binding partner such that binding of the second cognate binding partner does not directly interfere with the binding of the first cognate binding partner.
- any effect on binding of the cognate binding partner by the binding of the second cognate binding partner is through a mechanism other than direct interference with the binding of the first cognate binding partner.
- a non-competitive inhibitor binds to a site other than the active site of the enzyme.
- Non-competitive binding encompasses uncompetitive binding interactions in which a second cognate binding partner specifically binds at an interaction site that does not overlap with the binding of the first cognate binding partner but binds to the second interaction site only when the first interaction site is occupied by the first cognate binding partner.
- pharmaceutical composition refers to a composition suitable for pharmaceutical use in a mammalian subject, often a human.
- a pharmaceutical composition typically comprises an effective amount of an active agent (e.g., an immunomodulatory polypeptide comprising a variant ICOSL or engineered cells expressing a variant ICOSL transmembrane immunomodulatory protein) and a carrier, excipient, or diluent.
- an active agent e.g., an immunomodulatory polypeptide comprising a variant ICOSL or engineered cells expressing a variant ICOSL transmembrane immunomodulatory protein
- the carrier, excipient, or diluent is typically a pharmaceutically acceptable carrier, excipient or diluent, respectively.
- polypeptide and “protein” are used interchangeably herein and refer to a molecular chain of two or more amino acids linked through peptide bonds. The terms do not refer to a specific length of the product. Thus, “peptides,” and “oligopeptides,” are included within the definition of polypeptide.
- the terms include post-translational modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like.
- the terms also include molecules in which one or more amino acid analogs or non-canonical or unnatural amino acids are included as can be synthesized, or expressed recombinantly using known protein engineering techniques. In addition, proteins can be derivatized.
- primary T-cell assay refers to an in vitro assay to measure interferon-gamma ("IFN-gamma") expression.
- IFN-gamma interferon-gamma
- the assay used is an anti-CD3 coimmobilizaton assay.
- primary T cells are stimulated by anti-CD3 immobilized with or without additional recombinant proteins.
- Culture supernatants are harvested at timepoints, usually 24-72 hours.
- the assay used is the MLR.
- primary T cells are stimulated with allogeneic APC. Culture supernatants are harvested at timepoints, usually 24-72 hours. Human IFN-gamma levels are measured in culture supernatants by standard ELISA techniques. Commercial kits are available from vendors and the assay is performed according to manufacturer's recommendation.
- nucleic acids such as encoding immunomodulatory proteins of the invention
- purified as applied to nucleic acids, such as encoding immunomodulatory proteins of the invention, generally denotes a nucleic acid or polypeptide that is substantially free from other components as determined by analytical techniques well known in the art (e.g., a purified polypeptide or polynucleotide forms a discrete band in an electrophoretic gel, chromatographic eluate, and/or a media subjected to density gradient centrifugation).
- nucleic acid or polypeptide that gives rise to essentially one band in an electrophoretic gel is "purified.”
- a purified nucleic acid or protein of the invention is at least about 50% pure, usually at least about 75%, 80%, 85%, 90%, 95%, 96%, 99% or more pure (e.g., percent by weight or on a molar basis).
- recombinant indicates that the material (e.g., a nucleic acid or a polypeptide) has been artificially (i.e., non-naturally) altered by human intervention. The alteration can be performed on the material within, or removed from, its natural environment or state.
- a “recombinant nucleic acid” is one that is made by recombining nucleic acids, e.g., during cloning, affinity modification, DNA shuffling or other well-known molecular biological procedures.
- a “recombinant DNA molecule,” is comprised of segments of DNA joined together by means of such molecular biological techniques.
- recombinant protein or “recombinant polypeptide” as used herein refers to a protein molecule which is expressed using a recombinant DNA molecule.
- a "recombinant host cell” is a cell that contains and/or expresses a recombinant nucleic acid or that is otherwise altered by genetic engineering, such as by introducing into the cell a nucleic acid molecule encoding a recombinant protein, such as a transmembrane immunomodulatory protein provided herein.
- Transcriptional control signals in eukaryotes comprise "promoter” and “enhancer” elements. Promoters and enhancers consist of short arrays of DNA sequences that interact specifically with cellular proteins involved in transcription.
- Promoter and enhancer elements have been isolated from a variety of eukaryotic sources including genes in yeast, insect and mammalian cells and viruses (analogous control elements, i.e., promoters, are also found in prokaryotes). The selection of a particular promoter and enhancer depends on what cell type is to be used to express the protein of interest.
- the terms "in operable combination,” “in operable order” and “operably linked” as used herein refer to the linkage of nucleic acid sequences in such a manner or orientation that a nucleic acid molecule capable of directing the transcription of a given gene and/or the synthesis of a desired protein molecule is produced.
- recombinant expression vector refers to a DNA molecule containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host cell.
- Nucleic acid sequences necessary for expression in prokaryotes include a promoter, optionally an operator sequence, a ribosome binding site and possibly other sequences.
- Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
- a secretory signal peptide sequence can also, optionally, be encoded by the recombinant expression vector, operably linked to the coding sequence for the recombinant protein, such as a recombinant fusion protein, so that the expressed fusion protein can be secreted by the recombinant host cell, for easier isolation of the fusion protein from the cell, if desired.
- the term includes the vector as a self -replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- the vectors are viral vectors, such as lentiviral vectors.
- selectivity refers to the preference of a subject protein, or polypeptide, for specific binding of one substrate, such as one cognate binding partner, compared to specific binding for another substrate, such as a different cognate binding partner of the subject protein. Selectivity can be reflected as a ratio of the binding activity (e.g. binding affinity) of a subject protein and a first substrate, such as a first cognate binding partner, (e.g., K d i) and the binding activity (e.g. binding affinity) of the same subject protein with a second cognate binding partner (e.g., Kd2).
- sequence identity refers to the sequence identity between genes or proteins at the nucleotide or amino acid level, respectively.
- sequence identity is a measure of identity between proteins at the amino acid level and a measure of identity between nucleic acids at nucleotide level.
- the protein sequence identity may be determined by comparing the amino acid sequence in a given position in each sequence when the sequences are aligned.
- nucleic acid sequence identity may be determined by comparing the nucleotide sequence in a given position in each sequence when the sequences are aligned. Methods for the alignment of sequences for comparison are well known in the art, such methods include GAP, BESTFIT, BLAST, FASTA and TFASTA.
- the BLAST algorithm calculates percent sequence identity and performs a statistical analysis of the similarity between the two sequences.
- the software for performing BLAST analysis is publicly available through the National Center for Biotechnology Information (NCBI) website.
- soluble as used herein in reference to proteins, means that the protein is not a membrane protein.
- a soluble protein contains only the extracellular domain of an IgSF family member receptor, or a portion thereof containing an IgSF domain or domains or specific -binding fragments thereof, but does not contain the transmembrane domain and/or is not capable of being expressed on the surface of a cell.
- solubility of a protein can be improved by linkage or attachment, directly or indirectly via a linker, to an Fc domain, which, in some cases, also can improve the stability and/or half-life of the protein.
- a soluble protein is an Fc fusion protein.
- proteins as used herein with respect to polypeptides or nucleic acids means an ensemble of molecules with identical or substantially identical sequences. Variation between polypeptides that are of the same species may occur owing to differences in post-translational modification such as glycosylation, phosphorylation, ubiquitination, nitrosylation, methylation, acetylation, and lipidation. Slightly truncated sequences of polypeptides that differ (or encode a difference) from the full length species at the amino-terminus or carboxy-terminus by no more than 1, 2, or 3 amino acid residues are considered to be of a single species. Such
- microheterogeneities are a common feature of manufactured proteins.
- binding fragment as used herein in reference to a full-length wild- type mammalian ICOSL polypeptide or an IgV or an IgC domain thereof, means a polypeptide having a subsequence of an IgV and/or IgC domain and that specifically binds in vitro and/or in vivo to a mammalian ICOS and/or mammalian CD28 such as a human or murine ICOS or CD28.
- the specific binding fragment of ICOSL IgV or ICOSL IgC is at at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% the sequence length of the full- length wild-type sequence.
- the specific binding fragment can be altered in sequence to form a variant ICOSL of the invention.
- the term "specifically binds" as used herein means the ability of a protein, under specific binding conditions, to bind to a target protein such that its affinity or avidity is at least 5 times as great, but optionally at least 10, 20, 30, 40, 50, 100, 250 or 500 times as great, or even at least 1000 times as great as the average affinity or avidity of the same protein to a collection of random peptides or polypeptides of sufficient statistical size.
- a specifically binding protein need not bind exclusively to a single target molecule but may specifically bind to a non-target molecule due to similarity in structural conformation between the target and non-target (e.g., paralogs or orthologs).
- a polypeptide of the invention may specifically bind to more than one distinct species of target molecule due to cross -reactivity.
- Solid-phase ELISA immunoassays or Biacore measurements can be used to determine specific binding between two proteins.
- interactions between two binding proteins have dissociation constants (K 4 ) less than lxlO "5 M, and often as low as 1 x 1() "12 M.
- interactions between two binding proteins have dissociation constants of lxlO "6 M, lxlO "7 M, lxlO "8 M, lxlO "9 M, lxlO "10 M or lxlO "11 M.
- surface expresses
- surface expression or “expressed on the surface” in reference to a mammalian cell expressing a polypeptide means that the polypeptide is expressed as a membrane protein.
- the membrane protein is a transmembrane protein.
- synthetic with reference to, for example, a synthetic nucleic acid molecule or a synthetic gene or a synthetic peptide refers to a nucleic acid molecule or polypeptide molecule that is produced by recombinant methods and/or by chemical synthesis methods.
- targeting moiety refers to a composition that is covalently or non-covalently attached to, or physically encapsulates, a polypeptide comprising a variant ICOSL of the present invention.
- the targeting moiety has specific binding affinity for a target molecule such as a target molecule expressed on a cell.
- the target molecule is localized on a specific tissue or cell-type.
- Targeting moieties include: antibodies, antigen binding fragment (Fab), variable fragment (Fv) containing V H and V L , the single chain variable fragment (scFv) containing V H and V L linked together in one chain, as well as other antibody V region fragments, such as Fab', F(ab) 2 , F(ab') 2 , dsFv diabody, nanobodies, soluble receptors, receptor ligands, affinity matured receptors or ligands, as well as small molecule ( ⁇ 500 dalton) compositions (e.g., specific binding receptor compositions).
- Targeting moieties can also be attached covalently or non-covalently to the lipid membrane of liposomes that encapsulate a polypeptide of the present invention.
- transmembrane protein as used herein means a membrane protein that substantially or completely spans a lipid bilayer such as those lipid bilayers found in a biological membrane such as a mammalian cell, or in an artificial construct such as a liposome.
- the transmembrane protein comprises a transmembrane domain ("transmembrane domain") by which it is integrated into the lipid bilayer and by which the integration is thermodynamically stable under physiological conditions.
- Transmembrane domains are generally predictable from their amino acid sequence via any number of commercially available bioinformatics software applications on the basis of their elevated hydrophobicity relative to regions of the protein that interact with aqueous environments (e.g., cytosol, extracellular fluid).
- a transmembrane domain is often a hydrophobic alpha helix that spans the membrane.
- a transmembrane protein can pass through the both layers of the lipid bilayer once or multiple times.
- a transmembrane protein includes the provided transmembrane immunomodulatory proteins described herein.
- a transmembrane immunomodulatory protein of the invention further comprises an ectodomain and, in some embodiments, an endodomain.
- treating means slowing, stopping or reversing the disease or disorders progression, as evidenced by decreasing, cessation or elimination of either clinical or diagnostic symptoms, by administration of a therapeutic composition (e.g. containing an immunomodulatory protein or engineered cells) of the invention either alone or in combination with another compound as described herein.
- a therapeutic composition e.g. containing an immunomodulatory protein or engineered cells
- Treatment also means a decrease in the severity of symptoms in an acute or chronic disease or disorder or a decrease in the relapse rate as for example in the case of a relapsing or remitting autoimmune disease course or a decrease in inflammation in the case of an inflammatory aspect of an autoimmune disease.
- the terms “treatment” or, “inhibit,” “inhibiting” or “inhibition” of cancer refers to at least one of: a statistically significant decrease in the rate of tumor growth, a cessation of tumor growth, or a reduction in the size, mass, metabolic activity, or volume of the tumor, as measured by standard criteria such as, but not limited to, the Response Evaluation Criteria for Solid Tumors (RECIST), or a statistically significant increase in progression free survival (PFS) or overall survival (OS).
- RECIST Response Evaluation Criteria for Solid Tumors
- PFS progression free survival
- OS overall survival
- Preventing refers to the administration of an immunomodulatory polypeptide or engineered cells of the invention, either alone or in combination with another compound, to prevent the occurrence or onset of a disease or disorder or some or all of the symptoms of a disease or disorder or to lessen the likelihood of the onset of a disease or disorder.
- tumor specific antigen refers to a counter- structure that is present primarily on tumor cells of a mammalian subject but generally not found on normal cells of the mammalian subject.
- a tumor specific antigen need not be exclusive to tumor cells but the percentage of cells of a particular mammal that have the tumor specific antigen is sufficiently high or the levels of the tumor specific antigen on the surface of the tumor are sufficiently high such that it can be targeted by anti-tumor therapeutics, such as
- immunomodulatory polypeptides of the invention provide prevention or treatment of the mammal from the effects of the tumor.
- at least 50% of the cells displaying a TSA are cancerous.
- at least 60%, 70%, 80%, 85%, 90%, 95%, or 99% of the cells displaying a TSA are cancerous.
- variant as used in reference to a variant ICOSL means an ICOSL, such as a mammalian (e.g., human or murine) ICOSL created by human intervention.
- the variant ICOSL is a polypeptide having an altered amino acid sequence, relative to a reference (e.g. unmodified) or wild-type ICOSL.
- the variant ICOSL is a polypeptide which differs from a reference ICOSL, such as a wild-type ICOSL isoform sequence, by one or more modifications, such as one or more amino acid substitutions, deletions, additions, or combinations thereof.
- the variant ICOSL contains at least one affinity modified domain, whereby one or more of the amino acid differences occurs in an IgSF domain (e.g. IgV domain).
- IgSF domain e.g. IgV domain
- a variant ICOSL can contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid differences, such as amino acid substitutions.
- a variant ICOSL polypeptide generally exhibits at least 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to a corresponding reference (e.g.
- a variant ICOSL polypeptide exhibits at least 50%, 60%, 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to a corresponding reference (e.g. unmodified) or wild-type ICOSL, such as a reference ICOSL set forth in SEQ ID NO:32 or SEQ ID NOs: 196 or 545.
- a corresponding reference e.g. unmodified
- wild-type ICOSL such as a reference ICOSL set forth in SEQ ID NO:32 or SEQ ID NOs: 196 or 545.
- Non-naturally occurring amino acids as well as naturally occurring amino acids are included within the scope of permissible substitutions or additions.
- a variant ICOSL is not limited to any particular method of making and includes, for example, de novo chemical synthesis, de novo recombinant DNA techniques, or combinations thereof.
- a variant ICOSL of the invention specifically binds to CD28, ICOS, and/or CTLA-4 of a mammalian species.
- the altered amino acid sequence results in an an altered (i.e., increased or decreased) binding affinity or avidity to ICOS and/or CD28 compared to the reference (e.g. unmodified) or wild-type ICOSL protein.
- An increase or decrease in binding affinity or avidity can be determined using well known binding assays such as flow cytometry. Larsen et al., American Journal of Transplantation, Vol 5: 443-453 (2005). See also, Linsley et al., Immunity, Vol. 1(9): 793-801 (1994).
- An increase in variant ICOSL binding affinity or avidity to ICOS and/or CD28 is to a value at least 5% greater than that of the reference (e.g. unmodified) or wild-type ICOSL and in some embodiments, at least 10%, 15%, 20%, 30%, 40%, 50%, 100% greater than that of the reference (e.g. unmodified) or wild-type ICOSL control value.
- a decrease in ICOSL binding affinity or avidity to ICOS and/or CD28 is to a value no greater than 95% of the of the wild-type control values, and in some embodiments no greater than 80%, 70% 60%, 50%, 40%, 30%, 20%, 10%, 5%, or no detectable binding affinity or avidity of the wild-type ICOS and/or CD28 control values.
- a variant ICOSL is altered in primary amino acid sequence by substitution, addition, or deletion of amino acid residues.
- the term "variant" in the context of variant ICOSL is not be construed as imposing any condition for any particular starting composition or method by which the variant ICOSL is created.
- a variant ICOSL can, for example, be generated starting from a reference ICOSL or wild type mammalian ICOSL sequence information, then modeled in silico for binding to ICOS and/or CD28, and finally recombinantly or chemically synthesized to yield a variant ICOSL of the present invention.
- a variant ICOSL can be created by site-directed mutagenesis of a reference (e.g. unmodified) or wild-type ICOSL.
- variant ICOSL denotes a composition and not necessarily a product produced by any given process.
- a variety of techniques including recombinant methods, chemical synthesis, or combinations thereof, may be employed.
- wild-type or wild-type or “natural” or “native” as used herein is used in connection with biological materials such as nucleic acid molecules, proteins (e.g., ICOSL), IgSF members, host cells, and the like, refers to those which are found in nature and not modified by human intervention.
- biological materials such as nucleic acid molecules, proteins (e.g., ICOSL), IgSF members, host cells, and the like, refers to those which are found in nature and not modified by human intervention.
- variant ICOSL polypeptides that exhibit altered (increased or decreased) binding activity or affinity for one or more of an ICOSL cognate binding partner.
- the ICOSL cognate binding partner is one or more of CD28, ICOS, or CTLA-4.
- the variant ICOSL polypeptide contains one or more amino acids modifications, such as one or more substitutions (alternatively, "mutations" or
- a provided variant ICOSL polypeptide is or comprises a variant IgD (hereinafter called "vlgD") in which the one or more amino acid modifications (e.g.
- substitutions is in an IgD.
- the IgD comprises an IgV domain or an IgC (e.g. IgC2) domain or specific binding fragment of the IgV domain or the IgC (e.g. IgC2) domain, or combinations thereof.
- the IgD can be an IgV only, the combination of the IgV and IgC, including the entire extracellular domain (ECD), or any combination of Ig domains of ICOSL.
- Table 2 provides exemplary residues that correspond to IgV or IgC regions of ICOSL.
