WO2019023396A1 - ENHANCED CHIMERIC ANTIGENIC RECEPTORS AND USES THEREOF - Google Patents
ENHANCED CHIMERIC ANTIGENIC RECEPTORS AND USES THEREOF Download PDFInfo
- Publication number
- WO2019023396A1 WO2019023396A1 PCT/US2018/043779 US2018043779W WO2019023396A1 WO 2019023396 A1 WO2019023396 A1 WO 2019023396A1 US 2018043779 W US2018043779 W US 2018043779W WO 2019023396 A1 WO2019023396 A1 WO 2019023396A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- car
- cell
- seq
- amino acid
- cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001111—Immunoglobulin superfamily
- A61K39/001112—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001129—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/15—Natural-killer [NK] cells; Natural-killer T [NKT] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5443—IL-15
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/52—Genes encoding for enzymes or proenzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0646—Natural killers cells [NK], NKT cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5158—Antigen-pulsed cells, e.g. T-cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/17—Hinge-spacer domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/22—Intracellular domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- the present invention relates generally to the fields of immunology and molecular biology. More particularly, it concerns enhanced chimeric antigen receptors (CARs), such as for immune cells.
- CARs chimeric antigen receptors
- T cells of the immune system are capable of recognizing protein patterns specific for tumor cells and to mediate their destruction through a variety of effector mechanisms.
- CARs chimeric antigen receptors
- TAA tumor associated antigen
- the present disclosure provides enhanced chimeric antigen receptors and methods of their use for the treatment of diseases and disorders, including cancer and autoimmune disorders.
- a truncated EGFRvIII referred to as Ev3 (or tEv3), which does not comprise an endodomain or functional EGF binding domain.
- Ev3 comprises truncated domain 1 (LI), truncated domain 2 (CR1), domain 3 (L2), and domain 4 (CR2) of EGFR (as depicted in FIG. 2B).
- the Ev3 may be located in the hinge region of a CAR and can be used for CAR detection and/or ablation of CAR-expressing cells.
- the CAR comprises both a humanized scFv and an Ev3 hinge.
- humanized antigen-binding domains for the CARs such as humanized single chain variable fragments (scFvs).
- scFvs single chain variable fragments
- a chimeric antigen receptor comprising a Ev3 in the hinge of said CAR, wherein said Ev3 hinge links an extracellular domain and at least one intracellular immune signaling domain.
- the Ev3 hinge comprises a transmembrane domain and a non-functional ectodomain of EGFRvIII.
- the Ev3 hinge does not comprise EGFRvIII endodomain.
- the non- functional ectodomain of EGFRvIII has essentially no binding capability to epidermal growth factor (EGF).
- the Ev3 hinge comprises an amino acid sequence with at least 80%, such as at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% sequence identity to SEQ ID NO:2. In some aspects, the Ev3 hinge comprises an amino acid sequence of SEQ ID NO:2.
- the Ev3 may comprise or have at least 80% (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO:2 LEEKK-
- Ev3 may have one, two, three, or more modifications.
- the Ev3 hinge is encoded by a nucleotide sequence with at least 80%, such as at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% sequence identity to SEQ ID NO: l.
- the Ev3 hinge is encoded by a nucleotide sequence of SEQ ID NO: l.
- the extracellular domain of the CAR comprises an antigen- binding domain selected from the group consisting of F(ab')2, Fab', Fab, Fv, and scFv.
- the antigen-binding domain comprises a scFv.
- the scFv is further defined as a humanized scFv.
- the humanized scFv is a scFv according to the embodiments.
- the antigen binding region of the CAR binds one or more tumor associated antigens.
- the one or more tumor associated antigens are selected from the group consisting of CD19, CD319 (CS1), ROR1, CD20, carcinoembryonic antigen, alphafetoprotein, CA-125, MUC-1, epithelial tumor antigen, melanoma-associated antigen, mutated p53, mutated ras, HER2/Neu, ERBB2, folate binding protein, HIV-1 envelope glycoprotein gpl20, HIV-1 envelope glycoprotein gp41, GD2, CD5, CD123, CD23, CD30, CD56, c-Met, mesothelin, GD3, HERV-K, IL-l lRalpha, kappa chain, lambda chain, CSPG4, ERBB2, WT-1, TRAIL/DR4, VEGFR2, CD33, CLL-1 and CD99.
- the one or more tumor-associated antigens are CD19, CD319, CD123, CD5, ROR1, mesothelin, CD33, CLL-1, and/or CD99.
- the scFv does not comprise an EGFR binding domain.
- the at least one signaling domain comprises CD3 ⁇ , CD28, OX40/CD134, 4-1BB/CD137, FcsRIy, ICOS/CD278, ILRB/CD122, IL-2RG/CD132, DAP12, CD70, CD40, or a combination thereof.
- the at least one signaling domain comprises DAP12.
- the CAR comprises IL- 15.
- the CAR comprises CO3C,, CD28, DAP12, and IL- 15.
- the CAR further comprises a suicide gene.
- the suicide gene is inducible caspase 9.
- isolated antigen-specific humanized single chain variable fragments comprising a light chain variable region (VL) and a heavy chain variable region (VH), wherein the scFv is:
- VH comprises an amino acid sequence of SEQ ID NO: 14;
- VL comprises an amino acid sequence of SEQ ID NO: 19 and the VH comprises an amino acid sequence of SEQ ID NO:20;
- VL comprises an amino acid sequence of SEQ ID NO:25 and the VH comprises an amino acid sequence of SEQ ID NO:26;
- VL comprises an amino acid sequence of SEQ ID NO:31 and the VH comprises an amino acid sequence of SEQ ID NO:32;
- VL comprises an amino acid sequence of SEQ ID NO:59 and the VH comprises an amino acid sequence of SEQ ID NO:60;
- VL comprises an amino acid sequence of SEQ ID NO:59 and the VH comprises an amino acid sequence of SEQ ID NO:60;
- CD99-specific and wherein the VL comprises an amino acid sequence of SEQ ID NO:60;
- VH comprises an amino acid sequence of SEQ ID NO:64 or
- the scFv sequences comprise 91, 92, 93, 94, 95, 96, 97, 98, or 99% sequence identity to the framework regions of SEQ ID NOs:6, 12, 18, 24, or 30 and 100% sequence identity to the CDRs of said sequences.
- the CDRs of said sequences may have one, two, or three modifications.
- the scFv is CD19-specific and wherein the VL comprises an amino acid sequence of SEQ ID NO:7 and the VH comprises an amino acid sequence of SEQ ID NO:8.
- the CD19-specific scFv comprises an amino acid sequence of SEQ ID NO:6.
- the scFv is CD 123 -specific and wherein the VL comprises an amino acid sequence of SEQ ID NO: 13 and the VH comprises an amino acid sequence of SEQ ID NO: 14.
- the CD 123 -specific scFv comprises an amino acid sequence of SEQ ID NO: 12.
- the scFv is mesothelin- specific and wherein the VL comprises an amino acid sequence of SEQ ID NO: 19 and the VH comprises an amino acid sequence of SEQ ID NO:20.
- the mesothelin-specific scFv comprises an amino acid sequence of SEQ ID NO: 18.
- the scFv is RORl-specific and wherein the VL comprises an amino acid sequence of SEQ ID NO:25 and the VH comprises an amino acid sequence of SEQ ID NO:26.
- the RORl-specific comprises an amino acid sequence of SEQ ID NO:24.