- the variant ICOSL polypeptide contains an IgV domain or an IgC domain or specific binding fragments thereof in which the at least one of the amino acid modifications (e.g. substitutions) is in the IgV domain or IgC domain or a specific binding fragment thereof.
- the IgV domain or IgC domain is an affinity-modified IgSF domain.
- the variant is modified in one more IgSF domains relative to the sequence of a reference (e.g., unmodified) ICOSL sequence.
- the reference (e.g., unmodified) ICOSL sequence is a wild-type ICOSL.
- the reference (e.g., unmodified) or wild-type ICOSL has the sequence of a native ICOSL or an ortholog thereof.
- the reference (e.g., unmodified) or wild-type ICOSL is or comprises the extracellular domain (ECD) of ICOSL or a portion thereof containing one or more IgSF domain (see Table 2).
- the extracellular domain of a reference (e.g., unmodified) or wild-type ICOSL polypeptide comprises an IgV domain and an IgC domain or domains.
- the variant ICOSL polypeptide need not comprise both the IgV domain and the IgC domain or domains.
- the variant ICOSL polypeptide comprises or consists essentially of the IgV domain or a specific binding fragment thereof.
- the variant ICOSL polypeptide comprises or consists essentially of the IgC domain or specific binding fragments thereof.
- the variant ICOSL is soluble and lacks a transmembrane domain.
- the variant ICOSL further comprises a transmembrane domain and, in some cases, also a cytoplasmic domain.
- the reference (e.g., unmodified) or wild-type ICOSL sequence is a mammalian ICOSL sequence.
- the reference (e.g., unmodified) or wild-type ICOSL sequence can be a mammalian ICOSL that includes, but is not limited to, human, mouse, cynomolgus monkey, or rat.
- the reference (e.g., unmodified) or wildtype ICOSL sequence is human.
- the reference (e.g., unmodified) or wild-type ICOSL sequence has (i) the sequence of amino acids set forth in SEQ ID NO:5 or a mature form thereof lacking the signal sequence, (ii) a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO:5 or the mature form thereof, or (iii) is a portion of (i) or (ii) containing an IgV domain or IgC domain or specific binding fragments thereof.
- the reference ICOSL sequence is or comprises an extracellular domain of the ICOSL or a portion thereof.
- the reference or wild-type ICOSL polypeptide comprises the amino acid sequence set forth in SEQ ID NO:32, or an ortholog thereof.
- the reference (e.g., unmodified) or wild-type ICOSL polypeptide can comprise (i) the sequence of amino acids set forth in SEQ ID NO:32, (ii) a sequence of amino acids that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 32, or (iii) is a specific binding fragment of the sequence of(i) or (ii) comprising an IgV domain or an IgC domain.
- the reference ICOSL polypeptide comprises a truncated extracellular domain comprising a C-terminal truncation with reference to the reference ICOSL extracellular domain sequence set forth in SEQ ID NO:32.
- the C-terminal truncation is of at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 125 amino acid residues.
- the C- terminal truncation is of at least 1, at least 5 at least 10, at least 15, at least 20, at least 25, at least 30, at least 35 amino acid residues.
- the ICOSL polypeptide comprising a C-terminal truncation does not contain, beyond the C-terminus of the truncation point, contiguous amino acid residues of a wild-type ICOSL.
- ICOSL reference sequences are those that are shorter than the full extracellular domain of a wild-type ICOSL, e.g. set forth in SEQ ID NO: 32.
- the ICOSL polypeptide comprising a C- terminal truncation does not contain or is not fused to amino acid residues of an ICOSL domain beyond the extracellular domain.
- the ICOSL reference polypeptide is altered, such as mutated or deleted, in one or more protease cleavage site.
- wild-type ICOSL polypeptide contains a protease cleavage site that, in some cases, results in cleavage of the protein upon expression in cells, e.g. Chinese Hamster Ovary cells, thereby resulting in a heterogeneous product of multiple species, including species of different lengths or sizes.
- cleavage of the ICOSL polypeptide may occur at the LQQN/LT protease cleavage site between residues 207 and 208 of SEQ ID NO: 32 ("/" indicates potential cleavage site).
- the ICOSL reference polypeptide is altered in or lacks a protease cleavage site set forth as amino acids 204-209 of SEQ ID NO:32.
- a truncated ICOSL polypeptide is more resistant to protease cleavage compared to a wild-type or non-truncated ICOSL polypeptide.
- Exemplary truncated ICOSL polypeptide ECD truncations lacking all or a portion of the LQQN/LT protease cleavage site are provided in SEQ ID NOs: 600-606.
- Truncation #5 DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRY RNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPV VSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRI ARTPSVNIGCCIENVLLQQ (SEQ ID NO: 603)
- the ICOSL reference polypeptide is altered in one or more amino acids corresponding to amino acids 204-209 with reference to SEQ ID NO:32.
- the variant ICOSL polypeptide has one or more amino acid modification, e.g., substitution in a reference ICOSL or specific binding fragment thereof corresponding to position(s) 207 and/or 208 with reference to numbering of SEQ ID NO:32.
- the variant ICOSL polypeptide has one or more amino acid modification, e.g., substitution, selected from N207A, N207G, L208G, or a conservative amino acid modification, e.g., substitution thereof.
- the one or more amino acid modification, e.g., substitution is N207A/L208G or N207G/L208G.
- the full length reference ECDs or truncated reference ECDs of the variant ICOSL polypeptide are modified to contain one or more amino acid modifications, e.g., substitutions, selected from N207A, N207G, L208G, or a conservative amino acid modification.
- Exemplary full length or truncated reference ECDs with one or more modifications are set forth in SEQ ID NOs: 607-628.
- Exemplary reference sequences containing mutations at cleavage site N207 and/or L208 with reference to positions are set forth in SEQ ID NO: 32 are set forth in SEQ ID NOs: 624-628.
- the provided modifications may reduce protease cleavage of the ICOSL polypeptide, such as cleavage that may occur at the LQQN/LT protease cleavage site.
- combinations of the above truncation and modification strategies can be employed in a reference ICOSL ECD sequence.
- the modifications e.g., substitutions, are made in a truncated reference ICOSL polypeptide such as exemplary reference ICOSL sequence set forth in SEQ ID NOs: 600-606.
- Exemplary variant ICOSL polypeptide sequences with modifications at the potential protease cleavage site(s) N207 and/or L208 are set forth in SEQ ID NOs: 607-628.
- the variant ICOSL polypeptide exhibits decreased protease cleavage compared to wild-type ICOSL polypeptide, such as containing the ECD sequence set forth in SEQ ID NO:32.
- the reference (e.g., unmodified) or wildtype ICOSL polypeptide comprises an IgV domain or an IgC domain, or a specific binding fragment thereof.
- an ICOSL reference polypeptide containing an IgV domain comprises the amino acid sequence set forth in SEQ ID NO: 196 (corresponding to amino acid residues 19-129 of SEQ ID NO:5), or an ortholog thereof.
- the reference ICOSL polypeptide containing the IgV domain contains at least amino acids 1-112, 1-113, 1-114, 1-115, 1-116, 1-117, 1-118, 1-119, 1-120, 1- 121, 1-122, with reference to numbering set forth in SEQ ID NO:32.
- an ICOSL reference polypeptide containing an IgV domain comprises the amino acid sequence set forth in SEQ ID NO: 545 (corresponding to amino acid residues 19-140 of SEQ ID NO:5), or an ortholog thereof.
- the IgV domain is the only IgSF domain of the ICOSL reference polypeptide.
- the IgV domain of the reference (e.g., unmodified) or wild- type ICOSL polypeptide can contain (i) the sequence of amino acids set forth in SEQ ID NO: 196 or 545, (ii) a sequence of amino acids that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to SEQ ID NO: 196 or 545, or (iii) a specific binding fragment of the sequence of amino acids set forth in SEQ ID NO: 196 or 545 or a specific binding fragment of a sequence of (i) or (ii).
- the reference (e.g., unmodified) IgV domain is capable of binding one or more ICOSL cognate binding proteins, such as one or more of CD28, ICOS, or CTLA-4.
- the IgC domain of the reference (e.g., unmodified) or wild- type ICOSL polypeptide comprises the amino acid sequence set forth as residues 141-227 of SEQ ID NO: 5, or an ortholog thereof.
- the IgC domain of the reference (e.g., unmodified) or wild-type ICOSL polypeptide can contain (i) the sequence of amino acids set forth residues 141-227 of SEQ ID NO: 5, (ii) a sequence of amino acids that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to residues 141-227 of SEQ ID NO: 5, or (iii) (i) or (ii).
- the reference IgV domain is capable of binding one or more ICOSL cognate binding proteins.
- the reference (e.g., unmodified) or wild-type ICOSL polypeptide contains a specific binding fragment of ICOSL, such as a specific binding fragment of the IgV domain or the IgC domain.
- the specific binding fragment can bind CD28, ICOS, and/or CTLA-4.
- the specific binding fragment can have an amino acid length of at least 50 amino acids, such as at least 60, 70, 80, 90, 100, or 110 amino acids.
- the specific binding fragment of the IgV domain contains an amino acid sequence that is at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% of the length of the IgV domain set forth as amino acids 19-129 of SEQ ID NO: 5.
- the specific binding fragment of the IgC domain comprises an amino acid sequence that is at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% of the length of the IgC domain set forth as amino acids 141- 227 of SEQ ID NO: 5.
- the variant ICOSL polypeptide comprises the ECD domain, a truncated ECD domain, or a portion thereof comprising one or more affinity modified IgSF domains.
- the variant ICOSL polypeptides can comprise an IgV domain or an IgC domain, in which one or more of the IgSF domains (IgV or IgC) or a specific binding fragment of the IgV domain or a specific binding fragment of the IgC domain contains the one or more amino acid modifications (e.g. substitutions).
- the variant ICOSL polypeptides can comprise an IgV domain and an IgC domain, or a specific binding fragment of the IgV domain and a specific binding fragment of the IgC domain. In some embodiments, the variant ICOSL polypeptide comprises a full-length IgV domain. In some embodiments, the variant ICOSL polypeptide comprises a full-length IgC domain. In some embodiments, the variant ICOSL polypeptide comprises a specific binding fragment of the IgV domain. In some embodiments, the variant ICOSL polypeptide comprises a specific binding fragment of the IgC domain. In some embodiments, the variant ICOSL polypeptide comprises a full-length IgV domain and a full-length IgC domain.
- the variant ICOSL polypeptide comprises a full-length IgV domain and a specific binding fragment of an IgC domain. In some embodiments, the variant ICOSL polypeptide comprises a specific binding fragment of an IgV domain and a full-length IgC domain. In some embodiments, the variant ICOSL polypeptide comprises a specific binding fragment of an IgV domain and a specific binding fragment of an IgC domain.
- the one or more amino acid modifications (e.g., substitutions) of the variant ICOSL polypeptides can be located in any one or more of the ICOSL polypeptide domains.
- one or more amino acid substitutions are located in the extracellular domain (ECD) of the variant ICOSL polypeptide, such as set forth in SEQ ID NO: 32.
- one or more amino acid substitutions are located in the IgV domain or specific binding fragment of the IgV domain.
- one or more amino acid modifications (e.g. substitutions) are located in the IgC domain or specific binding fragment of the IgC domain.
- each of the various attributes of polypeptides are separately disclosed below (e.g., soluble, secretable and membrane bound polypeptides, affinity of ICOSL for CD28, ICOS, and CTLA-4, number of variations per polypeptide chain, number of linked polypeptide chains, the number and nature of amino acid alterations per variant ICOSL, etc.).
- any particular polypeptide can comprise a combination of these independent attributes. It is understood that reference to amino acids, including to a specific sequence set forth as a SEQ ID NO used to describe domain organization of an IgSF domain are for illustrative purposes and are not meant to limit the scope of the embodiments provided.
- polypeptides and the description of domains thereof are theoretically derived based on homology analysis and alignments with similar molecules. Thus, the exact locus can vary, and is not necessarily the same for each protein.
- the specific IgSF domain such as specific IgV domain or IgC domain, can be several amino acids (such as one, two, three or four) longer or shorter.
- variant ICOSL polypeptides containing at least one affinity- modified IgSF domain (e.g., IgV or IgC) or a specific binding fragment thereof in an IgSF domain contained in a reference (e.g., unmodified) or wild-type ICOSL polypeptide such that the variant ICOSL polypeptide exhibits altered (increased or decreased) binding activity or affinity for one or more ligands ICOS, CD28, or CTLA-4 compared to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- affinity- modified IgSF domain e.g., IgV or IgC
- a reference e.g., unmodified
- a variant ICOSL polypeptide has a binding affinity for CD28, ICOS, and/or CTLA-4 that differs from that of a reference (e.g., unmodified) or wild-type ICOSL polypeptide control sequence as determined by, for example, solid-phase ELISA immunoassays, flow cytometry or Biacore assays.
- the variant ICOSL polypeptide has an increased binding affinity for CD28, ICOS, and/or CTLA-4.
- the variant ICOSL polypeptide has a decreased binding affinity for CD28, ICOS, and/or CTLA-4, relative to a reference (unmodified) or wild-type ICOSL polypeptide.
- the CD28, ICOS and/or the CTLA-4 can be a mammalian protein, such as a human protein or a murine protein.
- Binding affinities for each of the cognate binding partners are independent; that is, in some embodiments, a variant ICOSL polypeptide has an increased binding affinity for one, two or three of CD28, ICOS, and/or CTLA-4, and a decreased binding affinity for one, two or three of CD28, ICOS, and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide has an increased binding affinity for CD28, relative to a reference (e.g., unmodified) or wildtype ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has an increased binding affinity for ICOS, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has an increased binding affinity for CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some
- the variant ICOSL polypeptide has a decreased binding affinity for CD28, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for ICOS, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide has an increased binding affinity for CD28 and ICOS, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has an increased binding affinity for CD28 and a decreased binding affinity for ICOS, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for CD28 and ICOS, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for CD28 and an increased binding affinity for ICOS, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide has an increased binding affinity for CD28 and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has an increased binding affinity for CD28 and a decreased binding affinity for CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for CD28 and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for CD28 and an increased binding affinity for CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide has an increased binding affinity for ICOS and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOS polypeptide. In some embodiments, the variant ICOSL polypeptide has an increased binding affinity for ICOS and a decreased binding affinity for CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for ICOS and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for ICOS and an increased binding affinity for CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide has an increased binding affinity for CD28, ICOS, and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has an increased binding affinity for CD28 and ICOS, and a decreased binding affinity for CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has an increased binding affinity for CD28 and CTLA-4, and a decreased binding affinity for ICOS, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide has a decreased binding affinity for CD28 and ICOS, and an increased binding affinity for CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for CD28 and an increased binding affinity for ICOS and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL
- the variant ICOSL polypeptide has an increased binding affinity for CD28, and a decreased binding affinity for ICOS and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for CD28, CTLA-4, and ICOS, relative to a reference (e.g., unmodified) or wild-type ICOSL polypeptide. In some embodiments, the variant ICOSL polypeptide has a decreased binding affinity for CD28, and an increased binding affinity for ICOS and CTLA-4, relative to a reference (e.g., unmodified) or wild-type ICOSL
- a variant ICOSL polypeptide with increased or greater binding affinity to CD28, ICOS, and/or CTLA-4 will have an increase in binding affinity relative to the reference (e.g., unmodified) or wild-type ICOSL polypeptide control of at least about 5%, such as at least about 10%, 15%, 20%, 25%, 35%, or 50% for the CD28, ICOS, and/or CTLA-4.
- the increase in binding affinity relative to the reference (e.g., unmodified) or wild-type ICOSL polypeptide is more than 1.2-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6- fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold 40-fold or 50-fold.
- the reference (e.g., unmodified) or wild-type ICOSL polypeptide has the same sequence as the variant ICOSL polypeptide except that it does not contain the one or more amino acid modifications (e.g., substitutions).
- a variant ICOSL polypeptide with reduced or decreased binding affinity to CD28, ICOS, and/or CTLA-4 will have decrease in binding affinity relative to the reference (e.g., unmodified) or wild-type ICOSL polypeptide control of at least 5%, such as at least about 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more for the CD28, ICOSL, and/or CTLA-4.
- the decrease in binding affinity relative to the reference (e.g., unmodified) or wild-type ICOSL polypeptide is more than 1.2-fold, 1.5-fold, 2- fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold 40-fold or 50- fold.
- the reference (e.g., unmodified) or wild-type ICOSL polypeptide has the same sequence as the variant ICOSL polypeptide except that it does not contain the one or more amino acid modifications, e.g. substitutions.
- the equilibrium dissociation constant (K d ) of any of the foregoing embodiments to CD28, ICOS, and/or CTLA-4 can be less than lxlO "5 M, IxlO -6 M, IxlO -7 M, IxlO -8 M, IxlO "9 M, IxlO -10 M or lxl0 _11 M, or IxlO "12 M.
- a variant ICOSL polypeptide has an increased or greater binding affinity to CD28.
- a variant ICOSL polypeptide with increased or greater binding affinity to CD28 will have an increase in binding affinity relative to the reference (e.g., unmodified) or wild-type ICOSL polypeptide control of at least about 25%, such as at least about 30%, 40%, 50%, or 60% for CD28.
- a variant ICOSL polypeptide with increased or greater binding affinity to CD28 has an equilibrium dissociation constant (K d ) of less than 200 pM, 300 pM, 400 pM, 500 pM, or 600 pM for CD28.
- the variant polypeptide specifically binds to the ectodomain of one of ICOS, CD28 or CTLA4 with increased selectivity compared to the reference (e.g., unmodified) or wild-type ICOSL.
- the increased selectivity is for CD28.
- the increased selectivity comprises a greater ratio of binding of the variant ICOSL polypeptide for one cognate binding partner selected from among ICOS, CD28 and CTLA4 versus another of the cognate binding partner compared to the ratio of binding of the reference (e.g., unmodified) or wild-type ICOSL polypeptide for the one cognate binding partner versus the another of the cognate binding partner.
- the ratio is greater by at least or at least about 1.5-fold, 2.0-fold, 3.0-fold, 4.0-fold, 5-fold, 10-fold, 15-fold, 20-fold, 30-fold, 40-fold, 50-fold or more.
- the reference (e.g., unmodified) or wild-type ICOSL sequence does not necessarily have to be used as a starting composition to generate variant ICOSL polypeptides described herein. Therefore, use of the term "modification”, such as "substitution” does not imply that the present embodiments are limited to a particular method of making variant ICOSL polypeptides.
- Variant ICOSL polypeptides can be made, for example, by de novo peptide synthesis and thus does not necessarily require a modification, such as a "substitution”, in the sense of altering a codon to encode for the modification, e.g. substitution. This principle also extends to the terms “addition” and “deletion” of an amino acid residue which likewise do not imply a particular method of making.
- the means by which the variant ICOSL polypeptides are designed or created is not limited to any particular method.
- a reference (e.g., unmodified) or wild-type ICOSL encoding nucleic acid is mutagenized from reference (e.g., unmodified) or wild-type ICOSL genetic material and screened for desired specific binding affinity and/or induction of IFN-gamma expression or other functional activity.
- a variant ICOSL polypeptide is synthesized de novo utilizing protein or nucleic acid sequences available at any number of publicly available databases and then subsequently screened.
- the National Center for Biotechnology Information provides such information and its website is publicly accessible via the internet as is the UniProtKB database as discussed previously.
- amino acid modification are designated by amino acid position number corresponding to the numbering of positions of the reference ECD sequence set forth in SEQ ID NO:32. It is within the level of a skilled artisan to identify the corresponding position of a modification, e.g. amino acid substitution, in an ICOSL polypeptide, including portion thereof containing an IgSF domain (e.g. IgV) thereof, such as by alignment of a reference sequence (e.g. SEQ ID NO: 196, 545, 600- 628) with SEQ ID NO:32. In the listing of modifications throughout this disclosure, the amino acid position is indicated in the middle, with the corresponding reference (e.g.
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution in a reference (e.g., unmodified) or wild-type ICOSL sequence.
- the one or more amino acid modification, e.g. substitution can be in the ectodomain
- the one or more amino acid modification e.g. substitution is in the IgV domain or specific binding fragment thereof. In some embodiments, the one or more amino acid
- modification e.g. substitution is in the IgC domain or specific binding fragment thereof.
- substitution is in the IgC domain or specific binding fragment thereof.
- modification e.g. substitution is in the IgV domain or a specific binding fragment thereof, and some of the one or more amino acid modification, e.g. substitution are in the IgC domain or a specific binding fragment thereof.
- the variant ICOSL polypeptide has up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid modification(s), e.g. substitution.
- the modification, e.g. substitution can be in the IgV domain or the IgC domain.
- the variant ICOSL polypeptide has up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid substitutions in the IgV domain or specific binding fragment thereof. In some embodiments, the variant ICOSL polypeptide has up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid substitutions in the IgC domain or specific binding fragment thereof.
- the variant ICOSL polypeptide has at least about 85%, 86%, 86%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with the reference (e.g., unmodified) or wild-type ICOSL polypeptide or specific binding fragment thereof, such as with the amino acid sequence of SEQ ID NO: 32, 196 or 545.
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution in a reference ICOSL or specific binding fragment there of corresponding to position(s) 10, 11, 13, 16, 18, 20, 25, 27, 30, 33, 37, 42, 43, 47, 52, 54, 57, 61, 62, 67, 71, 72, 74, 77, 78, 75, 80, 84, 89, 90, 92, 93, 94, 96, 97, 98, 99, 100, 102, 103, 107, 109, 110, 111, 113, 115, 116, 117, 119, 120, 121, 122, 126, 129, 130, 132, 133, 135, 138, 139, 140, 142, 143, 144, 146, 151, 152, 153, 154, 155, 156, 158, 161, 166, 168, 172, 173, 175, 190, 192, 193, 19
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution in a reference ICOSL or specific binding fragment there of corresponding to position(s) 10, 11, 13, 16, 18, 20, 25, 26, 27, 30, 33, 37, 38, 42, 43, 47, 52, 54, 57, 61, 62, 67, 71, 72, 74, 75, 77, 78, 80, 84, 89, 90, 92, 93, 94, 96, 97, 98, 99, 100, 102, 103, 107, 109, 110, 111, 113, 115, 116, 117, 119, 120, 121, 122, 126, 129, 130, 132, 133, 135, 137, 138, 139, 140, 142, 143, 144, 146, 151, 152, 153, 154, 155, 156, 158, 161, 164, 166, 168, 172, 173, 175, 190,
- such variant ICOSL polypeptides exhibit altered binding affinity to one or more of CD28, ICOS, and/or CTLA-4 compared to the reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide exhibits increased binding affinity to CD28, ICOS, and/or CTLA-4 compared to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide exhibits decreased binding affinity to CD28, ICOS, or CTLA-4 compared to a reference (e.g., unmodified) or wild-type ICOSL polypeptide.
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20V, S25G, F27S, F27C, N30D, Y33del, Q37R, K42E, Y47H, T43A, N52A, N52C, N52D, N52G, N52H, N52L, N52K, N52M, N52P, N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54P, N57A, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, N57Y, R61S, R61C, Y62F, L67P, A71T, G72R, L74Q, R75
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20T, A20V, S25G, R26S, F27C, F27S, N30D, Y33del, Q37R, T38P, K42E, T43A, Y47H, N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M, N52P, N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54F, S54P, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, N57Y, R61C, R61S, Y62F
- a conservative amino acid modification is any amino acid that falls in the same class of amino acids as the substituted amino acids, other than the reference (e.g., unmodified) or wild-type amino acid.
- the classes of amino acids are aliphatic (glycine, alanine, valine, leucine, and isoleucine), hydroxyl or sulfur-containing (serine, cysteine, threonine, and methionine), cyclic (proline), aromatic (phenylalanine, tyrosine, tryptophan), basic (histidine, lysine, and arginine), and acidic/amide (aspartate, glutamate, asparagine, and glutamine).
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20V, S25G, F27S, F27C, N30D, Y33del, Q37R, K42E, T43A, Y47H, N52A, N52C, N52D, N52G, N52H, N52L, N52K, N52M, N52P, N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54P, N57A, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, N57Y,R61S, R61C, Y62F, L67P, A71T, G72R, L74Q, R75
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20T, A20V, S25G, R26S, F27C, F27S, N30D, Y33del, Q37R, T38P, K42E, T43A, Y47H, N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M, N52P, N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54F, S54P, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, N57Y, R61C, R61S, Y62F, L67
- the one or more amino acid modification e.g. substitution is
- N52Y/N57Y/F138L/L203P N52H/N57Y/Q100P
- N52S/Y146C/Y152C N52H/C198R
- N52H/I143T N52S/L80P, F120S/Y152H/N201S, N52S/R75Q/L203P, N52S/D158G, N52D/Q133H, N52S/N57Y/H94D/L96F/L98F/Q100R, N52S/N57Y/H94D/L96F/L98F/Q100R/G103E/F120S,
- N52H/N57Y/Q100R N52H/N57Y/L74Q/Q100R/V110D
- N52H/Q100R N52H/S121G
- A20V/N52H/N57Y/Q100R/S109G N52H/N57Y/Q100P, N52H/N57Y/R61S/Q100R/V110D/L173S, N52H/N57Y/Q100R/V122A, N52H/N57Y/Q100R/F172S, N52H/N57Y, N52S/F120S, N52S/V97A, N52S/G72R, N52S/A71T/A117T, N52S/E220G, Y47H/N52S/V107A/F120S,
- N52H/N57 Y/Q 1 OOR/V 11 OD/V 116 A/L 161 M/Fl 72S/S 192G/C 198R, F27S/N52H/N57 Y/V 11 ON, N52S/H94E/L96I/S109N/L166Q, S18R/N52S/F93L/I143V/R221G, A20T/N52D/Y146C/Q164L, V11E/N30D/N52H/N57Y/H94E/L96I/L98F/N194D/V210A/I218T, N52S/H94E/L96I/V122M,
- N52H/N57Y/R61C/Y62F/Q100R/V110N/F120S/C198R N52H/N57Y/Q100R/V110D/H115R/C198R
- N52H/N57Y/Q100R/V110D/N144D/F172S/C198R N52S/H94E/L98F/Q100R, N52S/E90A
- N52H/N57Y/Q100R/C198R N52S/N194D, N52H/N57Y/Q100R/L102R/V110D/H115R/C198R, N52S/S54P, T38P/N52S/N57D, N52H/C140del/T225A, N52H/F78L/Q100R/C198R,
- N52H/N57Y/R75Q/Q100P/V110D N52H/N57Y/L74Q/V110D/S192G, N52H/S121G/C198R,
- N52H/N57Y/Q100R/V107I/V110D/I154F/C198R/R221G Q100R, F138L/L203P, N57Y/F138L/L203P, N57Y/Q100R/C198R, N57Y/F138L/L203P, Q100R/F138L, L203P, N52H/N57Y/Q100R/H115R/C198R, N52H/N57Y/Q100R/F172S/C198R, N52H/N57Y/Q100R/H115R/F172S/C198R,
- N52S/H115R/F172S/C198R N52H/N57Y/Q100P/C198R, N52H/N57Y/Q100P HI 15R/F172S/C198R, N52H/N57Y/Q100P/F172S/C198R, N52H/N57Y/Q1 OOP/HI 15R, N52H/N57Y/Q100P/H115R/C198R, N52H/Q100R/C198R, N52H/Q100R/H115R/F172S, N52H/Q100R/F172S/C198R,
- N52Q/N84Q/N155Q/N168Q N52Q/N84Q/N119Q/N168Q, N84Q/N119Q/N155Q/N168Q,
- N84Q/N155Q/N168Q/N207Q N84Q/N119Q/N155Q/N207Q, N52Q/N84Q/N119Q/N207Q,
- N84Q/N119Q/N155Q/N168Q/N207Q N52A/N57F/Q100S, N52A/N57H/Q100S, N52A/N57Y/Q100A, N52D/N57A/Q100A, N52D/Q100S, N52G/Q100A, N52H/Q100A, N52M/N57H/Q100S,
- N52M/N57W/Q100P N52Q/N57F, N52Q/N57S/Q100A, N52R/N57L/Q100A, N52R/N57Y/Q100P, N52R/N57Y/Q100S, N52S/N57A/Q100A, N52S/N57H/Q100E, N52S/N57L/Q100S,
- N52S/N57M/Q100S N52S/N57Y/Q100S, N52S/N57Y/Q100M, N52S/N57Y/Q100V,
- N52T/N57H/Q100S N52T/N57H/Q100A, N52T/N57Y/Q100A, N52V/N57L/Q100A,
- N52R/N57F/Q100P N52R/N57F/Q100R, N52R/N57F/Q100T, N52R/N57H/Q100K,
- N52R/N57L/Q100S N52R/N57W/Q100K, N52R/N57W, N52R/N57Y/Q100R, N52C/N57E/Q100S, N52G/N57P/Q100D, N52G/N57V/Q100G, N52G/N57V, N52L/N57V, N52P/N57P, N52P/N57S/Q100G, N52S/N57L/Q100G, N52T/N57K/Q100P, N52V/N57T/Q100L, or N57Q/Q100P.
- the one or more amino acid modifications are selected from among N52Y/N57Y/F138L/L203P, N52H/N57Y/Q100P, N52S/Y146C/Y152C, N52H/C198R,
- N52H/I143T N52S/L80P, F120S/Y152H/N201S, N52S/R75Q/L203P, N52S/D158G, N52D/Q133H, N52S/N57Y/H94D/L96F/L98F/Q100R, N52S/N57Y/H94D/L96F/L98F/Q100R/G103E/F120S,
- N52S/G103E N52H/F78L/Q100R, N52H/N57Y/Q100R/V110D, N52H/N57Y/R75Q/Q100R/V110D, N52H/N57Y/Q100R, N52H/N57Y/L74Q/Q100R/V110D, N52H/Q100R, N52H/S121G,
- N52H/N57Y/R61C/Y62F/Q100R/V110N/F120S/C198R N52H/N57Y/Q100R/V110D/H115R/C198R
- N52H/N57Y/Q100R/V110D/N144D/F172S/C198R N52S/H94E/L98F/Q100R, N52S/E90A
- N52H/C140del/T225A N52H/F78L/Q100R/C198R, N52H/N57Y/R75Q/Q100P/V110D,
- N52H/N57Y/Q100R/V110D/S132F/M175T N52H/N57Y/Q100R/V107I/V110D/I154F/C198R/R221G
- N52Q/N207Q N168Q/N207Q
- N52Q/N168Q N84Q/N207Q
- N155Q/N207Q N119Q/N168Q
- N155Q/N168Q/N207Q N119Q N155Q/N168Q, N119Q/N168Q/N207Q, N84Q/N119Q/N207Q, Nl 19Q/N155H/N207Q, N84Q/N119Q/N155Q, N52Q/N119Q/N155Q, N52H/N84Q/N119Q,
- N52H/N84Q N52H/N84Q/N168Q/N207Q, N52Q/N84Q/N155Q/N168Q, N52Q/N84Q/N119Q/N168Q, N84Q/N119Q/N155Q/N168Q, N84Q/N155Q/N168Q/N207Q, N84Q/N119Q/N155Q/N207Q,
- N52Q/N84Q/N119Q/N207Q N52Q/N84Q/N119Q/N155Q, N52Q/N84Q/N119Q/N155Q/N207Q, N84Q/N119Q/N155Q/N168Q/N207Q, F138L/L203P, N52Y/F138L/L203P, N57Y/Q100R/C198R, N57Y/F138L/L203P, Q100R/F138L, N52H/N57Y/Q100R/H115R/C198R,
- N52H/N57Y/Q100R/F172S N52H/Q100R/H115R/I143T/F172S, N52H/N57Y/Q1 OOP/HI 15R/F172S, N52Y/N57Y/Q100P/F172S, E16V/N52H/N57Y/Q100R/V110D/H115R/C198R,
- N52A/N57H/Q100S N52A/N57Y/Q100A, N52D/N57A/Q100A, N52D/Q100S, N52G/Q100A,
- N52H/Q100A N52M/N57H/Q100S, N52M/N57W/Q100P, N52Q/N57F, N52Q/N57S/Q100A,
- N52R/N57L/Q100A N52R/N57Y/Q100P, N52R/N57Y/Q100S, N52S/N57A/Q100A,
- N52S/N57H/Q100E N52S/N57L/Q100S, N52S/N57M/Q100S, N52S/N57Y/Q100S,
- N52S/N57Y/Q100M N52S/N57Y/Q100V, N52T/N57H/Q100S, N52T/N57H/Q100A,
- N52T/N57Y/Q100A N52V/N57L/Q100A, N52H/N57Y/Q100K, N52K/N57Y/Q100R,
- N52L/N57H/Q100R N52R/N57F/Q100N, N52R/N57F/Q100P, N52R/N57F/Q100R,
- N52R/N57F/Q100T N52R/N57H/Q100K, N52R/N57L/Q100S, N52R/N57W/Q100K, N52R/N57W, N52R/N57Y/Q100R, N52C/N57E/Q100S, N52G/N57P/Q100D, N52G/N57V/Q100G, N52G/N57V, N52L/N57V, N52P/N57P, N52P/N57S/Q100G, N52S/N57L/Q100G, N52T/N57K/Q100P,
- N52V/N57T/Q100L N57Q/Q100P
- S54F/V193A R26S/N52H/N57Y/V110D/T137A/C198R.
- the variant ICOSL polypeptide comprises any of the mutations listed in Table 1.
- Table 1 also provides exemplary sequences by reference to SEQ ID NO for the extracellular domain (ECD) or IgV domain of the reference (e.g., unmodified) or wild-type ICOSL or exemplary variant ICOSL polypeptides.
- ECD extracellular domain
- IgV domain of the reference
- wild-type ICOSL wild-type ICOSL
- exemplary variant ICOSL polypeptides As indicated, the exact locus or residues corresponding to a given domain can vary, such as depending on the methods used to identify or classify the domain.
- adjacent N- and/or C-terminal amino acids of a given domain e.g. IgV
- adjacent N- and/or C-terminal amino acids of a given domain also can be included in a sequence of a variant IgSF polypeptide, such as to ensure proper folding of the domain when expressed.
- the particular domain, such as the ECD domain, of a variant ICOSL polypeptide can be several amino acids longer or shorter, such as 1-10, e.g., 1, 2, 3, 4, 5, 6 or 7 amino acids longer or shorter, than the sequence of amino acids set forth in the respective SEQ ID NO.
- the variant ICOSL polypeptide comprises any of the mutations listed in Table 1.
- the mutations are made in a reference ICOSL containing the sequence of amino acids set forth in SEQ ID NO: 32, a reference ICOSL that contains the IgV domain of ICOSL set forth in SEQ ID NOs: 196 or 545, or a reference ICOSL that is truncated and/or modified containing the sequence of amino acids set forth in any of SEQ ID NOs: 600-
- the variant ICOSL polypeptide comprises any of the extracellular domain (ECD) sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 109-142, 239, 280-325, 364-381, 387-424, 427-433, 435-470, 638-685).
- ECD extracellular domain
- the variant ICOSL polypeptide comprises a polypeptide sequence that exhibits at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, such as at least 96% identity, 97% identity, 98% identity, or 99% identity to any of the extracellular domain (ECD) sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 109-142, 239, 280-325, 364-381, 387-424, 427-433, 435-470, 638-685) and contains the amino acid modification(s), e.g. substitution(s) not present in the reference (e.g., unmodified) or wild-type ICOSL.
- ECD extracellular domain
- the variant ICOSL polypeptide comprises a specific binding fragment of any of the extracellular domain (ECD) sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 109-142, 239, 280-325, 364-381, 387-424, 427-433, 435-470, 638-685) and contains the amino acid modification(s), e.g. substitution (s) not present in the reference (e.g., unmodified) or wild-type ICOSL.
- ECD extracellular domain
- the variant ICOSL polypeptide comprises any of the extracellular domain (ECD) sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 109-142, 239, 280-325, 364-381, 387-424, 427-433, 435-470, 638-685, 905, 908).
- ECD extracellular domain
- the variant ICOSL polypeptide comprises a polypeptide sequence that exhibits at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, such as at least 96% identity, 97% identity, 98% identity, or 99% identity to any of the extracellular domain (ECD) sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 109-142, 239, 280-325, 364-381, 387-424, 427-433, 435-470, 638-685, 905, 908) and contains the amino acid modification(s), e.g.