- the scFv is CD5-specific and wherein the VL comprises an amino acid sequence of SEQ ID NO:31 and the VH comprises an amino acid sequence of SEQ ID NO:32.
- the CD5-specific comprises an amino acid sequence of SEQ ID NO:30.
- the scFv comprises an amino acid sequence with at least 95%, such as at least 96, 97, 98, or 99% sequence identity to framework regions an amino acid sequence of SEQ ID NO:6, 12, 18, 24, or 30.
- isolated polynucleotides encoding the isolated scFvs of the above embodiments.
- the polynucleotide comprises SEQ ID NO:3, 9, 15, 21, or 27.
- the polynucleotide comprises a sequence with at least 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% sequence identity to SEQ ID NO:3, 9, 15, 21, or 27.
- expression vectors comprising isolated nucleotides of the embodiments.
- the vector is further defined as a viral vector.
- isolated nucleic acids comprising a nucleotide sequence encoding the CAR according to any one of the present embodiments.
- host cells engineered to express a CAR comprising a humanized scFv of the present embodiments and/or a truncated EGFRvIII (Ev3) in the hinge region of said CAR.
- the CAR is according to any one of the present embodiments.
- DNA encoding the CAR is integrated into the genome of the cell.
- the host cell is further defined as a CAR immune cell.
- the immune cell is a T cell, peripheral blood lymphocyte, NK cell, invariant NK cell, NKT cell, or stem cell.
- the immune cell is a T cell or a NK cell.
- the stem cell is a mesenchymal stem cell (MSC) or an induced pluripotent stem (iPS) cell.
- the immune cell is derived from an iPS cell.
- the T cell is a CD8 + T cell, CD4 + T cell, or gamma-delta T cell.
- the T cell is a cytotoxic T lymphocyte (CTL).
- CTL cytotoxic T lymphocyte
- the immune cell is allogeneic or autologous. In some aspects, the immune cell is isolated from peripheral blood, cord blood, or bone marrow. In certain aspects, the immune cell is isolated from cord blood. In particular aspects, the cord blood is pooled from 2 or more individual cord blood units.
- compositions comprising a population of immune cells according to any of the present embodiments. Also provided herein are compositions comprising a population of immune cells of any one of present embodiments for use in the treatment of an immune-related disorder.
- a method of treating an immune- related disorder in a subject comprising administering an effective amount of CAR immune cells of any one of the present embodiments, such as comprising a humanized scFv and/or a Ev3 hinge.
- the immune-related disorder is a cancer, autoimmune disorder, graft versus host disease, allograft rejection, or inflammatory condition.
- the immune-related disorder is an inflammatory condition and the immune cells have essentially no expression of glucocorticoid receptor.
- the immune-related disorder is a cancer.
- the immune cells are autologous or allogeneic.
- the cancer is a solid cancer or a hematologic malignancy.
- the method further comprises administering at least a second therapeutic agent.
- the at least a second therapeutic agent comprises chemotherapy, immunotherapy, surgery, radiotherapy, or biotherapy.
- the immune cells and/or the at least a second therapeutic agent are administered intravenously, intraperitoneally, intratracheally, intratumorally, intramuscularly, endoscopically, intralesionally, percutaneously, subcutaneously, regionally, or by direct injection or perfusion.
- the method further comprises administering an anti-EGFR antibody.
- the anti-EGFR antibody is a monoclonal antibody.
- the anti-EGFR antibody is cetuximab or panitumumab.
- the anti-EGFR antibody selectively ablates Ev3-CAR immune cells through antibody-dependent cell- mediated cytotoxicity (ADCC).
- ADCC antibody-dependent cell- mediated cytotoxicity
- the anti-EGFR antibody is fused to a detectable tag and/or a cytotoxic agent.
- the method further comprises imaging the detectable tag, thereby detecting the Ev3-CAR immune cells.
- the anti- EGFR antibody is fused to a cytotoxic agent.
- the cytotoxic agent induces activation of the suicide gene in the Ev3-CAR immune cells.
- the cytotoxic agent results in the ablation of the Ev3-CAR immune cells.
- FIGS. 1A-1B Comparisons between current CARs and Ev3-CAR designs.
- the Ev3 stalk serves as an integrative structure to transduce signals from antigen binding, such as by scFv, as well as an "off switch, such that it can be recognized by clinically accessible antibodies such as cetuximab to ablate CAR-positive immune cells.
- DAP12 may be utilized as the signal booster in Ev3-DAP12 CARs to increase the efficacies of CAR functions in NK cells.
- FIGS. 2A-2C (A) Schematic depicting Ev3 as compared to EGFR which comprise the endodomain and the EGF binding domain.
- B Schematic depicting EGFR variants and fragmets.
- C Sequence of Ev3 comprising only extracellular domains.
- FIGS. 3A-3F Diagrams for retroviral vectors for the antigens CD19 (A), hCD19 (B), CD123 (C), hCD123 (D), and CD99 (E).
- F Construct map for CAR 2.0 using humanized scFv against CD 19 which can be replaced with other scFvs.
- FIGS. 4A-4B (A) Ev3 antibody recognizes CAR19.Ev3.CD28.CD3 , CAR19.Ev3.DAP12.CD3 or humanized CAR19.Ev3.CD3 transduced NK cells. (B) In chromium release assays to assess the killing activity of CAR.19 transduced NK cells against CD19 + Raji tumor targets, it was shown that CAR19.Ev3.CD28.DAP12 NK cells are as effective as CAR19.IgGl.CD28.CD3z transduced NK cells in killing CD19 + Raji cells at multiple effector:target ratios.
- FIGS. 5A-5B (A) Schematic depicting platform for humanization of CARs. (B) Monoclonal antibody sequence analysis. [0035] FIG. 6: Schematic depicting isotypes, allotypes, and idiotypes of antibodies.
- Structural determinants of antibodies are pictured to define the elements isolated and used for the analysis and subsequent CDR/framework graftings.
- 5 major isotypes for human immunoglobulins are further subclassified as indicated (IgGl, 2, 3, 4, IgAl, 2).
- FIGS. 7A-7C (A) Amino acid sequences for hCD19 scFv and mCD19 scFv including VL and VH. The CDR regions are underlined. (B) BLAST analysis of hCD19 scFv and mCD19 scFv to verify their respective species origins by sequence identities or homologies. (C) Summary of analysis comparing mCD19 scFv vs humanized CD19 scFv.
- FIGS. 8A-8D (A) Schematic depicting 3D structure modeling.
- SWISS-MODEL* a fully automated protein structure homology-modeler, 3 -dimensional models of humanized VL and VH domains were generated (anti-CD 19 as specific example shown).
- Structure files were extracted from SAbDab, a structural antibody database, as templates for homology modeling, as well as using PDB structure files which are automatically accessed within SWISS-MODEL.
- FIGS. 9A-9C 3D structure modeling of human CD 19 variable heavy chain.
- FIGS. 10A-10G (A) Schematic depicting human framework grafting showing identification and isolation of the CDR regions from mouse antibodies (left top), distillation of human framework regions (right panel), and human frame work/murine CDR grafting (left bottom). The CDRs and framework regions are gleaned from sequence analysis as described above. (B) Baseline humanization scoring of monoclonal antibody using T20 scoring system (Gao et al, 2013) to enumerate the 'humanness' of particular Ig domains. As controls, VL and VH domains were extracted from antibodies which are currently in the market place for scoring and comparisons. The humanness scores for the indicated antibodies (right most columns) are listed for VL and VH domains.