- ECD extracellular domain
- the variant ICOSL polypeptide comprises a specific binding fragment of any of the extracellular domain (ECD) sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 109-142, 239, 280-325, 364-381, 387-424, 427-433, 435-470, 638-685, 905, 908) and contains the amino acid modification(s), e.g. substitution (s) not present in the reference (e.g., unmodified) or wild-type ICOSL.
- ECD extracellular domain
- the variant ICOSL polypeptide comprises any of the IgV sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 197-199, 201-208, 210, 212, 240, 326- 340, 382-386, 425-426, 434, 546-599, 686-857).
- the variant ICOSL polypeptide comprises a polypeptide sequence that exhibits at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, such as at least 96% identity, 97% identity, 98% identity, or 99% identity to any of the IgV sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 197-199, 201-208, 210, 212, 240, 326- 340, 382-386, 425-426, 434, 546-599, 686-857) and contains the amino acid modification(s), e.g.
- the variant ICOSL polypeptide comprises a specific binding fragment of any of the IgV sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 197-199, 201-208, 210, 212, 240, 326-340, 382-386, 425-426, 434, 546-599, 686-857) and contains the amino acid substitution(s) not present in the reference (e.g., unmodified) or wild-type ICOSL.
- the variant ICOSL polypeptide comprises any of the IgV sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 197-199, 201-208, 210, 212, 240, 326- 340, 382-386, 425-426, 434, 546-599, 686-857, 906-907, 909-910).
- the variant ICOSL polypeptide comprises a polypeptide sequence that exhibits at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, such as at least 96% identity, 97% identity, 98% identity, or 99% identity to any of the IgV sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 197-199, 201-208, 210, 212, 240, 326-340, 382-386, 425-426, 434, 546-599, 686-857, 906-907, 909-910) and contains the amino acid modification(s), e.g.
- the variant ICOSL polypeptide comprises a specific binding fragment of any of the IgV sequences listed in Table 1 (i.e., any one of SEQ ID NOS: 197-199, 201-208, 210, 212, 240, 326-340, 382-386, 425-426, 434, 546-599, 686-857, 906-907, 909-910) and contains the amino acid substitution(s) not present in the reference (e.g., unmodified) or wild-type ICOSL.
- Mutations designated with an "X" indicate the designated position contains a Q or the wild-type residue set forth in the corresponding position of SEQ ID NO: 32.
- the variant ICOSL polypeptide exhibits increased affinity for the ectodomain of CD28 compared to the reference (e.g., unmodified) or wild-type ICOSL polypeptide, such as comprising the sequence set forth in SEQ ID NO: 32, 196, or 545.
- the ICOSL polypeptide exhibits increased affinity for the ectodomain of ICOS compared to the reference (e.g., unmodified) or wild-type ICOSL, such as comprising the sequence set forth in SEQ ID NO: 32, 196, or 545.
- the ICOSL exhibits increased affinity for the ectodomain of CD28 compared to the reference (e.g., unmodified) or wild-type ICOSL polypeptide, such as comprising the sequence set forth in SEQ ID NO: 32, 196, or 545.
- the ICOSL exhibits increased affinity for the ectodomain of CD28 compared to the reference (e.g., unmodified) or wild-type ICOSL polypeptid
- polypeptide exhibits increased affinity for the ectodomain of CD28 and the ectodomain of ICOS compared to the reference (e.g., unmodified) or wild-type ICOSL, such as comprising the sequence set forth in SEQ ID NO: 32, 196, or 545.
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution corresponding to position(s) 52, 54 or 57. In some embodiments, the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution selected from N52H, N52D, N52Q, N52S, N52Y, N52K, S54A, S54P, or N57Y or a
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution selected from N52H, N52D, N52S, N52K or N57Y or a conservative amino acid modification, e.g.
- the variant ICOSL polypeptide can contain one or more further amino acid modification, e.g. substitution in addition to an amino acid modification, e.g.
- the one or more further amino acid modification e.g. substitution is at a position corresponding to 10, 11, 13, 16, 18, 20, 25, 27, 30, 37, 42, 43, 47, 52, 54, 57, 61, 62, 67, 71, 72, 74, 75, 77, 78, 80, 84, 89, 90, 92, 93, 94, 96, 97, 98, 99, 100, 102, 103, 107, 109, 110, 113, 115, 116, 117, 119, 120, 121, 122, 126, 129, 130, 132, 133, 135, 138, 139, 140, 142, 143, 144, 146, 151, 152, 153, 154, 155, 156, 158, 161, 166, 168, 172, 173, 175, 190, 192, 193, 194, 198, 201, 203, 207
- the one or more further amino acid modification e.g. substitution is at a position corresponding to 10, 11, 13, 16, 18, 20, 25, 26, 27, 30, 33, 37, 38, 42, 43, 47, 52, 54, 57, 61, 62, 67, 71, 72, 74, 75, 77, 78, 80, 84, 89, 90, 92, 93, 94, 96, 97, 98, 99, 100, 102, 103, 107, 109, 110, 111, 113, 115, 116, 117, 119, 120, 121, 122, 126, 129, 130, 132, 133, 135, 137, 138, 139, 140, 142, 143, 144, 146, 151, 152, 153, 154, 155, 156, 158, 161, 164, 166, 168, 172, 173, 175, 190, 192, 193, 194, 198, 201, 203, 207,
- the variant ICOSL contains one or more further amino acid modification, e.g. substitution selected from M10V, M10I, VI IE, S 13G, E16V, S 18R, A20V, S25G, F27S, F27C, N30D, Y33del, Q37R, K42E, T43A, Y47H, N52H, N52D, N52S, N52Y, N52K, N52Q, S54A, S54P, N57D, N57Y, R61S, R61C, Y62F, L67P, A71T, G72R, L74Q, R75Q, D77G, F78L, L80P, N84Q, D89G, E90A, K92R, F93L, H94E, H94D, L96F, L96I, V97A, L98F, S99G, Q100R, Q100K, Q100P, L102R, G103E, V107A,
- the variant ICOSL contains one or more further amino acid modification, e.g. substitution selected from M10V, Ml 01, VI IE, S 13G, E16V, S 18R, A20T, A20V, S25G, R26S, F27C, F27S, N30D, Y33del, Q37R, T38P, K42E, T43A, Y47H, N52A, N52C, N52D, N52G, N52H, N52K, N52L, N52M, N52P, N52Q, N52R, N52S, N52T, N52V, N52Y, S54A, S54F, S54P, N57A, N57D, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, N57Y, R61C, R61S, Y62F, L67P,
- the variant ICOSL polypeptide further comprises one or more amino acid deletions
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution selected from N52Y/N57Y/F138L/L203P, N52H/N57Y/Q100P, N52S/Y146C/Y152C, N52H/C198R, N52H/C140del/T225A, N52H/C198R/T225A, N52H/K92R, N57Y/Q100P, N52S/C198R, N52Y/N57Y/Y152C, N52Y/N57Y/H129P/C198R, N52H/L161P/C198R, N52S/T113E, N52S/S54P, N52K/L208P, N52S/Y152H, N52H/I143T, N52S/R75Q/L203P, N52S/D158G, N52D/Q133H, N52H/N57Y/Q100R/V110D/
- N52H/C140del/T225A N52H/F78L/Q100R/C198R, N52H/N57Y/R75Q/Q100P/V110D,
- N52H/N57Y/Q100R/V110D/S132F/M175T N52H/N57Y/Q100R/V107I/V110D/I154F/C198R/R221G
- N52Q/N207Q N52Q/N168Q, N52Q/N84Q, N52Q/N119Q
- N52Q/N84Q/N168Q N52Q/N84Q/N207Q, N52Q/N119Q/N155Q, N52H/N84Q/N119Q, N52H/N84Q, N52H/N84Q/N168Q, N52H/N84Q/N207Q, N52H/N84Q/N169Q/N207Q, N52Q/N84Q/N155Q, N52Q/N84Q/N168Q, N52Q/N84Q/N155Q/N168Q, N52Q/N84Q/N119Q/N168Q, N52Q/N84Q/N119Q/N
- N52Q/N84Q/N119Q/N155Q/N207Q N52Y/F138L/L203P, N57Y/Q100R/C198R, N57Y/F138L/L203P, N52H/N57Y/Q100R/H115R/C198R, N52H/N57Y/Q100R/F172S/C198R,
- N52H/N57Y/Q100R/H115R/F172S/I224V N52H/N57Y/Q100R/H115R/F172S, N52H/N57Y/Q100R/F172S, N52H/Q100R/H115R/I143T/F172S, N52H/N57Y/Q1 OOP/HI 15R/F172S, N52Y/N57Y/Q100P/F172S, E16V/N52H/N57Y/Q100R/V110D/H115R/C198R,
- N30D/K42E/N52S/H115R N30D/K42E/N52S/H115R/C198R/R221I
- N30D/K42E/N52S/H115R/C198R N30D/K42E/N52S/H115R/F172S/N194D
- N52S/H115R/F120S/I143V/C198R N30D/K42E/N52S/H115R, N30D/K42E/N52S/H115R/F172S/N194D
- N52S/H115R/F172S/C198R N52H/N57Y/Q100P/C198R, N52H/N57Y/Q100P H115R/F172S/C198R, N52H/N57Y/Q100P/F172S/C198R, N52H/N57Y/Q1 OOP/HI 15R, N52H/N57Y/Q100P/H115R/C198R, N52H/Q100R/C198R, N52H/Q100R/H115R/F172S, N52H/Q100R/F172S/C198R,
- the variant ICOSL polypeptide has one or more amino acid modification, e.g. substitution in an reference ICOSL or specific binding fragment there of corresponding to position(s) 52, 57, or 100 with reference to numbering of SEQ ID NO:32. In some embodiments, the variant ICOSL polypeptide has one or more amino acid modification, e.g.
- substitutions selected from N52A, N52C, N52D, N52G, N52H, N52L, N52K, N52M, N52P, N52Q, N52R, N52S, N52T, N52V, N52Y, N57A, N57E, N57F, N57H, N57K, N57L, N57M, N57P, N57Q, N57S, N57T, N57V, N57W, N57Y, Q100A, Q100D, Q100E, Q100G, Q100K, Q100L, Q100M, Q100N, Q100R, Q100P, Q100S, Q100T, or Q100V.
- the one or more amino acid modification, e.g. substitution is N52Y/N57Y/F138L/L203P,
- N52H/N57Y/Q100P N52S/Y146C/Y152C, N52H/C198R, N52H/C140D/T225A, N52H/C198R/T225A, N52H/K92R, N52H/S99G, N57Y/Q100P, N52S/S130G/Y152C, N52S/Y152C, N52S/C198R,
- N52Y/N57Y/Y152C N52Y/N57Y/Y152C, N52Y/N57Y/H129P/C198R, N52H/L161P/C198R, N52S/T113E, N52D/S54P, N52K/L208P, N52S/Y152H, N52D/V151A, N52H/I143T, N52S/L80P, N52S/R75Q/L203P,
- N52S/N57Y/H94D/L96F/L98F/Q100R/G103E/F120S N52H/F78L/Q100R, N52H/N57Y/Q100R/V110D, N52H/N57Y/R75Q/Q100R/V110D, N52H/N57Y/Q100R, N52H/N57Y/L74Q/Q100R/V110D,
- N52H/Q100R N52H/S121G, A20V/N52H/N57Y/Q100R/S109G,
- N52H/N57Y/R61S/Q100R/V110D/L173S N52H/N57Y/Q100R/V122A, N52H/N57Y/Q100R/F172S, N52H/N57Y, N52S/F120S, N52S/V97A, N52S/G72R, N52S/A71T/A117T, N52S/E220G,
- N52S/H94E/L96I/S109N/L166Q S18R/N52S/F93L/I143V/R221G, A20T/N52D/Y146C/Q164L, V11E/N30D/N52H/N57Y/H94E/L96I/L98F/N194D/V210A I218T, N52S/H94E/L96I/V122M, N52H/N57Y/H94E/L96I/F120I/S126TAV153R/I218N, M10V/S18R/N30D/N52S/S126R/T139S/L203F, S25G/N30D/N52S/F 120S/N227K, N30D/N52S/L67P/Q 100K/D217G/R221 K/T225S ,
- N52H/N57Y/R61C/Y62F/Q100R/V110N/F120S/C198R N52H/N57Y/Q100R/V110D/H115R/C198R
- N52H/N57Y/Q100R/V110D/N144D/F172S/C198R N52S/H94E/L98F/Q100R, N52S/E90A
- N52H/C140del/T225A N52H/F78L/Q100R/C198R, N52H/N57Y/R75Q/Q100P/V110D,
- N52H/N57Y/Q100R/V107I/V110D/I154F/C198R/R221G N52Q/N207Q, N168Q/N207Q, N52Q/N168Q, N52Q/N84Q, N52Q/N119Q, N52Q/N84Q/N168Q, N52Q/N84Q/N207Q, N52Q/N119Q/N155Q, N52H/N84Q/N119Q, N52H/N84Q, N52H/N84Q/N168Q/N207Q, N52Q/N84Q/N155Q/N168Q,
- N52Q/N84Q/N119Q/N168Q N52Q/N84Q/N119Q/N207Q, N52Q/N84Q/N119Q/N155Q,
- N52Q/N84Q/N119Q/N155Q/N207Q N52Y/F138L/L203P, N57Y/Q100R/C198R, N57Y/F138L/L203P, Q100R/F138L, N52H/N57Y/Q100R/H115R/C198R, N52H/N57Y/Q100R/F172S/C198R,
- N52H/N57Y/Q100R/F172S N52H/Q100R/H115R/I143T/F172S, N52H/N57Y/Q1 OOP/HI 15R/F172S, N52Y/N57Y/Q100P/F172S, E16V/N52H/N57Y/Q100R/V110D/H115R/C198R,
- N52S/H115R/F172S/C198R N52H/N57Y/Q100P/C198R, N52H/N57Y/Q100P H115R/F172S/C198R, N52H/N57Y/Q100P/F172S/C198R, N52H/N57Y/Q1 OOP/HI 15R, N52H/N57Y/Q100P/H115R/C198R, N52H/Q100R/C198R, N52H/Q100R/H115R/F172S, N52H/Q100R/F172S/C198R,
- N52H/Q100R/H115R/F172S/C198R N52H/N57Y/Q100R/F172S/C198R, N52A/N57F/Q100S, N52A/N57H/Q100S, N52A/N57Y/Q100A, N52D/N57A/Q100A, N52D/Q100S, N52G/Q100A, N52H/Q100A, N52M/N57H/Q100S, N52M/N57W/Q100P, N52Q/N57F, N52Q/N57S/Q100A, N52R/N57L/Q100A, N52R/N57Y/Q100P, N52R/N57Y/Q100S, N52S/N57A/Q100A,
- N52S/N57H/Q100E N52S/N57L/Q100S, N52S/N57M/Q100S, N52S/N57Y/Q100S,
- N52S/N57Y/Q100M N52S/N57Y/Q100V, N52T/N57H/Q100S, N52T/N57H/Q100A,
- N52T/N57Y/Q100A N52V/N57L/Q100A, N52H/N57Y/Q100K, N52K/N57Y/Q100R,
- N52L/N57H/Q100R N52R/N57F/Q100N, N52R/N57F/Q100P, N52R/N57F/Q100R,
- N52R/N57F/Q100T N52R/N57H/Q100K, N52R/N57L/Q100S, N52R/N57W/Q100K, N52R/N57W, N52R/N57Y/Q100R, N52C/N57E/Q100S, N52G/N57P/Q100D, N52G/N57V/Q100G, N52G/N57V, N52L/N57V, N52P/N57P, N52P/N57S/Q100G, N52S/N57L/Q100G, N52T/N57K/Q100P,
- N52V/N57T/Q100L, or N57Q/Q100P are examples of N52V/N57T/Q100L, or N57Q/Q100P.