- C Early therapeutic antibodies approved for the commercial marketpace are either murine or chimeric antibodies (variable mouse regions + human constant regions), while later approvals tend to be humanized or human antibodies.
- the humanness scores tend to cluster for antibodies of the same type (murine, chimeric, humanized, or human), with increasing humanness scores correlative to human contents.
- D Humanization scoring of variable heavy chains by year of FDA approval of antibody.
- the humanness scores tend to cluster for antibodies of the same type (murine, chimeric, humanized, or human), with increasing humanness scores correlative to human contents. Due to the larger sizes of the VH domains, the humanness scores tend to be lower (compared to VL).
- E Humanization scoring for indicated antibodies.
- the frequency of anti-therapeutic antibody responses is shown as % and the size of the patient group evaluated is given in brackets. In general, the more human or humanized an antibody, the less immunogenicity is reported in clinical use.
- F Humanization scoring of variable light chain of hCD19-CAR (SEQ ID NO: l) and mCD19-CAR (SEQ ID NO:3).
- G Humanization scoring of variable heavy chain of hCD19-CAR (SEQ ID NO:2) and mCD19-CAR (SEQ ID NO:4)
- FIGS. 11A-11E (A) Schematic of CD19-CAR and hCD19-CAR constructs. (B) Transduction efficiency of CAR. (C) Cytotoxicity of different CAR constructs against K562 cells. (D) Cytotoxicity of different CAR constructs against Raji cells. (E) Cytotoxicity assay for cells with control CD3 /IgGl CAR or humanized CD3 /IgGl CAR against K562 or Raji cells at indicated effector: target ratios.
- FIGS. 12A-12I (A) CD319-CAR NK transduction. (B) Growth curve of NK cells. (C) CD319 expression in cell lines. (D-F) CD319-CAR NK cytotoxicity assay. (G) Cytotoxicity assay with CD319-CAR NK cells against indicated cell types including K562, MM. IS, and OPM2. (H-I) CD319-CAR NK cells have an effector phenotype.
- Chimeric antigen receptor (CAR) based cellular immunotherapy has shown significant efficacies in cancer treatment, in particular for treatment of leukemia and lymphoma. Nevertheless, currently available CARs can comprise various design defects. Recent clinical results using CARs to reprogram immune cells for targeted cancer immunotherapy have shown potent anti-tumor cytotoxicity. Since most CAR single chain variable fragment (scFv) modules are derivatives of murine antibodies, human anti-mouse immune-reactivity compromises the efficacy of CARs thus derived. [0043] Thus, in some embodiments, the present disclosure provides a platform technology to engineer humanized CARs (hCARs) against antigens.
- hCARs humanized CARs
- the antigens may include CD19 (hCD19CAR), CD123 (hCD123CAR), mesothelin (hMesoCAR), ROR1 (hRORlCAR), CD5 (hCD5CAR), CLL-1 (hCLL-lCAR), and/or CD99 (hCD99CAR) as well as other antigens that may be targeted for treatment of a disease, such as cancer or autoimmune disorders. Accordingly, in certain embodiments, the present disclosure further provides humanized CARs and methods of their use in the treatment of cancer.
- the present disclosure provides a platform for the humanization of CARs, specifically the scFv of the CAR.
- the process follows 5 modular components as described in Example 1. These can include sequence analysis, 3D structure modeling, human framework grafting, humanization scoring, and functional analysis.
- IgG is focused on for the humanization process, making use of extensive sequence variations in the allotypes (i.e., versions of the same isotype) to fine tune for human framework selection (FIG. 2).
- the antibody sequences for human heavy and light chains can be curated in a local database from sources such as GenBank.
- the variable domains may be aligned using IgBLAST (a version of BLAST) to delineate allotypes and sort the sequences according to homologies.
- CDR regions can then be identified and framework sequences are cataloged (FIG. 1A).
- 3D structure modeling may then be performed, such as using a protein structure homology-modeler (e.g., SWISS -MODEL).
- immune cells are engineered to express CARs with the humanized scFvs provided herein.
- the immune cells may be NK cells and/or T cells, such as derived from peripheral blood, umbilical cord blood, or marrow-derived infiltrating lymphocytes.
- the immune cells with a scFv derived from the present humanization platform can mitigate the possibility of human anti-mouse antibody (HAMA) production and associated immune-mediated rejection of genetically modified immune cell therapy products.
- HAMA human anti-mouse antibody
- further embodiments provide methods of treating diseases or disorders by administering immune cells which express CARs with humanized scFvs. These methods can be used to lower immune rejection as well as longer persistence of infused cell therapy products.
- exemplary subjects that may be treated include cancer patients with CD19 + CLL, ALL and NHL; CD 123 -positive malignancies including AML, CML.
- MDS and BPDCN Mesothelin-positive cancers including cancers of the cervix, endometrium, and the head and neck; ROR1 -positive malignancies including CLL (e.g, without prior CAR therapy or those who relapse following CD19-CAR with CD19-negative disease),breast, ovary and pancreatic cancers; CD5 -positive malignancies including ALL and NHL as well as thymic cancer.
- the present disclosure provides CARs comprising truncated EGFRvIII wherein the receptor does not comprise the cytoplasmic endodomain or a functional EGF binding domain, referred to herein as Ev3.
- EGFRvIII is an EGFR variant that is found only in tumor cells, such as glioblastoma multiforme and lung cancer, and not in normal EGFR expressing cells such as epithelial cells.
- EGFRvIII has a somatic mutation resulting in deletion of exons 2-7 (801 base pair in-frame deletion, 267 amino acid missing compared to wild-type). The deletion of EGFRvIII also covers most of domains 1 and 2 resulting in a truncated domain 1 and truncated domain 2.
- EGFRvIII has a specific epitope as a result of the fusion between exon 1 and exon 8 creating an extra glycine residue (amino acids 6-273 are replaced by a glycine residue; i.e., LEEKKGNYVVTD), which forms a tumor- specific antigen, such as for glioblastoma multiforme.
- the truncated EGFRvIII provided herein, referred to as Ev3 (or tEv3), does not comprise an endodomain or functional EGF binding domain.
- Ev3 extracellular domain may be used as the CAR stalk, excluding the transmembrane and intracellular signaling domain, for a) signal transduction, b) cellular marker for assigning CAR positivity and, c) antigenic marker for cell ablation via antibody binding (e.g., with Cetuximab).
- Ev3 comprises truncated domain 1 (LI), truncated domain 2 (CR1), domain 3 (L2), and domain 4 (CR2) of EGFR (as depicted in FIG. 2B).
- FIG. 2C An exemplary sequence of Ev3 is depicted in FIG. 2C.
- the present Ev3 may comprise a sequence at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the sequence in FIG. 2C.
- the cetuximab binding site (in domain 3) is preserved in both Ev3 and wild-type EGFR extracellular domains.
- the Ev3 epitope presents additional binding sites for other antibodies (e.g., MRl, mAb 806, and DH8.3)
- the CARs provided herein can use Ev3 as an integral signal transduction hinge which can double as an antigenic safety switch to covalently link the scFv (i.e., the antigen recognition domain) with the signaling domains (i.e., CD28 and CD3 ⁇ ).
- the Ev3 also allows for detection of CAR immune cells in vitro and in vivo.
- the Ev3 hinge ensures retention of genetic loads (CARs).
- a further aspect of the Ev3 hinge that is provided herein is its ability to be targeted by antibodies, such as MRl, which as specific to EGFRvIII and will not cross-react with domain III and IV of EGFR which is present in other tissues and cells, such as epithelial cells.
- antibodies such as MRl
- Cetuximab and panitumumab are clinically available antibodies and FDA-approved which obviates the need to acquire regulatory approval for idiotypic antibodies for each CAR with different antigenic specificities, such as CD19, CD123, CD5, ROR1, CD33, CD99, and mesothelin.
- the ability to target Ev3-CARs can be used to detect CAR-positive cells and/or controlled cellular ablation.
- Ev3 is not normally expressed in immune cells, such as T or NK cells, enforced expression of Ev3 will specifically mark genetically-modified immune cells.
- Ev3 does not comprise a signaling endodomain as the cytoplasmic domain is removed) or an EGF binding domain
- CARs comprising Ev3 will not respond or crosstalk with EGF signaling pathways (e.g., AR, ARF4, CAV1, CAV3, CBL, CBLB, CBLC, CD44, CDC25A, CRK, CTNNB1, DCN, EGF, GRB 14, Grb2, JAK2, MUC1, NCK1, NCK2, PKCa, PLCG1, PLSCR1, PTPN1, PTPN11, PTPN6, PTPRK, SH2D3A, SH3KBP1, SHC1, SOS1, Src, STAT1, STAT3, STAT3, STAT5A, UBC, WAS) either outside or inside the cell.
- EGF signaling pathways e.g., AR, ARF4, CAV1, CAV3, CBL, CBLB, CBLC, CD44, CDC25A, CRK, CTNNB1, DCN, EGF,
- Ev3 may have one, two, three, or more modifications.
- DAP12 DNAX-activation protein 12
- essentially free in terms of a specified component, is used herein to mean that none of the specified component has been purposefully formulated into a composition and/or is present only as a contaminant or in trace amounts.
- the total amount of the specified component resulting from any unintended contamination of a composition is therefore well below 0.05 % , preferably below 0.01%.
- Most preferred is a composition in which no amount of the specified component can be detected with standard analytical methods.
- exogenous when used in relation to a protein, gene, nucleic acid, or polynucleotide in a cell or organism refers to a protein, gene, nucleic acid, or polynucleotide that has been introduced into the cell or organism by artificial or natural means; or in relation to a cell, the term refers to a cell that was isolated and subsequently introduced to other cells or to an organism by artificial or natural means.
- An exogenous nucleic acid may be from a different organism or cell, or it may be one or more additional copies of a nucleic acid that occurs naturally within the organism or cell.
- An exogenous cell may be from a different organism, or it may be from the same organism.
- an exogenous nucleic acid is one that is in a chromosomal location different from where it would be in natural cells, or is otherwise flanked by a different nucleic acid sequence than that found in nature.
- expression construct or "expression cassette” is meant a nucleic acid molecule that is capable of directing transcription.
- An expression construct includes, at a minimum, one or more transcriptional control elements (such as promoters, enhancers or a structure functionally equivalent thereof) that direct gene expression in one or more desired cell types, tissues or organs. Additional elements, such as a transcription termination signal, may also be included.
- a "vector” or “construct” refers to a macromolecule or complex of molecules comprising a polynucleotide to be delivered to a host cell, either in vitro or in vivo.
- a "plasmid,” a common type of a vector, is an extra-chromosomal DNA molecule separate from the chromosomal DNA that is capable of replicating independently of the chromosomal DNA. In certain cases, it is circular and double- stranded.
- the term "patient” or “subject” refers to a living mammalian organism, such as a human, monkey, cow, sheep, goat, dog, cat, mouse, rat, guinea pig, or transgenic species thereof.
- the patient or subject is a primate.
- Non- limiting examples of human patients are adults, juveniles, infants and fetuses.
- an “immune disorder,” “immune-related disorder,” or “immune-mediated disorder” refers to a disorder in which the immune response plays a key role in the development or progression of the disease. Immune-mediated disorders include autoimmune disorders, allograft rejection, graft versus host disease and inflammatory and allergic conditions.
- An “immune response” is a response of a cell of the immune system, such as a B cell, or a T cell, or innate immune cell to a stimulus. In one embodiment, the response is specific for a particular antigen (an "antigen-specific response").
- tumor-associated antigen refers to proteins, glycoproteins or carbohydrates that are specifically or preferentially expressed by cancer cells.
- An "epitope" is the site on an antigen recognized by an antibody as determined by the specificity of the amino acid sequence. Two antibodies are said to bind to the same epitope if each competitively inhibits (blocks) binding of the other to the antigen as measured in a competitive binding assay. Alternatively, two antibodies have the same epitope if most amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other. Two antibodies are said to have overlapping epitopes if each partially inhibits binding of the other to the antigen, and/or if some amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- Treating" or treatment of a disease or condition refers to executing a protocol, which may include administering one or more drugs to a patient, in an effort to alleviate signs or symptoms of the disease. Desirable effects of treatment include decreasing the rate of disease progression, ameliorating or palliating the disease state, and remission or improved prognosis. Alleviation can occur prior to signs or symptoms of the disease or condition appearing, as well as after their appearance. Thus, “treating” or “treatment” may include “preventing” or "prevention” of disease or undesirable condition. In addition, “treating” or “treatment” does not require complete alleviation of signs or symptoms, does not require a cure, and specifically includes protocols that have only a marginal effect on the patient.
- Prevention includes: (1) inhibiting the onset of a disease in a subject or patient which may be at risk and/or predisposed to the disease but does not yet experience or display any or all of the pathology or symptomatology of the disease, and/or (2) slowing the onset of the pathology or symptomatology of a disease in a subject or patient which may be at risk and/or predisposed to the disease but does not yet experience or display any or all of the pathology or symptomatology of the disease.
- framework region(s) refers to regions of the variable region of an antibody which act as a scaffold for the CDRs.
- the framework regions may comprise the non-CDR sequences of the variable light chain and variable heavy chain.
- the CDRs of a variable region may be determined by methods known in the art, such as by using the Kabat numbering system as described in Sela-Culang et al, 2013; incorporated herein by reference in its entirety.
- the system described by Kabat (CITE) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs.
- pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues, organs, and/or bodily fluids of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.
- “Pharmaceutically acceptable salts” means salts of compounds disclosed herein which are pharmaceutically acceptable, as defined above, and which possess the desired pharmacological activity.
- Such salts include acid addition salts formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like; or with organic acids such as 1,2-ethanedisulfonic acid, 2-hydroxyethanesulfonic acid, 2-naphthalenesulfonic acid, 3-phenylpropionic acid, 4,4'-methylenebis(3-hydroxy-2-ene- 1-carboxylic acid), 4-methylbicyclo[2.2.2]oct-2-ene-l-carboxylic acid, acetic acid, aliphatic mono- and dicarboxylic acids, aliphatic sulfuric acids, aromatic sulfuric acids, benzenesulfonic acid, benzoic acid, camphorsulfonic acid, carbonic acid, cinnamic acid, citric acid, cyclopentanepropionic acid, ethanesulfonic acid, fumaric acid, glucoheptonic acid, gluconic acid
- Pharmaceutically acceptable salts also include base addition salts which may be formed when acidic protons present are capable of reacting with inorganic or organic bases.
- Acceptable inorganic bases include sodium hydroxide, sodium carbonate, potassium hydroxide, aluminum hydroxide and calcium hydroxide.