- the one or more amino acid modifications are selected from among N52Y/N57Y/F138L/L203P, N52H/N57Y/Q100P, N52S/Y146C/Y152C, N52H/C198R,
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Cell Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Reproductive Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Toxicology (AREA)
- Developmental Biology & Embryology (AREA)
- Pulmonology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Virology (AREA)
- Gynecology & Obstetrics (AREA)
- Dermatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (35)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP25219892.4A EP4717707A2 (en) | 2017-10-18 | 2018-10-17 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| UAA202002918A UA129833C2 (uk) | 2017-10-18 | 2018-10-17 | Гібридний білок, що містить поліпептид варіантного ліганду icos |
| ES18803814T ES3061962T3 (en) | 2017-10-18 | 2018-10-17 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| MX2020004540A MX2020004540A (es) | 2017-10-18 | 2018-10-17 | Proteinas inmunomoduladoras de ligando icos variante y composiciones y metodos relacionados. |
| HRP20260069TT HRP20260069T1 (hr) | 2017-10-18 | 2018-10-17 | Imunomodulatorni proteini s varijantama liganda icos, farmaceutski sastavi i povezani postupci |
| FIEP18803814.5T FI3697810T3 (fi) | 2017-10-18 | 2018-10-17 | Icos-ligandin variantin immunomodulatorisia proteiineja ja niihin liittyviä koostumuksia ja menetelmiä |
| MA50404A MA50404B1 (fr) | 2017-10-18 | 2018-10-17 | Protéines immunomodulatrices à variants de ligand de icos variant, compositions et méthodes associées |
| BR112020007542-6A BR112020007542A2 (pt) | 2017-10-18 | 2018-10-17 | proteínas imunomoduladoras ligantes de icos variantes e composições e métodos relacionados |
| DK18803814.5T DK3697810T3 (da) | 2017-10-18 | 2018-10-17 | Immunmodulerende proteiner af icos-ligand-varianten og tilsvarende sammensætninger og fremgangsmåder |
| EP18803814.5A EP3697810B1 (en) | 2017-10-18 | 2018-10-17 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| SI201831296T SI3697810T1 (sl) | 2017-10-18 | 2018-10-17 | Imunomodulatorni proteini variantnega liganda icos in z njimi povezani sestavki in postopki |
| KR1020207014230A KR102776394B1 (ko) | 2017-10-18 | 2018-10-17 | 변이체 icos 리간드 면역조절 단백질 및 관련 조성물 및 방법 |
| MYPI2020001960A MY203416A (en) | 2017-10-18 | 2018-10-17 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| EA202090974A EA202090974A1 (ru) | 2017-10-18 | 2018-10-17 | Вариантные иммуномодулирующие белки лиганда icos и сопутствующие композиции и способы |
| IL320945A IL320945A (en) | 2017-10-18 | 2018-10-17 | Immunomodulatory proteins, ligands for ICOs, and compositions and methods related thereto |
| KR1020257006686A KR20250034197A (ko) | 2017-10-18 | 2018-10-17 | 변이체 icos 리간드 면역조절 단백질 및 관련 조성물 및 방법 |
| LTEPPCT/US2018/056381T LT3697810T (lt) | 2017-10-18 | 2018-10-17 | Icos ligando imunitetą moduliuojančių baltymų variantas bei susijusios kompozicijos ir būdai |
| SM20260062T SMT202600062T1 (it) | 2017-10-18 | 2018-10-17 | Proteine immunomodulatrici del ligando di icos variante e composizioni e metodi correlati |
| CN201880080659.9A CN111712515A (zh) | 2017-10-18 | 2018-10-17 | 变体icos配体免疫调节蛋白及相关组合物和方法 |
| IL273726A IL273726B2 (en) | 2017-10-18 | 2018-10-17 | Immunomodulatory proteins, ligands for ICOs, and compositions and methods related thereto |
| SG11202003078VA SG11202003078VA (en) | 2017-10-18 | 2018-10-17 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| RS20260125A RS67712B1 (sr) | 2017-10-18 | 2018-10-17 | Imunomodulatorni proteini varijanti icos liganda i povezane kompozicije i postupci |
| JP2020521877A JP7282760B2 (ja) | 2017-10-18 | 2018-10-17 | バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法 |
| US16/757,344 US20200283500A1 (en) | 2017-10-18 | 2018-10-17 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| AU2018351000A AU2018351000B2 (en) | 2017-10-18 | 2018-10-17 | Variant ICOS Ligand immunomodulatory proteins and related compositions and methods |
| MDE20200863T MD3697810T2 (ro) | 2017-10-18 | 2018-10-17 | Proteine imunomodulatoare cu variante de ligand ICOS și compoziții și metode asociate |
| PL18803814.5T PL3697810T3 (pl) | 2017-10-18 | 2018-10-17 | Wariant białka immunomodulacyjnego ligandu icos oraz powiązane kompozycje i sposoby |
| CA3078517A CA3078517A1 (en) | 2017-10-18 | 2018-10-17 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| SA520411779A SA520411779B1 (ar) | 2017-10-18 | 2020-04-16 | بروتينات ضابطة للمناعة لمركب ترابطي لمحفز مشترك قابل للحث متباين وتركيبات وطرق ذات صلة |
| PH12020550449A PH12020550449A1 (en) | 2017-10-18 | 2020-04-18 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| US17/560,209 US11613566B2 (en) | 2017-10-18 | 2021-12-22 | Variant ICOS ligand immunomodulatory proteins and related compositions and methods |
| JP2023012510A JP7530457B2 (ja) | 2017-10-18 | 2023-01-31 | バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法 |
| US18/172,258 US20230235012A1 (en) | 2017-10-18 | 2023-02-21 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| AU2024201301A AU2024201301A1 (en) | 2017-10-18 | 2024-02-27 | Variant ICOS Ligand immunomodulatory proteins and related compositions and methods |
| JP2024086832A JP2024103596A (ja) | 2017-10-18 | 2024-05-29 | バリアントicosリガンド免疫調節タンパク質ならびに関連する組成物および方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762574161P | 2017-10-18 | 2017-10-18 | |
| US62/574,161 | 2017-10-18 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/757,344 A-371-Of-International US20200283500A1 (en) | 2017-10-18 | 2018-10-17 | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| US17/560,209 Continuation US11613566B2 (en) | 2017-10-18 | 2021-12-22 | Variant ICOS ligand immunomodulatory proteins and related compositions and methods |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2019079520A2 true WO2019079520A2 (en) | 2019-04-25 |
| WO2019079520A3 WO2019079520A3 (en) | 2019-05-23 |
Family
ID=64316982
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/056381 Ceased WO2019079520A2 (en) | 2017-10-18 | 2018-10-17 | ICOS VARIANT LIGAND IMMUNOMODULATORY IMMUNOMODULATORY PROTEINS, COMPOSITIONS AND METHODS THEREOF |
Country Status (31)
| Country | Link |
|---|---|
| US (3) | US20200283500A1 (enExample) |
| EP (2) | EP3697810B1 (enExample) |
| JP (3) | JP7282760B2 (enExample) |
| KR (2) | KR102776394B1 (enExample) |
| CN (1) | CN111712515A (enExample) |
| AR (1) | AR113455A1 (enExample) |
| AU (2) | AU2018351000B2 (enExample) |
| BR (1) | BR112020007542A2 (enExample) |
| CA (1) | CA3078517A1 (enExample) |
| DK (1) | DK3697810T3 (enExample) |
| EA (1) | EA202090974A1 (enExample) |
| ES (1) | ES3061962T3 (enExample) |
| FI (1) | FI3697810T3 (enExample) |
| HR (1) | HRP20260069T1 (enExample) |
| IL (2) | IL320945A (enExample) |
| LT (1) | LT3697810T (enExample) |
| MA (1) | MA50404B1 (enExample) |
| MD (1) | MD3697810T2 (enExample) |
| MX (1) | MX2020004540A (enExample) |
| MY (1) | MY203416A (enExample) |
| PH (1) | PH12020550449A1 (enExample) |
| PL (1) | PL3697810T3 (enExample) |
| PT (1) | PT3697810T (enExample) |
| RS (1) | RS67712B1 (enExample) |
| SA (1) | SA520411779B1 (enExample) |
| SG (1) | SG11202003078VA (enExample) |
| SI (1) | SI3697810T1 (enExample) |
| SM (1) | SMT202600062T1 (enExample) |
| TW (2) | TW202500579A (enExample) |
| UA (1) | UA129833C2 (enExample) |
| WO (1) | WO2019079520A2 (enExample) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020214867A1 (en) * | 2019-04-17 | 2020-10-22 | Alpine Immune Sciences, Inc. | Methods and uses of variant icos ligand (icosl) fusion proteins |
| US10882914B2 (en) | 2016-04-15 | 2021-01-05 | Alpine Immune Sciences, Inc. | ICOS ligand variant immunomodulatory proteins and uses thereof |
| WO2021181233A3 (en) * | 2020-03-09 | 2021-11-04 | Pfizer Inc. | Cd80-fc fusion protein and uses thereof |
| WO2022034375A1 (en) * | 2020-08-12 | 2022-02-17 | Migal Galilee Research Institute Ltd. | Alloreactive immune cell-distancing device and uses thereof for protecting donor-derived cells from allorejection |
| US11319359B2 (en) | 2015-04-17 | 2022-05-03 | Alpine Immune Sciences, Inc. | Immunomodulatory proteins with tunable affinities |
| JP2022545167A (ja) * | 2019-08-30 | 2022-10-26 | アロジーン セラピューティクス,インコーポレイテッド | Tgfベータ結合ドメインを含むキメラサイトカイン受容体 |
| US20230015408A1 (en) * | 2019-11-20 | 2023-01-19 | Gi Cell, Inc. | Medium composition for culturing t cells and method for culturing t cells using same |
| US11613566B2 (en) | 2017-10-18 | 2023-03-28 | Alpine Immune Sciences, Inc. | Variant ICOS ligand immunomodulatory proteins and related compositions and methods |
| US12065476B2 (en) | 2018-06-15 | 2024-08-20 | Alpine Immune Sciences, Inc. | PD-1 variant immunomodulatory proteins and uses thereof |
| EP4506358A4 (en) * | 2022-05-03 | 2026-04-15 | Univ Korea Res & Bus Found | ICOS-L VARIANT WITH IMPROVED BOND AFFINITY FOR ICOS |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7749319B2 (ja) | 2017-10-10 | 2025-10-06 | アルパイン イミューン サイエンシズ インコーポレイテッド | Ctla-4変異型免疫調節タンパク質およびそれらの使用 |
| AU2019205273B2 (en) | 2018-01-03 | 2024-04-04 | Alpine Immune Sciences, Inc. | Multi-domain immunomodulatory proteins and methods of use thereof |
| BR112022002028A2 (pt) * | 2019-08-02 | 2022-04-12 | Cttq Akeso Shanghai Biomed Tech Co Ltd | Anticorpo anti-pd-1 e uso farmacêutico do mesmo |
| EP4146684A2 (en) | 2020-05-08 | 2023-03-15 | Alpine Immune Sciences, Inc. | April and baff inhibitory immunomodulatory proteins with and without a t cell inhibitory protein and methods of use thereof |
Citations (126)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1993010151A1 (en) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Receptor for oncostatin m and leukemia inhibitory factor |
| WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| US5443964A (en) | 1987-08-10 | 1995-08-22 | Duke University | Poxvirus insertion/expression vector |
| US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5698530A (en) | 1991-05-06 | 1997-12-16 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant virus expressing human carcinoembryonic antigen and methods of use thereof |
| US5716826A (en) | 1988-03-21 | 1998-02-10 | Chiron Viagene, Inc. | Recombinant retroviruses |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5767071A (en) | 1995-06-07 | 1998-06-16 | Ixsys Incorporated | Sevenmer cyclic peptide inhibitors of diseases involving αv β3 |
| US5780426A (en) | 1995-06-07 | 1998-07-14 | Ixsys, Incorporated | Fivemer cyclic peptide inhibitors of diseases involving αv β3 |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
| WO1999038955A2 (en) | 1998-01-29 | 1999-08-05 | Biovex Limited | Mutant herpes simplex viruses and uses thereof |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US5998205A (en) | 1994-11-28 | 1999-12-07 | Genetic Therapy, Inc. | Vectors for tissue-specific replication |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6143290A (en) | 1992-10-13 | 2000-11-07 | The Board Of Regents, University Of Texas System | Tumor regression by adenovirus expression of wild-type p53 |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO2001030843A1 (en) | 1999-10-25 | 2001-05-03 | Novartis Ag | Ligand activated transcriptional regulator proteins |
| US6365619B1 (en) | 1999-07-22 | 2002-04-02 | Novartis Ag | Treatment of arteriosclerosis |
| US6428968B1 (en) | 1999-03-15 | 2002-08-06 | The Trustees Of The University Of Pennsylvania | Combined therapy with a chemotherapeutic agent and an oncolytic virus for killing tumor cells in a subject |
| US20020168714A1 (en) | 2000-07-18 | 2002-11-14 | The Scripps Research Institute | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches |
| US6596535B1 (en) | 1999-08-09 | 2003-07-22 | Targeted Genetics Corporation | Metabolically activated recombinant viral vectors and methods for the preparation and use |
| US6632670B1 (en) | 1995-09-08 | 2003-10-14 | Genzyme Corporation | AAV vectors for gene therapy |
| US6635472B1 (en) | 1997-08-15 | 2003-10-21 | Rubicon Laboratory, Inc. | Retrovirus and viral vectors |
| US6653103B2 (en) | 2001-03-30 | 2003-11-25 | Wisconsin Alumni Research Foundation | Inhibition of nucleocytoplasmic transport by vesicular stomatitis virus M protein-like polypeptides |
| US20040009604A1 (en) | 2002-03-27 | 2004-01-15 | Xiaoliu Zhang | Potent oncolytic herpes simplex virus for cancer therapy |
| EP1385466A2 (en) | 2001-05-11 | 2004-02-04 | Wellstat Biologics Corporation | Oncolytic virus therapy |
| US6689871B1 (en) | 1999-02-26 | 2004-02-10 | Amersham Health As | Process for production diphtheria toxin |
| EP1391213A1 (en) | 2002-08-21 | 2004-02-25 | Boehringer Ingelheim International GmbH | Compositions and methods for treating cancer using maytansinoid CD44 antibody immunoconjugates and chemotherapeutic agents |
| US20040063094A1 (en) | 1998-05-20 | 2004-04-01 | Biovex Limited | Mutant herpes simplex viruses and uses thereof |
| US6723316B2 (en) | 1999-12-22 | 2004-04-20 | Onyx Pharmaceuticals, Inc. | Herpes simplex virus-1 Glycoprotein C mutants for treating unwanted hyperproliferative cell growth |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| US20040146488A1 (en) | 2001-10-09 | 2004-07-29 | Fang Hu | Oncolytic microorganisms expressing hsp and uses thereof |
| US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US6855317B2 (en) | 1998-08-07 | 2005-02-15 | University Of Washington | Immunological herpes simplex virus antigens and methods for use thereof |
| EP1520175A2 (en) | 2002-06-28 | 2005-04-06 | Oncolytics Biotech, Inc. | Oncolytic viruses as phenotyping agents for neoplasms |
| US6897045B2 (en) | 1998-05-20 | 2005-05-24 | University Of Iowa Research Foundation | Adeno-associated virus vectors |
| WO2005063816A2 (en) | 2003-12-19 | 2005-07-14 | Genentech, Inc. | Monovalent antibody fragments useful as therapeutics |
| US6936257B1 (en) | 1998-05-29 | 2005-08-30 | The Secretary Of State For Defence | Recombinant Venezuelan equine encephalitis virus vaccine |
| US20050220818A1 (en) | 2002-06-21 | 2005-10-06 | Wellstat Biologics Corporation | Administration of therapeutic viruses |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| US20050260601A1 (en) | 2002-09-09 | 2005-11-24 | Whitt Michael A | Recombinant mutants of rhabdovirus and methods of use thereof |
| EP1606411A1 (en) | 2003-03-27 | 2005-12-21 | Ottawa Health Research Institute | Mutant vesicular stomatitis viruses and use thereof |
| US20060024298A1 (en) | 2002-09-27 | 2006-02-02 | Xencor, Inc. | Optimized Fc variants |
| US6998252B1 (en) | 1982-11-30 | 2006-02-14 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant poxviruses having foreign DNA expressed under the control of poxvirus regulatory sequences |
| US7001765B2 (en) | 1996-03-06 | 2006-02-21 | Medigene Ag | Adeno-associated virus vector for boosting immunogenicity of cells |
| US20060039894A1 (en) | 2004-06-24 | 2006-02-23 | Ian Mohr | Avirulent oncolytic herpes simplex virus strains engineered to counter the innate host response |
| WO2006019447A1 (en) | 2004-07-15 | 2006-02-23 | Xencor, Inc. | Optimized fc variants |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7033826B2 (en) | 1995-06-23 | 2006-04-25 | Aventis Pharma S.A. | Recombinant adenoviruses, use thereof for preparing AAVS, complementary cell line, and pharmaceutical compositions containing said adenoviruses |
| US7153510B1 (en) | 1995-05-04 | 2006-12-26 | Yale University | Recombinant vesiculoviruses and their uses |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| US7172893B2 (en) | 1998-11-10 | 2007-02-06 | University Of North Carolina At Chapel Hill | Virus vectors and methods of making and administering the same |
| US20070098743A1 (en) | 2003-03-27 | 2007-05-03 | Bell John C | Mutant vesicular stomatitis viruses and uses thereof |
| WO2007052029A1 (en) | 2005-11-03 | 2007-05-10 | Biovex Limited | Oncolytic herpes virus vectors |
| US20070110720A1 (en) | 2003-11-17 | 2007-05-17 | Brown Susanne M | Vectors, mutant viruses and methods for generating mutant viruses |
| US7238526B2 (en) | 1997-09-19 | 2007-07-03 | The Trustees Of The University Of Pennsylvania | Methods and cell line useful for production of recombinant adeno-associated viruses |
| US7241447B1 (en) | 1999-10-07 | 2007-07-10 | University Of Iowa Research Foundation | Adeno-associated virus vectors and uses thereof |
| US7247615B2 (en) | 2001-11-30 | 2007-07-24 | United States Of America, Represented By The Secretary, Department Of Health And Human Services | Peptide agonists of prostate-specific antigen and uses therefor |