- Acceptable organic bases include ethanolamine, diethanolamine, triethanolamine, tromethamine, N-methylglucamine and the like. It should be recognized that the particular anion or cation forming a part of any salt of this invention is not critical, so long as the salt, as a whole, is pharmacologically acceptable. Additional examples of pharmaceutically acceptable salts and their methods of preparation and use are presented in Handbook of Pharmaceutical Salts: Properties, and Use (P. H. Stahl & C. G. Wermuth eds., Verlag Helvetica Chimica Acta, 2002).
- a "pharmaceutically acceptable carrier,” “drug carrier,” or simply “carrier” is a pharmaceutically acceptable substance formulated along with the active ingredient medication that is involved in carrying, delivering and/or transporting a chemical agent.
- Drug carriers may be used to improve the delivery and the effectiveness of drugs, including for example, controlled-release technology to modulate drug bioavailability, decrease drug metabolism, and/or reduce drug toxicity. Some drug carriers may increase the effectiveness of drug delivery to the specific target sites.
- Examples of carriers include: liposomes, microspheres (e.g. , made of poly(lactic-co-glycolic) acid), albumin microspheres, synthetic polymers, nanofibers, protein-DNA complexes, protein conjugates, erythrocytes, virosomes, and dendrimers.
- CARs chimeric antigen receptors
- CARs may refer to artificial T cell receptors, chimeric T cell receptors, or chimeric immunoreceptors, for example, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell.
- CARs may be employed to impart the specificity of a monoclonal antibody onto a T cell, thereby allowing a large number of specific T cells to be generated, for example, for use in adoptive cell therapy.
- CARs direct specificity of the cell to a tumor associated antigen, for example.
- CARs comprise an intracellular activation domain, a transmembrane domain, and an extracellular domain comprising a tumor associated antigen binding region.
- CARs comprise fusions of single- chain variable fragments (scFv) derived from monoclonal antibodies, fused to CD3-zeta a transmembrane domain and endodomain.
- scFv single- chain variable fragments
- the specificity of other CAR designs may be derived from ligands of receptors (e.g. , peptides) or from pattern-recognition receptors, such as Dectins.
- the spacing of the antigen-recognition domain can be modified to reduce activation-induced cell death.
- CARs comprise domains for additional co- stimulatory signaling, such as CD3 , FcR, CD27, CD28, CD137, DAP10, and/or OX40.
- molecules can be co-expressed with the CAR, including co-stimulatory molecules, reporter genes for imaging (e.g. , for positron emission tomography), gene products that conditionally ablate the T cells upon addition of a pro-drug, homing receptors, chemokines, chemokine receptors, cytokines, and cytokine receptors.
- APCs antigen presenting cells
- APCs can be intact whole cells such as macrophages, B-cells, endothelial cells, activated T-cells, and dendritic cells; or other molecules, naturally occurring or synthetic, such as purified MHC Class I molecules complexed to 2-microglobulin.
- culturing refers to the in vitro maintenance, differentiation, and/or propagation of cells in suitable media.
- enriched is meant a composition comprising cells present in a greater percentage of total cells than is found in the tissues where they are present in an organism.
- An "anti-cancer” agent is capable of negatively affecting a cancer cell/tumor in a subject, for example, by promoting killing of cancer cells, inducing apoptosis in cancer cells, reducing the growth rate of cancer cells, reducing the incidence or number of metastases, reducing tumor size, inhibiting tumor growth, reducing the blood supply to a tumor or cancer cells, promoting an immune response against cancer cells or a tumor, preventing or inhibiting the progression of cancer, or increasing the lifespan of a subject with cancer.
- sequence identity or “homology” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences. This alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in CURRENT PROTOCOLS IN MOLECULAR BIOLOGY (F. M.
- BLAST BLAST
- truncated refers to a fragment of a protein or domain of a protein which is shorter than the full length protein or domain of a protein.
- the truncation may be by removal of 1 or more amino acids, such as 5, 10, 15, 20, 25, 30 or more amino acids of the full length sequence.
- Certain embodiments of the present disclosure concern immune cells which express a CAR, such as with Ev3 as the hinge of the CAR and/or a humanized scFv as the antigen binding domain of the cAR.
- the immune cells may be T cells (e.g., regulatory T cells, CD4 + T cells, CD8 + T cells, or gamma-delta T cells), NK cells, invariant NK cells, NKT cells, stem cells (e.g., mesenchymal stem cells (MSCs) or induced pluripotent stem (iPSC) cells).
- T cells e.g., regulatory T cells, CD4 + T cells, CD8 + T cells, or gamma-delta T cells
- NK cells e.g., invariant NK cells
- NKT cells e.g., mesenchymal stem cells (MSCs) or induced pluripotent stem (iPSC) cells.
- the cells are monocytes or granulocytes, e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.
- monocytes or granulocytes e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.
- the immune cells may be used as immunotherapy, such as to target cancer cells.
- the immune cells may be isolated from subjects, particularly human subjects.
- the immune cells can be obtained from a subject of interest, such as a subject suspected of having a particular disease or condition, a subject suspected of having a predisposition to a particular disease or condition, or a subject who is undergoing therapy for a particular disease or condition.
- Immune cells can be collected from any location in which they reside in the subject including, but not limited to, blood, cord blood, spleen, thymus, lymph nodes, and bone marrow.
- the isolated immune cells may be used directly, or they can be stored for a period of time, such as by freezing.
- the immune cells may be enriched/purified from any tissue where they reside including, but not limited to, blood (including blood collected by blood banks or cord blood banks), spleen, bone marrow, tissues removed and/or exposed during surgical procedures, and tissues obtained via biopsy procedures. Tissues/organs from which the immune cells are enriched, isolated, and/or purified may be isolated from both living and non-living subjects, wherein the non-living subjects are organ donors.
- the immune cells are isolated from blood, such as peripheral blood or cord blood.
- immune cells isolated from cord blood have enhanced immunomodulation capacity, such as measured by CD4- or CD8-positive T cell suppression.
- the immune cells are isolated from pooled blood, particularly pooled cord blood, for enhanced immunomodulation capacity.
- the pooled blood may be from 2 or more sources, such as 3, 4, 5, 6, 7, 8, 9, 10 or more sources (e.g., donor subjects).
- the population of immune cells can be obtained from a subject in need of therapy or suffering from a disease associated with reduced immune cell activity. Thus, the cells will be autologous to the subject in need of therapy.
- the population of immune cells can be obtained from a donor, preferably a histocompatibility matched donor.
- the immune cell population can be harvested from the peripheral blood, cord blood, bone marrow, spleen, or any other organ/tissue in which immune cells reside in said subject or donor.
- the immune cells can be isolated from a pool of subjects and/or donors, such as from pooled cord blood.
- the donor is preferably allogeneic, provided the cells obtained are subject-compatible in that they can be introduced into the subject. Allogeneic donor cells are may or may not be human- leukocyte-antigen (HLA)-compatible.
- HLA human- leukocyte-antigen
- the immune cells are T cells.
- TILs tumor-infiltrating lymphocytes
- APCs artificial antigen-presenting cells
- beads coated with T cell ligands and activating antibodies or cells isolated by virtue of capturing target cell membrane
- allogeneic cells naturally expressing anti-host tumor T cell receptor (TCR)
- non-tumor-specific autologous or allogeneic cells genetically reprogrammed or "redirected" to express tumor-reactive TCR or chimeric TCR molecules displaying antibody-like tumor recognition capacity known as ''Tbodies.
- the T cells are derived from the blood, bone marrow, lymph, umbilical cord, or lymphoid organs.
- the cells are human cells.
- the cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen.
- the cells include one or more subsets of T cells or other cell types, such as whole T cell populations, CD4 + cells, CD8 + cells, and subpopulations thereof, such as those defined by function, activation state, maturity, potential for differentiation, expansion, recirculation, localization, and/or persistence capacities, antigen- specificity, type of antigen receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and/or degree of differentiation.
- the cells may be allogeneic and/or autologous.
- the cells are pluripotent and/or multipotent, such as stem cells, such as induced pluripotent stem cells (iPSCs).
- the methods include isolating cells from the subject, preparing, processing, culturing, and/or engineering them, as described herein, and re-introducing them into the same patient, before or after cryopreservation.
- T cells e.g., CD4 + and/or CD8 + T cells
- TN naive T
- TEFF effector T cells
- memory T cells and sub-types thereof such as stem cell memory T (TSCM), central memory T (TCM), effector memory T (TEM), or terminally differentiated effector memory T cells, tumor-infiltrating lymphocytes (TIL), immature T cells, mature T cells, helper T cells, cytotoxic T cells, mucosa-associated invariant T (MAIT) cells, naturally occurring and adaptive regulatory T (Treg) cells, helper T cells, such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha/beta T cells, and delta/gamma T cells.
- TIL tumor-infiltrating lymphocytes
- MAIT mucosa-associated invariant T
- Reg adaptive regulatory T
- helper T cells such as TH
- one or more of the T cell populations is enriched for or depleted of cells that are positive for a specific marker, such as surface markers, or that are negative for a specific marker.
- markers are those that are absent or expressed at relatively low levels on certain populations of T cells (e.g., non- memory cells) but are present or expressed at relatively higher levels on certain other populations of T cells (e.g., memory cells).
- T cells are separated from a PBMC sample by negative selection of markers expressed on non-T cells, such as B cells, monocytes, or other white blood cells, such as CD 14.
- a CD4 + or CD8 + selection step is used to separate CD4 + helper and CD8 + cytotoxic T cells.
- Such CD4 + and CD8 + populations can be further sorted into sub-populations by positive or negative selection for markers expressed or expressed to a relatively higher degree on one or more naive, memory, and/or effector T cell subpopulations.
- CD8 + T cells are further enriched for or depleted of naive, central memory, effector memory, and/or central memory stem cells, such as by positive or negative selection based on surface antigens associated with the respective subpopulation.
- enrichment for central memory T (TCM) cells is carried out to increase efficacy, such as to improve long-term survival, expansion, and/or engraftment following administration, which in some aspects is particularly robust in such sub-populations.
- the T cells are autologous T cells.
- tumor samples are obtained from patients and a single cell suspension is obtained.
- the single cell suspension can be obtained in any suitable manner, e.g., mechanically (disaggregating the tumor using, e.g., a gentleMACSTM Dissociator, Miltenyi Biotec, Auburn, Calif.) or enzymatically (e.g., collagenase or DNase).
- Single-cell suspensions of tumor enzymatic digests are cultured in interleukin-2 (IL-2).
- IL-2 interleukin-2
- the cultured T cells can be pooled and rapidly expanded. Rapid expansion provides an increase in the number of antigen-specific T-cells of at least about 50-fold (e.g., 50-, 60-, 70-, 80-, 90-, or 100-fold, or greater) over a period of about 10 to about 14 days. More preferably, rapid expansion provides an increase of at least about 200-fold (e.g., 200-, 300-, 400-, 500-, 600-, 700-, 800-, 900-, or greater) over a period of about 10 to about 14 days.
- 50-fold e.g., 50-, 60-, 70-, 80-, 90-, or 100-fold, or greater
- rapid expansion provides an increase of at least about 200-fold (e.g., 200-, 300-, 400-, 500-, 600-, 700-, 800-, 900-, or greater) over a period of about 10 to about 14 days.
- T cells can be rapidly expanded using non-specific T-cell receptor stimulation in the presence of feeder lymphocytes and either interleukin-2 (IL-2) or interleukin- 15 (IL-15), with IL-2 being preferred.
- the non-specific T-cell receptor stimulus can include around 30 ng/ml of OKT3, a mouse monoclonal anti-CD3 antibody (available from Ortho- McNeil®, Raritan, N.J.).
- T cells can be rapidly expanded by stimulation of peripheral blood mononuclear cells (PBMC) in vitro with one or more antigens (including antigenic portions thereof, such as epitope(s), or a cell) of the cancer, which can be optionally expressed from a vector, such as an human leukocyte antigen A2 (HLA-A2) binding peptide, in the presence of a T-cell growth factor, such as 300 IU/ml IL-2 or IL-15, with IL-2 being preferred.
- HLA-A2 human leukocyte antigen A2
- T-cell growth factor such as 300 IU/ml IL-2 or IL-15, with IL-2 being preferred.
- the in vz ' iro-induced T-cells are rapidly expanded by re- stimulation with the same antigen(s) of the cancer pulsed onto HLA-A2-expressing antigen-presenting cells.
- the T-cells can be re-stimulated with irradiated, autologous lymphocytes or with ir
- the autologous T cells can be modified to express a T cell growth factor that promotes the growth and activation of the autologous T cells.
- Suitable T cell growth factors include, for example, interleukin (IL)-2, IL-7, IL-15, and IL-12.
- IL interleukin
- Suitable methods of modification are known in the art. See, for instance, Sambrook et al., Molecular Cloning: A Laboratory Manual, 3 rd ed., Cold Spring Harbor Press, Cold Spring Harbor, N.Y. 2001; and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, NY, 1994.
- modified autologous T cells express the T cell growth factor at high levels.
- T cell growth factor coding sequences such as that of IL- 12, are readily available in the art, as are promoters, the operable linkage of which to a T cell growth factor coding sequence promote high-level expression.
- the immune cells are natural killer (NK) cells.
- NK cells are a subpopulation of lymphocytes that have spontaneous cytotoxicity against a variety of tumor cells, virus-infected cells, and some normal cells in the bone marrow and thymus. NK cells differentiate and mature in the bone marrow, lymph nodes, spleen, tonsils, and thymus. NK cells can be detected by specific surface markers, such as CD16, CD56, and CD8 in humans. NK cells do not express T cell antigen receptors, the pan T marker CD3, or surface immunoglobulin B cell receptors.
- NK cells are derived from human peripheral blood mononuclear cells (PBMC), unstimulated leukapheresis products (PBSC), human embryonic stem cells (hESCs), induced pluripotent stem cells (iPSCs), bone marrow, or umbilical cord blood by methods well known in the art. Particularly, umbilical CB is used to derive NK cells.
- PBMC peripheral blood mononuclear cells
- hESCs human embryonic stem cells
- iPSCs induced pluripotent stem cells
- bone marrow or umbilical cord blood
- umbilical CB is used to derive NK cells.
- the NK cells are isolated and expanded by the previously described method of ex vivo expansion of NK cells (Spanholtz et al., 2011 ; Shah et al, 2013).
- CB mononuclear cells are isolated by ficoll density gradient centrifugation and cultured in a bioreactor with IL-2 and artificial antigen presenting cells (aAPCs). After 7 days, the cell culture is depleted of any cells expressing CD3 and re-cultured for an additional 7 days. The cells are again CD3-depleted and characterized to determine the percentage of CD56 + /CD3 ⁇ cells or NK cells.
- umbilical CB is used to derive NK cells by the isolation of CD34 + cells and differentiation into CD56VCD3 " cells by culturing in medium contain SCF, IL-7, IL-15, and IL-2.