| US20070202572A1 (en) | 2003-06-18 | 2007-08-30 | Szalay Aladar A | Microorganisms for therapy |
| EP1870459A1 (en) | 2005-03-31 | 2007-12-26 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| WO2008011636A2 (en) | 2006-07-21 | 2008-01-24 | California Institute Of Technology | Targeted gene delivery for dendritic cell vaccination |
| US7368116B2 (en) | 1994-10-03 | 2008-05-06 | The United States Of America As Represented By The Department Of Health And Human Services | Method of enhancing a targeted immune response against tumors |
| US7378087B2 (en) | 1994-09-23 | 2008-05-27 | Tapimmune, Inc. | Method of enhancing an immune response |
| WO2008092117A2 (en) | 2007-01-25 | 2008-07-31 | Xencor, Inc. | Immunoglobulins with modifications in the fcr binding region |
| WO2008155134A1 (en) | 2007-06-21 | 2008-12-24 | Technische Universität München | Biological active proteins having increased in vivo and/or vitro stability |
| US20090010889A1 (en) | 2003-11-17 | 2009-01-08 | Crusade Laboratories Limited | Treatment Using Herpes Simplex Virus |
| US20090053244A1 (en) | 2006-10-16 | 2009-02-26 | Nanhai Chen | Modified vaccinia virus strains for use in diagnostic and therapeutic methods |
| US20090117034A1 (en) | 2007-06-15 | 2009-05-07 | Nanhai Chen | Microorganisms for imaging and/or treatment of tumors |
| US7537924B2 (en) | 2000-01-21 | 2009-05-26 | Biovex Limited | Virus strains |
| US20090136917A1 (en) | 2007-10-25 | 2009-05-28 | Szalay Aladar A | Systems and methods for viral therapy |
| WO2009067800A1 (en) | 2007-11-27 | 2009-06-04 | Viventia Biotech Inc. | Antibodies against a cancer-associated epitope of variant nfkbib and uses thereof |
| WO2009076524A2 (en) | 2007-12-11 | 2009-06-18 | The University Of North Carolina At Chapel Hill | Polypurine tract modified retroviral vectors |
| US7550296B2 (en) | 2004-12-01 | 2009-06-23 | Bayer Schering Pharma Ag | Generation of replication competent viruses for therapeutic use |
| US20090162288A1 (en) | 2007-07-18 | 2009-06-25 | Nanhai Chen | Use of modified vaccinia virus strains in combination with a chemotherapeutic agent for use in therapeutic methods |
| US20090215147A1 (en) | 2005-06-23 | 2009-08-27 | Baylor College Of Medicine | Use of Mutant Herpes Simplex Virus-2 for Cancer Therapy |
| US20090274728A1 (en) | 2003-11-17 | 2009-11-05 | Crusade Laboratories Limited | Mutant Viruses |
| US20090285860A1 (en) | 2008-04-04 | 2009-11-19 | The General Hospital Corporation | Cancer immunotherapy |
| US7662627B2 (en) | 1994-06-06 | 2010-02-16 | Nationwide Children's Hospital, Inc. | Adeno-associated virus materials and methods |
| US20100092515A1 (en) | 2007-02-16 | 2010-04-15 | Crusade Laboratories Limited | Herpes simplex viruses and methods of viral replication |
| US20100113567A1 (en) | 2001-07-11 | 2010-05-06 | University Of Miami | Recombinant VSV For The Treatment of Tumor Cells |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US20100172877A1 (en) | 2009-01-08 | 2010-07-08 | Yale University | Compositions and methods of use of an oncolytic vesicular stomatitis virus |
| US20100178684A1 (en) | 2006-12-21 | 2010-07-15 | Woo Savio L C | Transgenic oncolytic viruses and uses thereof |
| US7811814B2 (en) | 2004-05-18 | 2010-10-12 | Children's Memorial Hospital | Tetracycline-regulated adeno-associated viral (AAV) vectors for gene delivery to the nervous system |
| US7906111B2 (en) | 2003-09-30 | 2011-03-15 | The Trustees Of The University Of Pennsylvania | Adeno-associated virus (AAV) clades, sequences, vectors containing same, and uses therefor |
| US20110064650A1 (en) | 2008-05-16 | 2011-03-17 | Szalay Aladar A | Microorganisms for preventing and treating neoplasms accompanying cellular therapy |
| US20110064763A1 (en) | 2009-07-24 | 2011-03-17 | Immune Design Corp. | Lentiviral vectors pseudotyped with a sindbis virus envelope glycoprotein |
| US7927585B2 (en) | 2002-04-30 | 2011-04-19 | University Of Florida Research Foundation, Inc. | Production of recombinant AAV virions |
| WO2011056983A1 (en) | 2009-11-05 | 2011-05-12 | Genentech, Inc. | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
| US7943374B2 (en) | 2005-08-21 | 2011-05-17 | Markus Hildinger | Super-size adeno-associated viral vector harboring a recombinant genome larger than 5.7 kb |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| US7968340B2 (en) | 1999-07-15 | 2011-06-28 | Medigene Ag | Structural protein of adeno-associated virus with modified antigenicity, its production and its use |
| US20110177032A1 (en) | 2008-05-29 | 2011-07-21 | The General Hospital Corporation D/B/A Massachusetts General Hospital | Use on oncolytic herpes viruses for killing cancer stem cells |
| US8007780B2 (en) | 2004-06-03 | 2011-08-30 | Genzyme Corporation | AAV vectors for gene delivery to the lung |
| US20110212530A1 (en) | 2005-06-01 | 2011-09-01 | California Institute Of Technology | Method of targeted gene delivery using viral vectors |
| WO2011133886A2 (en) | 2010-04-23 | 2011-10-27 | Genentech, Inc. | Production of heteromultimeric proteins |
| US20110293705A1 (en) | 2008-11-24 | 2011-12-01 | Massachusetts Institute Of Technology | Methods and compositions for localized agent delivery |
| WO2012125850A1 (en) | 2011-03-16 | 2012-09-20 | Amgen Inc. | Fc variants |
| WO2012141984A1 (en) | 2011-04-08 | 2012-10-18 | Immune Design Corp. | Immunogenic compositions and methods of using the compositions for inducing humoral and cellular immune responses |
| WO2012149364A1 (en) | 2011-04-28 | 2012-11-01 | Diamond Don J | Tumor associated vaccines and compositions for disrupting tumor-derived immunosuppression for use in combination cancer immunotherapy |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013130683A2 (en) | 2012-02-27 | 2013-09-06 | Amunix Operating Inc. | Xten conjugate compositions and methods of making same |
| WO2013149167A1 (en) | 2012-03-30 | 2013-10-03 | Immune Design Corp. | Lentiviral vector particles having improved transduction efficiency for cells expressing dc- sign |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| US20140050708A1 (en) | 2011-01-18 | 2014-02-20 | THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA a university | Compositions and Methods for Treating Cancer |
| US20140099309A1 (en) | 2012-10-05 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Use of a Trans-Signaling Approach in Chimeric Antigen Receptors |
| US20140227237A1 (en) | 2011-09-16 | 2014-08-14 | The Trustees Of The University Of Pennsylvania | Rna engineered t cells for the treatment of cancer |
| US20140322129A1 (en) | 2013-03-14 | 2014-10-30 | Genentech, Inc. | Anti-b7-h4 antibodies and immunoconjugates |
| US8911726B2 (en) | 2004-09-22 | 2014-12-16 | Kyowa Hakko Kirin Co., Ltd | Stabilized human Igg4 antibodies |
| WO2014198002A1 (en) | 2013-06-14 | 2014-12-18 | Ottawa Hospital Research Institute | A bacterium producing an interferon binding protein and uses thereof |
| WO2015107026A1 (en) | 2014-01-15 | 2015-07-23 | F. Hoffmann-La Roche Ag | Fc-region variants with modified fcrn- and maintained protein a-binding properties |
| US9103831B2 (en) | 2009-07-16 | 2015-08-11 | University College Cork-National University Of Ireland Cork | Orally administered bacteria as vehicles for systemic delivery of agents |
| US20150359909A1 (en) | 2009-07-16 | 2015-12-17 | University College Cork-National University Of Ireland, Cork | Orally administered bacteria as vehicles for systemic delivery of agents |
| US20160017041A1 (en) | 2013-03-15 | 2016-01-21 | Biogen Ma Inc. | Treatment and prevention of acute kidney injury using anti-alpha v beta 5 antibodies |
| WO2016011083A1 (en) | 2014-07-15 | 2016-01-21 | Immune Design Corp. | Prime-boost regimens with a tlr4 agonist adjuvant and a lentiviral vector |
| EP3020816A1 (en) | 2014-11-11 | 2016-05-18 | University College Cork | Bacterial mediated gene therapy |
| US20160271218A1 (en) | 2013-06-27 | 2016-09-22 | Mor Research Applications Ltd. | Soluble ctla-4 molecules and derivatives thereof for treatment of minimal change disease |
| US20160339066A1 (en) | 2014-01-02 | 2016-11-24 | Genelux Corporation | Oncolytic virus adjunct therapy with agents that increase virus infectivity |
| WO2017034916A1 (en) | 2015-08-24 | 2017-03-02 | Eli Lilly And Company | Pd-l1 ("programmed death-ligand 1") antibodies |
Family Cites Families (67)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6218525B1 (en) | 1988-02-25 | 2001-04-17 | The General Hospital Corporation | Nucleic acid encoding CD28 |
| US6887471B1 (en) | 1991-06-27 | 2005-05-03 | Bristol-Myers Squibb Company | Method to inhibit T cell interactions with soluble B7 |
| US5773253A (en) | 1993-01-22 | 1998-06-30 | Bristol-Myers Squibb Company | MYPPPY variants of CTL A4 and uses thereof |
| US6294170B1 (en) | 1997-08-08 | 2001-09-25 | Amgen Inc. | Composition and method for treating inflammatory diseases |
| US5891432A (en) | 1997-07-29 | 1999-04-06 | The Immune Response Corporation | Membrane-bound cytokine compositions comprising GM=CSF and methods of modulating an immune response using same |
| US8624010B1 (en) | 1999-02-03 | 2014-01-07 | Steven K. Yoshinaga | Nucleic acids encoding B7RP1 |
| DK1218504T3 (da) | 1999-09-21 | 2007-11-12 | Genetics Inst Llc | GL50 molekyler og anvendelser deraf |
| US7094874B2 (en) | 2000-05-26 | 2006-08-22 | Bristol-Myers Squibb Co. | Soluble CTLA4 mutant molecules |
| EP1360290A2 (en) | 2000-06-23 | 2003-11-12 | Maxygen, Inc. | Co-stimulatory molecules |
| US7183376B2 (en) | 2000-06-23 | 2007-02-27 | Maxygen, Inc. | Variant B7 co-stimulatory molecules |
| US20040022787A1 (en) | 2000-07-03 | 2004-02-05 | Robert Cohen | Methods for treating an autoimmune disease using a soluble CTLA4 molecule and a DMARD or NSAID |
| EP1935427B1 (en) | 2000-07-03 | 2018-03-07 | Bristol-Myers Squibb Company | Uses of soluble CTLA4 mutant molecules |
| US6635750B1 (en) | 2000-07-20 | 2003-10-21 | Millennium Pharmaceuticals, Inc. | B7-H2 nucleic acids, members of the B7 family |
| AU2002368044A1 (en) | 2001-06-22 | 2004-04-19 | Maxygen, Inc. | Co-stimulatory molecules |
| US7235631B2 (en) | 2002-02-07 | 2007-06-26 | Mayo Foundation For Medical Education And Research | ICOS mutants |
| DK1969007T3 (da) | 2005-12-20 | 2013-11-25 | Bristol Myers Squibb Co | Sammensætninger og fremgangsmåder til fremstilling af en sammensætning |
| SI2856876T1 (en) | 2007-03-30 | 2018-04-30 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| CN101784564B (zh) | 2007-07-13 | 2014-07-02 | 约翰霍普金斯大学 | B7-dc变体 |
| KR101680906B1 (ko) * | 2007-09-26 | 2016-11-30 | 추가이 세이야쿠 가부시키가이샤 | 항체 정상영역 개변체 |
| EP2612867A1 (en) | 2007-11-01 | 2013-07-10 | Perseid Therapeutics LLC | Immunosuppressive polypeptides and nucleic acids |
| CA2769822C (en) * | 2009-08-13 | 2019-02-19 | The Johns Hopkins University | Methods of modulating immune function |
| EP2482849B1 (en) | 2009-09-30 | 2018-06-06 | Memorial Sloan-Kettering Cancer Center | Combination immunotherapy for the treatment of cancer |
| ES2724451T3 (es) | 2010-02-04 | 2019-09-11 | Univ Pennsylvania | ICOS regula fundamentalmente la expansión y la función de linfocitos Th17 humanos inflamatorios |
| HUE030100T2 (en) | 2010-02-19 | 2017-04-28 | Xencor Inc | New CTLA4-IG immunoadhesins |
| CN106432474A (zh) | 2010-03-12 | 2017-02-22 | 艾伯维生物医疗股份有限公司 | Ctla4蛋白和其用途 |
| CN102836441B (zh) | 2011-06-24 | 2019-06-11 | 台北荣民总医院 | 于感染性与恶性疾病的治疗中提升免疫反应的方法 |
| CN103796681B (zh) | 2011-06-30 | 2018-07-20 | 建新公司 | T细胞活化的抑制剂 |
| US9428574B2 (en) | 2011-06-30 | 2016-08-30 | Compugen Ltd. | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
| US8956619B2 (en) | 2011-10-25 | 2015-02-17 | University Of Maryland, Baltimore County | Soluble CD80 as a therapeutic to reverse immune supression in cancer patients |
| WO2013156054A1 (en) * | 2012-04-16 | 2013-10-24 | Universität Stuttgart | The igm and ige heavy chain domain 2 as covalently linked homodimerization modules for the generation of fusion proteins with dual specificity |
| WO2013169338A1 (en) | 2012-05-11 | 2013-11-14 | Medimmune, Llc | Ctla-4 variants |
| KR20150033703A (ko) | 2012-06-27 | 2015-04-01 | 오르반 바이오테크 엘엘씨 | 당뇨병 치료를 위한 ctla4 융합 단백질 |
| EP3508215A3 (en) | 2012-12-03 | 2019-10-02 | Bristol-Myers Squibb Company | Enhancing anti-cancer activity of immunomodulatory fc fusion proteins |
| HK1210964A1 (en) | 2012-12-04 | 2016-05-13 | Oncomed Pharmaceuticals, Inc. | Immunotherapy with binding agents |
| US9944689B2 (en) | 2013-03-07 | 2018-04-17 | The General Hospital Corporation | Human CTLA4 mutants and use thereof |
| GB201311475D0 (en) | 2013-06-27 | 2013-08-14 | Alligator Bioscience Ab | Polypeptides |
| ES2745472T3 (es) | 2013-07-15 | 2020-03-02 | The U S A As Represented By The Secretary Department Of Health And Human Services Office Of Tech Tra | Receptores de células T anti-virus del papiloma humano 16 E6 |
| AU2014319921A1 (en) * | 2013-09-11 | 2016-03-17 | Compugen Ltd. | Anti-VSTM5 antibodies and the use thereof in therapy and diagnosis |
| WO2015113494A1 (zh) | 2014-01-28 | 2015-08-06 | 北京韩美药品有限公司 | 双功能融合蛋白及其制备方法和用途 |
| ES2792849T3 (es) | 2014-02-10 | 2020-11-12 | Univ Emory | Expresión de polipéptido químico con receptores de linfocitos variables en células inmunes y usos para tratar el cáncer |
| EP3699195A3 (en) * | 2014-03-28 | 2020-11-04 | Xencor, Inc. | Bispecific antibodies that bind to cd38 and cd3 |
| US20170042972A1 (en) | 2014-04-25 | 2017-02-16 | Chetan KARYEKAR | Use of ctla4 compound for achieving drug-free remission in subjects with early ra |
| RU2696312C2 (ru) | 2014-07-16 | 2019-08-01 | Трансген Са | Онколитический вирус для экспрессии модуляторов иммунологических контрольных точек |
| AU2015301338C1 (en) * | 2014-08-04 | 2021-07-22 | Baylor Research Institute | Antagonistic anti-OX40L antibodies and methods of their use |
| PT3177640T (pt) | 2014-08-08 | 2020-08-31 | Univ Leland Stanford Junior | Agentes pd-1 de alta afinidade e métodos de utilização |
| EP3188752A2 (en) | 2014-09-03 | 2017-07-12 | Bavarian Nordic A/S | Recombinant modified vaccinia virus ankara (mva) filovirus vaccine |
| US20160145344A1 (en) | 2014-10-20 | 2016-05-26 | University Of Southern California | Murine and human innate lymphoid cells and lung inflammation |
| US20190119353A1 (en) | 2014-11-06 | 2019-04-25 | Children's Research Institute, Children's National Medical Center | Immunotherapeutics for cancer and autoimmune diseases |
| WO2016118577A1 (en) | 2015-01-22 | 2016-07-28 | Medimmune, Llc | Thymosin-beta-four fusion proteins |
| HK1250637A1 (zh) | 2015-04-02 | 2019-01-11 | Cancure Limited | 用於引发免疫应答的剂和组合物 |
| WO2016164428A1 (en) | 2015-04-06 | 2016-10-13 | The Board Of Trustees Of The Leland Stanford Junior University | Receptor-based antagonists of the programmed cell death 1 (pd-1) pathway |
| CN121159719A (zh) * | 2015-04-17 | 2025-12-19 | 高山免疫科学股份有限公司 | 具有可调的亲和力的免疫调节蛋白 |
| TWI715587B (zh) | 2015-05-28 | 2021-01-11 | 美商安可美德藥物股份有限公司 | Tigit結合劑和彼之用途 |
| HUE068868T2 (hu) | 2015-07-30 | 2025-02-28 | Macrogenics Inc | PD-1-hez kötõdõ molekulák és alkalmazásukra szolgáló eljárások |
| CA2993429A1 (en) | 2015-07-31 | 2017-02-09 | Tarveda Therapeutics, Inc. | Compositions and methods for immuno-oncology therapies |
| CN108513576A (zh) | 2015-09-14 | 2018-09-07 | 高山免疫科学股份有限公司 | 可调变体免疫球蛋白超家族结构域和工程改造的细胞治疗 |
| ES2924402T3 (es) | 2015-10-02 | 2022-10-06 | Symphogen As | Anticuerpos anti-PD-1 y composiciones |
| MX2018012472A (es) * | 2016-04-15 | 2019-08-12 | Alpine Immune Sciences Inc | Proteinas inmunomoduladoras variantes de ligando icos y sus usos. |
| WO2017181152A2 (en) | 2016-04-15 | 2017-10-19 | Alpine Immune Sciences, Inc. | Cd80 variant immunomodulatory proteins and uses thereof |
| CN109689096A (zh) | 2016-05-18 | 2019-04-26 | 阿尔伯特爱因斯坦医学院公司 | 变体pd-l1多肽、t细胞调节性多聚体多肽及其使用方法 |
| WO2018022946A1 (en) | 2016-07-28 | 2018-02-01 | Alpine Immune Sciences, Inc. | Cd155 variant immunomodulatory proteins and uses thereof |
| WO2018022945A1 (en) | 2016-07-28 | 2018-02-01 | Alpine Immune Sciences, Inc. | Cd112 variant immunomodulatory proteins and uses thereof |
| WO2018075978A1 (en) | 2016-10-20 | 2018-04-26 | Alpine Immune Sciences, Inc. | Secretable variant immunomodulatory proteins and engineered cell therapy |
| BR112020007542A2 (pt) | 2017-10-18 | 2020-12-01 | Alpine Immune Sciences, Inc. | proteínas imunomoduladoras ligantes de icos variantes e composições e métodos relacionados |
| AU2019205273B2 (en) * | 2018-01-03 | 2024-04-04 | Alpine Immune Sciences, Inc. | Multi-domain immunomodulatory proteins and methods of use thereof |
| WO2019241758A1 (en) | 2018-06-15 | 2019-12-19 | Alpine Immune Sciences, Inc. | Pd-1 variant immunomodulatory proteins and uses thereof |
| MX2021012607A (es) | 2019-04-17 | 2022-03-11 | Alpine Immune Sciences Inc | Metodos y usos de proteinas de fusion de ligando icos (icosl) variante. |
-
2018
- 2018-10-17 BR BR112020007542-6A patent/BR112020007542A2/pt unknown
- 2018-10-17 PL PL18803814.5T patent/PL3697810T3/pl unknown
- 2018-10-17 AU AU2018351000A patent/AU2018351000B2/en active Active
- 2018-10-17 UA UAA202002918A patent/UA129833C2/uk unknown
- 2018-10-17 MD MDE20200863T patent/MD3697810T2/ro unknown
- 2018-10-17 CN CN201880080659.9A patent/CN111712515A/zh active Pending
- 2018-10-17 MX MX2020004540A patent/MX2020004540A/es unknown
- 2018-10-17 SI SI201831296T patent/SI3697810T1/sl unknown
- 2018-10-17 SM SM20260062T patent/SMT202600062T1/it unknown
- 2018-10-17 EA EA202090974A patent/EA202090974A1/ru unknown
- 2018-10-17 TW TW113109818A patent/TW202500579A/zh unknown
- 2018-10-17 SG SG11202003078VA patent/SG11202003078VA/en unknown
- 2018-10-17 DK DK18803814.5T patent/DK3697810T3/da active
- 2018-10-17 KR KR1020207014230A patent/KR102776394B1/ko active Active
- 2018-10-17 KR KR1020257006686A patent/KR20250034197A/ko active Pending
- 2018-10-17 IL IL320945A patent/IL320945A/en unknown
- 2018-10-17 HR HRP20260069TT patent/HRP20260069T1/hr unknown
- 2018-10-17 RS RS20260125A patent/RS67712B1/sr unknown
- 2018-10-17 TW TW107136610A patent/TWI899046B/zh active
- 2018-10-17 EP EP18803814.5A patent/EP3697810B1/en active Active
- 2018-10-17 LT LTEPPCT/US2018/056381T patent/LT3697810T/lt unknown
- 2018-10-17 ES ES18803814T patent/ES3061962T3/es active Active
- 2018-10-17 JP JP2020521877A patent/JP7282760B2/ja active Active
- 2018-10-17 MA MA50404A patent/MA50404B1/fr unknown
- 2018-10-17 IL IL273726A patent/IL273726B2/en unknown
- 2018-10-17 US US16/757,344 patent/US20200283500A1/en not_active Abandoned
- 2018-10-17 MY MYPI2020001960A patent/MY203416A/en unknown
- 2018-10-17 CA CA3078517A patent/CA3078517A1/en active Pending
- 2018-10-17 WO PCT/US2018/056381 patent/WO2019079520A2/en not_active Ceased
- 2018-10-17 PT PT188038145T patent/PT3697810T/pt unknown
- 2018-10-17 FI FIEP18803814.5T patent/FI3697810T3/fi active
- 2018-10-17 EP EP25219892.4A patent/EP4717707A2/en active Pending
- 2018-10-18 AR ARP180103041A patent/AR113455A1/es unknown
-
2020
- 2020-04-16 SA SA520411779A patent/SA520411779B1/ar unknown
- 2020-04-18 PH PH12020550449A patent/PH12020550449A1/en unknown
-
2021
- 2021-12-22 US US17/560,209 patent/US11613566B2/en active Active
-
2023
- 2023-01-31 JP JP2023012510A patent/JP7530457B2/ja active Active
- 2023-02-21 US US18/172,258 patent/US20230235012A1/en active Pending
-
2024
- 2024-02-27 AU AU2024201301A patent/AU2024201301A1/en active Pending
- 2024-05-29 JP JP2024086832A patent/JP2024103596A/ja active Pending
Patent Citations (150)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6998252B1 (en) | 1982-11-30 | 2006-02-14 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant poxviruses having foreign DNA expressed under the control of poxvirus regulatory sequences |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US5385839A (en) | 1985-01-30 | 1995-01-31 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter regulatory DNA sequence |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5443964A (en) | 1987-08-10 | 1995-08-22 | Duke University | Poxvirus insertion/expression vector |
| US5716613A (en) | 1988-03-21 | 1998-02-10 | Chiron Viagene, Inc. | Recombinant retroviruses |
| US5851529A (en) | 1988-03-21 | 1998-12-22 | Guber; Harry E. | Recombinant retroviruses |
| US5716826A (en) | 1988-03-21 | 1998-02-10 | Chiron Viagene, Inc. | Recombinant retroviruses |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5698530A (en) | 1991-05-06 | 1997-12-16 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant virus expressing human carcinoembryonic antigen and methods of use thereof |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993010151A1 (en) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Receptor for oncostatin m and leukemia inhibitory factor |
| US6143290A (en) | 1992-10-13 | 2000-11-07 | The Board Of Regents, University Of Texas System | Tumor regression by adenovirus expression of wild-type p53 |
| WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| US7662627B2 (en) | 1994-06-06 | 2010-02-16 | Nationwide Children's Hospital, Inc. | Adeno-associated virus materials and methods |
| US7378087B2 (en) | 1994-09-23 | 2008-05-27 | Tapimmune, Inc. | Method of enhancing an immune response |
| US7368116B2 (en) | 1994-10-03 | 2008-05-06 | The United States Of America As Represented By The Department Of Health And Human Services | Method of enhancing a targeted immune response against tumors |
| US5998205A (en) | 1994-11-28 | 1999-12-07 | Genetic Therapy, Inc. | Vectors for tissue-specific replication |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US7153510B1 (en) | 1995-05-04 | 2006-12-26 | Yale University | Recombinant vesiculoviruses and their uses |
| US5780426A (en) | 1995-06-07 | 1998-07-14 | Ixsys, Incorporated | Fivemer cyclic peptide inhibitors of diseases involving αv β3 |
| US5767071A (en) | 1995-06-07 | 1998-06-16 | Ixsys Incorporated | Sevenmer cyclic peptide inhibitors of diseases involving αv β3 |
| US7033826B2 (en) | 1995-06-23 | 2006-04-25 | Aventis Pharma S.A. | Recombinant adenoviruses, use thereof for preparing AAVS, complementary cell line, and pharmaceutical compositions containing said adenoviruses |
| US6632670B1 (en) | 1995-09-08 | 2003-10-14 | Genzyme Corporation | AAV vectors for gene therapy |
| US7001765B2 (en) | 1996-03-06 | 2006-02-21 | Medigene Ag | Adeno-associated virus vector for boosting immunogenicity of cells |
| WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
| US6635472B1 (en) | 1997-08-15 | 2003-10-21 | Rubicon Laboratory, Inc. | Retrovirus and viral vectors |
| US7238526B2 (en) | 1997-09-19 | 2007-07-03 | The Trustees Of The University Of Pennsylvania | Methods and cell line useful for production of recombinant adeno-associated viruses |
| WO1999038955A2 (en) | 1998-01-29 | 1999-08-05 | Biovex Limited | Mutant herpes simplex viruses and uses thereof |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US20040063094A1 (en) | 1998-05-20 | 2004-04-01 | Biovex Limited | Mutant herpes simplex viruses and uses thereof |
| US6897045B2 (en) | 1998-05-20 | 2005-05-24 | University Of Iowa Research Foundation | Adeno-associated virus vectors |
| US6936257B1 (en) | 1998-05-29 | 2005-08-30 | The Secretary Of State For Defence | Recombinant Venezuelan equine encephalitis virus vaccine |
| US6855317B2 (en) | 1998-08-07 | 2005-02-15 | University Of Washington | Immunological herpes simplex virus antigens and methods for use thereof |
| US7172893B2 (en) | 1998-11-10 | 2007-02-06 | University Of North Carolina At Chapel Hill | Virus vectors and methods of making and administering the same |
| US7371826B2 (en) | 1999-01-15 | 2008-05-13 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7332581B2 (en) | 1999-01-15 | 2008-02-19 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6689871B1 (en) | 1999-02-26 | 2004-02-10 | Amersham Health As | Process for production diphtheria toxin |
| US6428968B1 (en) | 1999-03-15 | 2002-08-06 | The Trustees Of The University Of Pennsylvania | Combined therapy with a chemotherapeutic agent and an oncolytic virus for killing tumor cells in a subject |
| US7968340B2 (en) | 1999-07-15 | 2011-06-28 | Medigene Ag | Structural protein of adeno-associated virus with modified antigenicity, its production and its use |
| US6365619B1 (en) | 1999-07-22 | 2002-04-02 | Novartis Ag | Treatment of arteriosclerosis |
| US7125717B2 (en) | 1999-08-09 | 2006-10-24 | Targeted Genetics Corporation | Metabolically activated recombinant viral vectors and methods for their preparation and use |
| US6596535B1 (en) | 1999-08-09 | 2003-07-22 | Targeted Genetics Corporation | Metabolically activated recombinant viral vectors and methods for the preparation and use |
| US7241447B1 (en) | 1999-10-07 | 2007-07-10 | University Of Iowa Research Foundation | Adeno-associated virus vectors and uses thereof |
| WO2001030843A1 (en) | 1999-10-25 | 2001-05-03 | Novartis Ag | Ligand activated transcriptional regulator proteins |
| US6723316B2 (en) | 1999-12-22 | 2004-04-20 | Onyx Pharmaceuticals, Inc. | Herpes simplex virus-1 Glycoprotein C mutants for treating unwanted hyperproliferative cell growth |
| US7537924B2 (en) | 2000-01-21 | 2009-05-26 | Biovex Limited | Virus strains |
| US20140154216A1 (en) | 2000-01-21 | 2014-06-05 | Amgen Inc. | Virus strains |
| US20020168714A1 (en) | 2000-07-18 | 2002-11-14 | The Scripps Research Institute | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches |
| US6653103B2 (en) | 2001-03-30 | 2003-11-25 | Wisconsin Alumni Research Foundation | Inhibition of nucleocytoplasmic transport by vesicular stomatitis virus M protein-like polypeptides |
| EP1385466A2 (en) | 2001-05-11 | 2004-02-04 | Wellstat Biologics Corporation | Oncolytic virus therapy |
| US20100113567A1 (en) | 2001-07-11 | 2010-05-06 | University Of Miami | Recombinant VSV For The Treatment of Tumor Cells |
| US20040146488A1 (en) | 2001-10-09 | 2004-07-29 | Fang Hu | Oncolytic microorganisms expressing hsp and uses thereof |
| US7247615B2 (en) | 2001-11-30 | 2007-07-24 | United States Of America, Represented By The Secretary, Department Of Health And Human Services | Peptide agonists of prostate-specific antigen and uses therefor |
| US20040009604A1 (en) | 2002-03-27 | 2004-01-15 | Xiaoliu Zhang | Potent oncolytic herpes simplex virus for cancer therapy |
| US7927585B2 (en) | 2002-04-30 | 2011-04-19 | University Of Florida Research Foundation, Inc. | Production of recombinant AAV virions |
| US20050220818A1 (en) | 2002-06-21 | 2005-10-06 | Wellstat Biologics Corporation | Administration of therapeutic viruses |
| EP1520175A2 (en) | 2002-06-28 | 2005-04-06 | Oncolytics Biotech, Inc. | Oncolytic viruses as phenotyping agents for neoplasms |
| EP1391213A1 (en) | 2002-08-21 | 2004-02-25 | Boehringer Ingelheim International GmbH | Compositions and methods for treating cancer using maytansinoid CD44 antibody immunoconjugates and chemotherapeutic agents |
| US20050260601A1 (en) | 2002-09-09 | 2005-11-24 | Whitt Michael A | Recombinant mutants of rhabdovirus and methods of use thereof |
| US20060024298A1 (en) | 2002-09-27 | 2006-02-02 | Xencor, Inc. | Optimized Fc variants |
| US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| US20070098743A1 (en) | 2003-03-27 | 2007-05-03 | Bell John C | Mutant vesicular stomatitis viruses and uses thereof |
| US7731974B2 (en) | 2003-03-27 | 2010-06-08 | Ottawa Hospital Research Institute | Mutant vesicular stomatitis viruses and uses thereof |
| EP1606411A1 (en) | 2003-03-27 | 2005-12-21 | Ottawa Health Research Institute | Mutant vesicular stomatitis viruses and use thereof |
| US7662398B2 (en) | 2003-06-18 | 2010-02-16 | Genelux Corporation | Microorganisms for therapy |
| US7754221B2 (en) | 2003-06-18 | 2010-07-13 | Genelux Corporation | Microorganisms for therapy |
| US20070212727A1 (en) | 2003-06-18 | 2007-09-13 | Szalay Aladar A | Microorganisms for therapy |
| US20070202572A1 (en) | 2003-06-18 | 2007-08-30 | Szalay Aladar A | Microorganisms for therapy |
| US7588767B2 (en) | 2003-06-18 | 2009-09-15 | Genelux Corporation | Microorganisms for therapy |
| US7588771B2 (en) | 2003-06-18 | 2009-09-15 | Genelux Corporation | Microorganisms for therapy |
| US20100062016A1 (en) | 2003-06-18 | 2010-03-11 | Szalay Aladar A | Microorganisms for therapy |
| US7906111B2 (en) | 2003-09-30 | 2011-03-15 | The Trustees Of The University Of Pennsylvania | Adeno-associated virus (AAV) clades, sequences, vectors containing same, and uses therefor |
| US7897146B2 (en) | 2003-11-17 | 2011-03-01 | Crusade Laboratories Limited | Treatment using herpes simplex virus |
| US20070110720A1 (en) | 2003-11-17 | 2007-05-17 | Brown Susanne M | Vectors, mutant viruses and methods for generating mutant viruses |
| US20110158948A1 (en) | 2003-11-17 | 2011-06-30 | Crusade Laboratories Limited | Treatment Using Herpes Simplex Virus |
| US20090010889A1 (en) | 2003-11-17 | 2009-01-08 | Crusade Laboratories Limited | Treatment Using Herpes Simplex Virus |
| US20090274728A1 (en) | 2003-11-17 | 2009-11-05 | Crusade Laboratories Limited | Mutant Viruses |
| WO2005063816A2 (en) | 2003-12-19 | 2005-07-14 | Genentech, Inc. | Monovalent antibody fragments useful as therapeutics |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| US7811814B2 (en) | 2004-05-18 | 2010-10-12 | Children's Memorial Hospital | Tetracycline-regulated adeno-associated viral (AAV) vectors for gene delivery to the nervous system |
| US8007780B2 (en) | 2004-06-03 | 2011-08-30 | Genzyme Corporation | AAV vectors for gene delivery to the lung |
| US7731952B2 (en) | 2004-06-24 | 2010-06-08 | New York University | Avirulent oncolytic herpes simplex virus strains engineered to counter the innate host response |
| US20060039894A1 (en) | 2004-06-24 | 2006-02-23 | Ian Mohr | Avirulent oncolytic herpes simplex virus strains engineered to counter the innate host response |
| WO2006019447A1 (en) | 2004-07-15 | 2006-02-23 | Xencor, Inc. | Optimized fc variants |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US8911726B2 (en) | 2004-09-22 | 2014-12-16 | Kyowa Hakko Kirin Co., Ltd | Stabilized human Igg4 antibodies |
| US7550296B2 (en) | 2004-12-01 | 2009-06-23 | Bayer Schering Pharma Ag | Generation of replication competent viruses for therapeutic use |
| EP1870459A1 (en) | 2005-03-31 | 2007-12-26 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| US20110212530A1 (en) | 2005-06-01 | 2011-09-01 | California Institute Of Technology | Method of targeted gene delivery using viral vectors |
| US20090215147A1 (en) | 2005-06-23 | 2009-08-27 | Baylor College Of Medicine | Use of Mutant Herpes Simplex Virus-2 for Cancer Therapy |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| US7943374B2 (en) | 2005-08-21 | 2011-05-17 | Markus Hildinger | Super-size adeno-associated viral vector harboring a recombinant genome larger than 5.7 kb |
| WO2007052029A1 (en) | 2005-11-03 | 2007-05-10 | Biovex Limited | Oncolytic herpes virus vectors |
| WO2008011636A2 (en) | 2006-07-21 | 2008-01-24 | California Institute Of Technology | Targeted gene delivery for dendritic cell vaccination |
| US20090098529A1 (en) | 2006-10-16 | 2009-04-16 | Nanhai Chen | Methods for attenuating virus strains for diagnostic and therapeutic uses |
| US20090053244A1 (en) | 2006-10-16 | 2009-02-26 | Nanhai Chen | Modified vaccinia virus strains for use in diagnostic and therapeutic methods |
| US20090155287A1 (en) | 2006-10-16 | 2009-06-18 | Nanhai Chen | Modified vaccinia virus strains for use in diagnostic and therapeutic methods |
| US20100178684A1 (en) | 2006-12-21 | 2010-07-15 | Woo Savio L C | Transgenic oncolytic viruses and uses thereof |
| WO2008092117A2 (en) | 2007-01-25 | 2008-07-31 | Xencor, Inc. | Immunoglobulins with modifications in the fcr binding region |
| US20100092515A1 (en) | 2007-02-16 | 2010-04-15 | Crusade Laboratories Limited | Herpes simplex viruses and methods of viral replication |
| US20090117034A1 (en) | 2007-06-15 | 2009-05-07 | Nanhai Chen | Microorganisms for imaging and/or treatment of tumors |
| US20100233078A1 (en) | 2007-06-15 | 2010-09-16 | Szalay Aladar A | Microorganisms for imaging and/or treatment of tumors |
| WO2008155134A1 (en) | 2007-06-21 | 2008-12-24 | Technische Universität München | Biological active proteins having increased in vivo and/or vitro stability |
| US20100196325A1 (en) | 2007-07-18 | 2010-08-05 | Szalay Aladar A | Use of modified vaccinia virus strains in combination with a chemotherapeutic agent for use in therapeutic methods |
| US20090162288A1 (en) | 2007-07-18 | 2009-06-25 | Nanhai Chen | Use of modified vaccinia virus strains in combination with a chemotherapeutic agent for use in therapeutic methods |
| US20090136917A1 (en) | 2007-10-25 | 2009-05-28 | Szalay Aladar A | Systems and methods for viral therapy |
| WO2009067800A1 (en) | 2007-11-27 | 2009-06-04 | Viventia Biotech Inc. | Antibodies against a cancer-associated epitope of variant nfkbib and uses thereof |