- the immune cells of the present disclosure may be stem cells, such as induced pluripotent stem cells (PSCs), mesenchymal stem cells (MSCs), or hematopoietic stem cells (HSCs).
- stem cells such as induced pluripotent stem cells (PSCs), mesenchymal stem cells (MSCs), or hematopoietic stem cells (HSCs).
- PSCs induced pluripotent stem cells
- MSCs mesenchymal stem cells
- HSCs hematopoietic stem cells
- the pluripotent stem cells used herein may be induced pluripotent stem (iPS) cells, commonly abbreviated iPS cells or iPSCs.
- iPS induced pluripotent stem
- germ cells any cell can be used as a starting point for iPSCs.
- cell types could be keratinocytes, fibroblasts, hematopoietic cells, mesenchymal cells, liver cells, or stomach cells.
- iPSCs induced pluripotent stem cells
- germ cells any cell can be used as a starting point for iPSCs.
- cell types could be keratinocytes, fibroblasts, hematopoietic cells, mesenchymal cells, liver cells, or stomach cells.
- undifferentiated progenitor cells including somatic stem cells
- differentiated mature cells can be used as sources of somatic cells in the methods disclosed herein.
- Somatic cells can be reprogrammed to produce iPS cells using methods known to one of skill in the art. Generally, nuclear reprogramming factors are used to produce pluripotent stem cells from a somatic cell. In some embodiments, at least three, or at least four, of Klf4, c-Myc, Oct3/4, Sox2, Nanog, and Lin28 are utilized. In other embodiments, Oct3/4, Sox2, c-Myc and Klf4 are utilized or Oct3/4, Sox2, Nanog, and Lin28.
- iPSCs can be cultured in a medium sufficient to maintain pluripotency.
- undefined conditions may be used; for example, pluripotent cells may be cultured on fibroblast feeder cells or a medium that has been exposed to fibroblast feeder cells in order to maintain the stem cells in an undifferentiated state.
- the cell is cultured in the co-presence of mouse embryonic fibroblasts treated with radiation or an antibiotic to terminate the cell division, as feeder cells.
- pluripotent cells may be cultured and maintained in an essentially undifferentiated state using a defined, feeder- independent culture system, such as a TESRTM medium or E8TM/Essential 8TM medium.
- the present disclosure provides enhanced CARs which comprise Ev3 as the hinge or stalk region of the CAR by covalently linking the antigen binding region to the intracellular signaling domain(s).
- the antigen binding region may comprise a single-chain variable fragment (scFv) derived from an anti-antigen binding domain derived from an antibody, such as a mouse anti-human antibody.
- the scFv can target any potential antigen.
- the scFv may be humanized, such as in the framework region of the scFv.
- the accessibility to the detection or ablation antibodies e.g., via ADCC is maintained.
- the Ev3 may comprise or have at least 80% (e.g., 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO:2 LEEKK- GNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRK- VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDIL KT VKEITGFLLIQ AWPENRTDLH AFENLEIIRGRTKQHGQFS LAWS LNITS LGLRS LK EISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQ- VCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPE CLPQAMNITCTGRGPDNCIQCA
- a CD19Ev3-CAR comprising from N-terminal to C-terminal a scFv derived from a mouse anti-human CD 19 monoclonal antibody, a Ev3 hinge including the transmembrane domain, a CD28 endodomain, and a CD3 ⁇ endodomain.
- the CD19Ev3-CAR comprises a humanized CD19 (hCD19) referred to as hCD19Ev3-CAR.
- the CAR may further comprise DAP 12 endodomain, such as between the Ev3 transmembrane domain and the CD3 ⁇ endodomain, such a CD19Ev3DAP12-CAR or hCD19Ev3DAP12-CAR.
- a CD123Ev3-CAR comprising from N-terminal to C-terminal a scFv derived from a mouse anti-human CD 123 monoclonal antibody, a Ev3 hinge including the transmembrane domain, a CD28 endodomain, and a CD3 ⁇ endodomain.
- the CD123Ev3-CAR comprises a humanized CD123 (hCD123) referred to as hCD123Ev3-CAR.
- the CAR may further comprise DAP12 endodomain, such as between the Ev3 transmembrane domain and the CD3 ⁇ endodomain, such a CD123Ev3DAP12-CAR or hCD123Ev3DAP12-CAR.
- a MesoEv3-CAR comprising from N-terminal to C-terminal a scFv derived from a mouse anti-human mesothelin monoclonal antibody, a Ev3 hinge including the transmembrane domain, a CD28 endodomain, and a CD3 ⁇ endodomain.
- the MesoEv3-CAR comprises a humanized Meso (hMeso) referred to as hMesoEv3-CAR.
- the CAR may further comprise DAP12 endodomain, such as between the Ev3 transmembrane domain and the CD3 ⁇ endodomain, such a MesoEv3DAP12-CAR or hMesoEv3DAP12-CAR.
- a RORl-Ev3-CAR comprising from N-terminal to C-terminal a scFv derived from a mouse anti-human RORl monoclonal antibody, a Ev3 hinge including the transmembrane domain, a CD28 endodomain, and a CD3 ⁇ endodomain.
- the RORl-Ev3-CAR comprises a humanized ROR1 (hRORl) referred to as hRORlEv3-CAR.
- the CAR may further comprise DAP 12 endodomain, such as between the Ev3 transmembrane domain and the CD3 ⁇ endodomain, such a RORl-Ev3DAP12-CAR or hRORl-Ev3DAP12-CAR.
- a CD5Ev3-CAR comprising from N-terminal to C-terminal a scFv derived from a mouse anti-human CD5 monoclonal antibody, a Ev3 hinge including the transmembrane domain, a CD28 endodomain, and a CD3 ⁇ endodomain.
- the CD5Ev3-CAR comprises a humanized CD5 (hCD5) referred to as hCD5Ev3-CAR.
- the CAR may further comprise DAP12 endodomain, such as between the Ev3 transmembrane domain and the CD3 ⁇ endodomain, such a CD5Ev3DAP12- CAR or hCD5Ev3DAP12-CAR.
- a CD99Ev3-CAR comprising from N-terminal to C-terminal a scFv derived from a mouse anti-human CD99 monoclonal antibody, a Ev3 hinge including the transmembrane domain, a CD28 endodomain, and a CD3 ⁇ endodomain.
- the CD5Ev3-CAR comprises a humanized CD99 (hCD99) referred to as hCD99Ev3-CAR.
- the CAR may further comprise DAP 12 endodomain, such as between the Ev3 transmembrane domain and the CD3 ⁇ endodomain, such a CD99Ev3DAP12-CAR or hCD99Ev3DAP12-CAR.
- DAP 12 endodomain such as between the Ev3 transmembrane domain and the CD3 ⁇ endodomain, such a CD99Ev3DAP12-CAR or hCD99Ev3DAP12-CAR.
- EGFRvIII is the result of a mutation of exons 2-7 of the EGFR gene which renders the mutant receptor incapable of binding any known ligand as the receptor does not have a complete ligand binding domain.
- the truncated EGFRvIII, Ev3, of the present disclosure further comprises a deletion of the intracellular domain or endodomain of EGFRvIII.
- Ev3 does not comprise a functional EGF binding domain or the intracellular signaling domain of EGFRvIII.
- the Ev3 hinge may comprise a nucleotide sequence of SEQ ID NO: l and/or an amino acid sequence of SEQ ID NO:2.
- the Ev3 hinge has at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% sequence identity with SEQ ID NO: l or SEQ ID NO:2.