| WO2009076524A2 (en) | 2007-12-11 | 2009-06-18 | The University Of North Carolina At Chapel Hill | Polypurine tract modified retroviral vectors |
| US20090285860A1 (en) | 2008-04-04 | 2009-11-19 | The General Hospital Corporation | Cancer immunotherapy |
| US20110064650A1 (en) | 2008-05-16 | 2011-03-17 | Szalay Aladar A | Microorganisms for preventing and treating neoplasms accompanying cellular therapy |
| US20110177032A1 (en) | 2008-05-29 | 2011-07-21 | The General Hospital Corporation D/B/A Massachusetts General Hospital | Use on oncolytic herpes viruses for killing cancer stem cells |
| US20110293705A1 (en) | 2008-11-24 | 2011-12-01 | Massachusetts Institute Of Technology | Methods and compositions for localized agent delivery |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US20100172877A1 (en) | 2009-01-08 | 2010-07-08 | Yale University | Compositions and methods of use of an oncolytic vesicular stomatitis virus |
| US20150359909A1 (en) | 2009-07-16 | 2015-12-17 | University College Cork-National University Of Ireland, Cork | Orally administered bacteria as vehicles for systemic delivery of agents |
| US9103831B2 (en) | 2009-07-16 | 2015-08-11 | University College Cork-National University Of Ireland Cork | Orally administered bacteria as vehicles for systemic delivery of agents |
| US20110064763A1 (en) | 2009-07-24 | 2011-03-17 | Immune Design Corp. | Lentiviral vectors pseudotyped with a sindbis virus envelope glycoprotein |
| WO2011056983A1 (en) | 2009-11-05 | 2011-05-12 | Genentech, Inc. | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011133886A2 (en) | 2010-04-23 | 2011-10-27 | Genentech, Inc. | Production of heteromultimeric proteins |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| US20140050708A1 (en) | 2011-01-18 | 2014-02-20 | THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA a university | Compositions and Methods for Treating Cancer |
| WO2012125850A1 (en) | 2011-03-16 | 2012-09-20 | Amgen Inc. | Fc variants |
| WO2012141984A1 (en) | 2011-04-08 | 2012-10-18 | Immune Design Corp. | Immunogenic compositions and methods of using the compositions for inducing humoral and cellular immune responses |
| WO2012149364A1 (en) | 2011-04-28 | 2012-11-01 | Diamond Don J | Tumor associated vaccines and compositions for disrupting tumor-derived immunosuppression for use in combination cancer immunotherapy |
| US20140186401A1 (en) | 2011-04-28 | 2014-07-03 | City Of Hope | Tumor associated vaccines and compositions for disrupting tumor-derived immunosuppression for use in combination cancer immunotherapy |
| US9453227B2 (en) | 2011-04-28 | 2016-09-27 | City Of Hope | Tumor associated vaccines and compositions for disrupting tumor-derived immunosuppression for use in combination cancer immunotherapy |
| US20140227237A1 (en) | 2011-09-16 | 2014-08-14 | The Trustees Of The University Of Pennsylvania | Rna engineered t cells for the treatment of cancer |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013130683A2 (en) | 2012-02-27 | 2013-09-06 | Amunix Operating Inc. | Xten conjugate compositions and methods of making same |
| WO2013149167A1 (en) | 2012-03-30 | 2013-10-03 | Immune Design Corp. | Lentiviral vector particles having improved transduction efficiency for cells expressing dc- sign |
| US20140099309A1 (en) | 2012-10-05 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Use of a Trans-Signaling Approach in Chimeric Antigen Receptors |
| US20140322129A1 (en) | 2013-03-14 | 2014-10-30 | Genentech, Inc. | Anti-b7-h4 antibodies and immunoconjugates |
| US20160017041A1 (en) | 2013-03-15 | 2016-01-21 | Biogen Ma Inc. | Treatment and prevention of acute kidney injury using anti-alpha v beta 5 antibodies |
| WO2014198002A1 (en) | 2013-06-14 | 2014-12-18 | Ottawa Hospital Research Institute | A bacterium producing an interferon binding protein and uses thereof |
| US20160271218A1 (en) | 2013-06-27 | 2016-09-22 | Mor Research Applications Ltd. | Soluble ctla-4 molecules and derivatives thereof for treatment of minimal change disease |
| US20160339066A1 (en) | 2014-01-02 | 2016-11-24 | Genelux Corporation | Oncolytic virus adjunct therapy with agents that increase virus infectivity |
| WO2015107026A1 (en) | 2014-01-15 | 2015-07-23 | F. Hoffmann-La Roche Ag | Fc-region variants with modified fcrn- and maintained protein a-binding properties |
| WO2016011083A1 (en) | 2014-07-15 | 2016-01-21 | Immune Design Corp. | Prime-boost regimens with a tlr4 agonist adjuvant and a lentiviral vector |
| EP3020816A1 (en) | 2014-11-11 | 2016-05-18 | University College Cork | Bacterial mediated gene therapy |
| WO2017034916A1 (en) | 2015-08-24 | 2017-03-02 | Eli Lilly And Company | Pd-l1 ("programmed death-ligand 1") antibodies |
Non-Patent Citations (101)
| Title |
|---|
| "Applications Handbook and Catalog", 2003, pages: 467 - 498 |
| BABAN ET AL., BIOENGINEERED BUGS, vol. 1, no. 6, 2010, pages 385 - 394 |
| BROWN ET AL., J. VIROL., vol. 73, 1999, pages 9011 |
| BRUGGEMANN, M. ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361 |
| BUCHSCHER ET AL., J. VIROL., vol. 66, 1992, pages 2731 - 39 |
| BUSCH; SASSONE-CORSI, TRENDS GENETICS, vol. 6, 1990, pages 36 - 40 |
| CHANG ET AL., BIOORGANIC & MEDICINAL CHEM LETT, vol. 12, 2002, pages 159 - 163 |
| CHARI ET AL., CANCER RESEARCH, vol. 52, 1992, pages 127 - 131 |
| CHATAL: "Monoclonal Antibodies in Immunoscintigraphy", 1989, CRC PRESS |
| CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656 |
| COLBY, D.W. ET AL., METHODS ENZYMOLOGY, vol. 388, 2004, pages 348 - 358 |
| COLCHER ET AL.: "Use Of Monoclonal Antibodies as Radiopharmaceuticals For The Localization Of Human Carcinoma Xenografts In Athymic Mice", METH. ENZYMOL., vol. 121, 1986, pages 802 - 16 |
| CORNETTA ET AL., HUM. GENE THER., vol. 2, 1991, pages 215 |
| CRAGG, M. S. ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052 |
| CRAGG, M. S.; M. J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743 |
| CURRENT OPINION IN BIOTECHNOLOGY, vol. 20, no. 6, 2009, pages 685 - 691 |
| DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014 |
| DEISENHOFER ET AL., BIOCHEMISTRY, vol. 20, 1981, pages 2361 - 2370 |
| DUNCAN; WINTER, NATURE, vol. 322, 1988, pages 738 - 40 |
| ENGELMAN ET AL., J. VIROL., vol. 69, 1995, pages 2729 |
| FRAKER ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 80, 1978, pages 49 - 57 |
| GARCIA-ARAGONCILLO ET AL., CURR OPIN MOL THER, vol. 12, 2010, pages 403 - 411 |
| GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| GENTZ ET AL., SCIENCE, vol. 243, 1989, pages 1695 - 1699 |
| GHERADI ET AL., J. GEN. VIROL., vol. 86, 2005, pages 2925 - 36 |
| GUERRA ET AL., J. VIROL., vol. 80, 2006, pages 985 - 98 |
| HALLDEN; PORTELLA, EXPERT OPIN THER TARGETS, vol. 16, 2012, pages 945 - 58 |
| HELLSTROM, I ET AL., PROC. NAT'LACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502 |
| HELLSTROM, I. ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063 |
| HINMAN ET AL., CANCER RES., vol. 53, 1993, pages 3336 - 3342 |
| HU ET AL., J. VIROL., vol. 75, 2001, pages 10300 - 308 |
| HUNTER ET AL., NATURE, vol. 144, 1962, pages 945 |
| IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184 |
| JOHANN ET AL., J. VIROL., vol. 66, 1992, pages 1635 - 40 |
| KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological interest", 1991, US DEPARTMENT OF HEALTH AND HUMAN SERVICES, NIH |
| KEITH D. MILLER; NOAH B. PEFAUR; CHERYL L. BAIRDL: "Current Protocols in Cytometry", July 2008 |
| KIRN ET AL., NAT REV CANCER, vol. 9, 2009, pages 64 - 71 |
| KOLBERG, NIH RES., vol. 4, 1992, pages 43 |
| LABRIJIN ET AL., NAT. BIOTECHNOL., vol. 27, no. 8, 2009, pages 767 - 71 |
| LARSEN ET AL., AMERICAN JOURNAL OF TRANSPLANTATION, vol. 5, 2005, pages 443 - 453 |
| LI; AND KURLANDER, J TRANSL MED., vol. 8, 2010, pages 104 |
| LI; KURLANDER, J TRANSL MED., vol. 8, 2010, pages 104 |
| LIN ET AL., BIOORGANIC & MEDICINAL CHEM LETT, vol. 12, 2002, pages 133 - 136 |
| LINSLEY ET AL., IMMUNITY, vol. 1, 1994, pages 793 - 801 |
| LINSLEY ET AL., IMMUNITY, vol. 1, no. 9, 1994, pages 793 - 801 |
| LIU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 8618 - 8623 |
| LODE ET AL., CANCER RES., vol. 58, 1998, pages 2928 |
| MANDLER ET AL., BIOCONJUGATE CHEM., vol. 13, 2002, pages 786 - 791 |
| MANDLER ET AL., BIOORGANIC & MED. CHEM. LETTERS, vol. 10, 2000, pages 1025 - 1028 |
| MANDLER ET AL., J.NAT. CANCER INST., vol. 92, no. 19, 2000, pages 1573 - 1581 |
| MAYR ET AL., INFECTION, vol. 3, 1975, pages 6 - 14 |
| MCLOUGHLIN ET AL., ANN. SURG. ONCOL., vol. 12, 2005, pages 825 - 30 |
| MCWILLIAMS ET AL., J. VIROL., vol. 77, 2003, pages 11150 |
| MERCHANT, A. M. ET AL., NATURE BIOTECH., vol. 16, 1998, pages 677 - 681 |
| MERCIER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 101, 2004, pages 6188 - 93 |
| MILLER ET AL., J MOL. BIOL., vol. 216, 1990, pages 965 - 973 |
| MILLER ET AL., J. VIROL., vol. 65, 1991, pages 2220 - 24 |
| MILLER ET AL., MOL. CELL BIOL., vol. 10, 1990, pages 4239 |
| MILLER, K.D., CURRENT PROTOCOLS IN CYTOMETRY, July 2008 (2008-07-01) |
| MILONE ET AL., MOLECULAR THERAPY, vol. 17, 2009, pages 1453 - 1464 |
| MIYOSHI ET AL., J. VIROL., vol. 72, 1998, pages 8150 |
| MOLIN ET AL., J. VIROL., vol. 72, 1998, pages 8358 - 61 |
| NARUMI ET AL., AM J. RESPIR. CELL MOL. BIOL., vol. 19, 1998, pages 936 - 41 |
| NIGHTINGALE ET AL., MOL. THERAPY, vol. 13, 2006, pages 1121 |
| NUCLEIC ACIDS RESEARCH, vol. 41, no. D1, January 2013 (2013-01-01), pages D36 - 42 |
| NYGREN, J., HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407 |
| PAIN ET AL., J. IMMUNOL. METH., vol. 40, 1981, pages 219 |
| PATYAR ET AL., J BIOMED SCI, vol. 17, 2010, pages 21 |
| PENIX ET AL., J. EXP. MED., vol. 178, 1993, pages 1483 - 96 |
| PEPER ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 405, 2014, pages 192 - 198 |
| PEREZ DE LA LASTRA ET AL., IMMUNOLOGY, vol. 96, no. 4, April 1999 (1999-04-01), pages 663 - 670 |
| PETKOVA, S. B. ET AL., INT'L. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769 |
| PFEIFER ET AL., ANNU. REV. GENOMICS HUM. GENET., vol. 2, 2001, pages 177 - 211 |
| PHILPOTT; THRASHER, HUMAN GENE THERAPY, vol. 18, 2007, pages 483 |
| POWELL ET AL., J. VIROL., vol. 70, pages 5288 |
| QIN ET AL., J. HEMATOL. ONCOL., vol. 10, 2017, pages 68 |
| RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492 |
| RIDGWAY ET AL., PROT. ENGIN., vol. 9, 1996, pages 617 - 621 |
| RIDGWAY ET AL., PROTEIN ENGINEERING, vol. 9, 1996, pages 617 - 621 |
| ROSENBERG ET AL., NEW ENG. J. OF MED., vol. 319, 1988, pages 1676 |
| ROWLAND ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 21, 1986, pages 183 - 187 |
| SEOW; WOOD, MOLECULAR THERAPY, vol. 17, no. 5, 2009, pages 767 - 777 |
| SHIELDS ET AL., J BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604 |
| SOMMERFELT ET AL., VIROLOGY, vol. 176, 1990, pages 58 - 59 |
| TANGNEY ET AL., BIOENGINEERED BUGS, vol. 1, no. 4, 2010, pages 284 - 287 |
| TAREEN ET AL., MOL. THER., vol. 22, 2014, pages 575 - 587 |
| TARTAGLIA ET AL., AIDS RESEARCH AND HUMAN RETROVIRUSES, vol. 8, 1992, pages 1445 - 47 |
| THOMPSON ET AL., MOL. CELL. BIOL., vol. 12, 1992, pages 1043 - 53 |
| TODD ET AL., J. EXP. MED., vol. 177, 1993, pages 1663 - 74 |
| VAN PIJKEREN ET AL., HUM GENE THER., vol. 21, no. 4, 2010, pages 405 - 416 |
| VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098 |
| WANG ET AL., CANCER IMMUNOL RES., vol. 2, no. 9, September 2014 (2014-09-01), pages 846 - 56 |
| WENSEL; MEARES: "Radioimmunoimaging and Radioimmunotherapy", 1983, ELSEVIER |
| WILSON ET AL., J. VIROL., vol. 63, 1989, pages 2374 - 78 |
| WU ET AL., IMMUNOL LETT, vol. 117, no. 1, 15 April 2008 (2008-04-15), pages 57 - 62 |
| YAO ET AL., IMMUNITY, vol. 34, 2011, pages 729 - 740 |
| YU ET AL., INT. IMMUNOL., vol. 10, 1998, pages 791 - 797 |
| ZHANG ET AL.: "Introduction to the Data Analysis of the Roche xCELLigencesSystem with RTCA Package", BIOCONDUCTOR, 3 May 2016 (2016-05-03) |
| ZHAO; JI, EXP CELL RES., vol. 340, no. 1, 1 January 2016 (2016-01-01), pages 132 - 138 |
| ZUFFEREY ET AL., J. VIROL., vol. 72, 1998, pages 9873 |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12486312B2 (en) | 2015-04-17 | 2025-12-02 | Alpine Immune Sciences, Inc. | Immunomodulatory proteins with tunable affinities |
| US11319359B2 (en) | 2015-04-17 | 2022-05-03 | Alpine Immune Sciences, Inc. | Immunomodulatory proteins with tunable affinities |
| US12110339B2 (en) | 2016-04-15 | 2024-10-08 | Alpine Immune Sciences, Inc. | ICOS ligand variant immunomodulatory proteins and uses thereof |
| US10882914B2 (en) | 2016-04-15 | 2021-01-05 | Alpine Immune Sciences, Inc. | ICOS ligand variant immunomodulatory proteins and uses thereof |
| US11613566B2 (en) | 2017-10-18 | 2023-03-28 | Alpine Immune Sciences, Inc. | Variant ICOS ligand immunomodulatory proteins and related compositions and methods |
| US12065476B2 (en) | 2018-06-15 | 2024-08-20 | Alpine Immune Sciences, Inc. | PD-1 variant immunomodulatory proteins and uses thereof |
| WO2020214867A1 (en) * | 2019-04-17 | 2020-10-22 | Alpine Immune Sciences, Inc. | Methods and uses of variant icos ligand (icosl) fusion proteins |
| US20220218785A1 (en) * | 2019-04-17 | 2022-07-14 | Alpine Immune Sciences, Inc. | Methods and uses of variant icos ligand (icosl) fusion proteins |
| EP4438054A3 (en) * | 2019-04-17 | 2025-01-08 | Alpine Immune Sciences, Inc. | Methods and uses of variant icos ligand (icosl) fusion proteins |
| JP2022545167A (ja) * | 2019-08-30 | 2022-10-26 | アロジーン セラピューティクス,インコーポレイテッド | Tgfベータ結合ドメインを含むキメラサイトカイン受容体 |
| US12528856B2 (en) | 2019-08-30 | 2026-01-20 | Allogene Therapeutics, Inc. | Chimeric cytokine receptors comprising TGF β binding domains |
| US20230015408A1 (en) * | 2019-11-20 | 2023-01-19 | Gi Cell, Inc. | Medium composition for culturing t cells and method for culturing t cells using same |
| US12516290B2 (en) * | 2019-11-20 | 2026-01-06 | Gi Cell, Inc. | Medium composition for culturing T cells and method for culturing T cells using same |
| WO2021181233A3 (en) * | 2020-03-09 | 2021-11-04 | Pfizer Inc. | Cd80-fc fusion protein and uses thereof |
| WO2022034375A1 (en) * | 2020-08-12 | 2022-02-17 | Migal Galilee Research Institute Ltd. | Alloreactive immune cell-distancing device and uses thereof for protecting donor-derived cells from allorejection |
| EP4506358A4 (en) * | 2022-05-03 | 2026-04-15 | Univ Korea Res & Bus Found | ICOS-L VARIANT WITH IMPROVED BOND AFFINITY FOR ICOS |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12110339B2 (en) | ICOS ligand variant immunomodulatory proteins and uses thereof | |
| US11359022B2 (en) | CD80 variant immunomodulatory proteins and uses thereof | |
| US11613566B2 (en) | Variant ICOS ligand immunomodulatory proteins and related compositions and methods | |
| AU2019389151B2 (en) | CD86 variant immunomodulatory proteins and uses thereof | |
| EP3596116A1 (en) | Pd-l1 variant immunomodulatory proteins and uses thereof | |
| EP3491013A1 (en) | Cd155 variant immunomodulatory proteins and uses thereof | |
| WO2018022945A1 (en) | Cd112 variant immunomodulatory proteins and uses thereof | |
| EP3596115A1 (en) | Pd-l2 variant immunomodulatory proteins and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18803814 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 273726 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 3078517 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020521877 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018351000 Country of ref document: AU Date of ref document: 20181017 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20207014230 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018803814 Country of ref document: EP Effective date: 20200518 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020007542 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112020007542 Country of ref document: BR Free format text: REAPRESENTE O RELATORIO DESCRITIVO COM A NUMERACAO DAS PAGINAS CORRIGIDA |
|
| ENP | Entry into the national phase |
Ref document number: 112020007542 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200416 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522440369 Country of ref document: SA |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 1020257006686 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020257006686 Country of ref document: KR |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 320945 Country of ref document: IL |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2018803814 Country of ref document: EP |