- the Ev3 hinge region may comprise a fragment of SEQ ID NO:2 or may comprise additional amino acids on the N-terminal or C-terminal end of the receptor fragment.
- An exemplary schematic of Ev3 is depicted in FIG. 2.
- the inclusion of the truncated EGFRvIII in the hinge region of a CAR allows for retention of genetic cargo load.
- the Ev3 can also be used a safety switch and/or for detection of the CAR in vitro or in vivo.
- the integral Ev4 hinge can be recognized by antibodies, such as clinically accessible monoclonal antibodies (e.g., cetuximab), for detection or cellular ablation.
- the Ev3 does not comprise a ligand binding domain; thus, there is no endogenous function or crosstalk with other pathways.
- the Ev3 is also plays a role in the CAR signal transduction and is tumor specific which can minimize side-effects of CAR therapies.
- the CARs provided herein may have any antigenic specificity useful in the treatment of a disease or disorder.
- the CARs provided herein may comprise more than one antigen, such as two antigens.
- Exemplary antigens include, but are not limited to, CD 19, CD123, mesothelin, CD5, CD47, CLL-1, CD33, CD99, CLL-1, U5snRNP200, CD200, CS1, BAFF-R, ROR-1, CD99, Mesothelin, or BCMA.
- the humanization platform provided herein may be used for the development of a humanized CAR for any given antigen.
- Exemplary antigens with humanized CARs include, but are not limited to, CD19, CD123, mesothelin, CD5, CD47, CLL-1, CD33, CD99, U5snRNP200, CD200, CS1, BAFF-R, ROR-1, or BCMA.
- the encoded light chain variable region comprises one, two, three or all four framework regions of the human PH0879 germline sequence.
- the encoded heavy chain variable region of hCD19 may comprise one, two, three or all four framework regions of the human ACD43442 germline sequence.
- the encoded antigen binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of SEQ ID NO:6, 12, 18, 24, 30, 58 or 61.
- the antigen binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 10, 20 or 30 modifications (e.g., substitutions) of an amino acid sequence of a light chain variable region provided herein, or a sequence with 90-99% identity with an amino acid sequence of SEQ ID NOs:7, 13, 19, 25, 31, 59 or 63; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 10, 20 or 30 modifications (e.g., substitutions) of an amino acid sequence of a heavy chain variable region of SEQ ID NOs:8, 14, 20, 26, 32, 60 or
- a humanized scFv for CD19 is provided herein.
- the humanized CD19 (hCD19) scFv may have a variable light chain sequence of SEQ ID NO:7 (DIQMTQSPSSLSASVGDRVTITCRASQDISKYLNWYQQKPGKVPKLLIYHTSRLHS GVPDRFSGSGSGTDFTLTISSLQPEDVATYYCQQGNTLPYTFGQGTKVEIKR) and a variable heavy chain of SEQ ID NO: 8
- the hCD19 scFv may comprise a V L with at least 80%, 85%, 90%, 91 %, 921 %, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:7 and/or a V H with at least 80%, 85%, 90%, 91%, 921%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:8.
- the hCD19 scFv may comprise an amino acid sequence with at least 80%, 85%, 90%, 91 %, 921 %, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:6.
- the hCD19 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 921 %, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:3.
- the V L of the hCD19 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91 %, 921 %, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:4.
- the V H of the hCD19 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 921 %, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:5.
- a humanized scFv for CD123 is provided herein.
- the humanized CD123 (hCD123) scFv may have a variable light chain sequence of SEQ ID NO: 13 and a variable heavy chain of SEQ ID NO: 14.
- the hCD123 scFv may comprise a V L with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: 13 and/or a V H with at least 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: 14.
- the hCD123 scFv may comprise an amino acid sequence with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 12.
- the hCD123 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:9.
- the V L of the hCD123 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 10.
- the V H of the hCD123 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 11.
- a humanized scFv for mesothelin is provided herein.
- the humanized mesothelin (hMeso) scFv may have a variable light chain sequence of SEQ ID NO: 19 and a variable heavy chain of SEQ ID NO:20.
- the hMeso scFv may comprise a V L with at least 80%, 85%, 90%, 91%, 921%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: 19 and/or a V H with at least 80%, 85%, 90%, 91%, 921%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:20.
- the hMeso scFv may comprise an amino acid sequence with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 18.
- the hMeso scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 15.
- the V L of the hMeso scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 16.
- the VH of the hMeso scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 17.
- a humanized scFv for ROR1 is provided herein.
- the humanized ROR1 (hRORl) scFv may have a variable light chain sequence of SEQ ID NO:25 and a variable heavy chain of SEQ ID NO:26.
- the hRORl scFv may comprise a V L with at least 80%, 85%, 90%, 91%, 921%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:25 and/or a V H with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:26.
- the hRORl scFv may comprise an amino acid sequence with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:24.
- the hRORl scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:21.
- the V L of the hRORl scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:22.
- the V H of the hRORl scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:23.
- a humanized scFv for CD5 is provided herein.
- the humanized CD5 (hCD5) scFv may have a variable light chain sequence of SEQ ID NO:31 and a variable heavy chain of SEQ ID NO:32.
- the hCD5 scFv may comprise a V L with at least 80%, 85%, 90%, 91%, 921%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:31 and/or a V H with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:32.
- the hCD5 scFv may comprise an amino acid sequence with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:30.
- the hCD5 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:27.
- the V L of the hCD5 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:28.
- the V H of the hCD5 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:29.
- a humanized scFv for CD99 is provided herein.
- the humanized CD99 (hCD99) scFv may have a variable light chain sequence of SEQ ID NO: 63 and a variable heavy chain of SEQ ID NO: 64.
- the hCD99 scFv may comprise a V L with at least 80%, 85%, 90%, 91%, 921%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:63 and/or a V H with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:64.
- the hCD99 scFv may comprise an amino acid sequence with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:61.
- the hCD99 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:61.
- a humanized scFv for CD99 is provided herein.
- the humanized CD99 (hCD99) scFv may have a variable light chain sequence of SEQ ID NO: 59 and a variable heavy chain of SEQ ID NO: 60.
- the hCD99 scFv may comprise a V L with at least 80%, 85%, 90%, 91%, 921%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:59 and/or a V H with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:60.
- the hCD99 scFv may comprise an amino acid sequence with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:58.
- the hCD99 scFv may be encoded by a polynucleotide with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:57.
- antigens targeted by the genetically engineered antigen receptors are those expressed in the context of a disease, condition, or cell type to be targeted via the adoptive cell therapy.
- the diseases and conditions are proliferative, neoplastic, and malignant diseases and disorders, including cancers and tumors, including hematologic cancers, cancers of the immune system, such as lymphomas, leukemias, and/or myelomas, such as B, T, and myeloid leukemias, lymphomas, and multiple myelomas.
- the antigen is selectively expressed or overexpressed on cells of the disease or condition, e.g., the tumor or pathogenic cells, as compared to normal or non-targeted cells or tissues, antigens associated with autoimmune or alloimmune disorders, or pathogen-specific antigens.
- the antigen is expressed on normal cells and/or is expressed on the engineered cells.
- antigens include, but are not limited to, antigenic molecules from infectious agents, auto-/self- antigens, tumor-/cancer-associated antigens, and tumor neoantigens.
- the antigens include NY-ESO, EGFRvIII, Muc-1, Her2, CA-125, WT-1, Mage-A3, Mage-A4, Mage-A10, TRAIL/DR4, and CEA.
- Tumor-associated antigens may be derived from prostate, breast, colorectal, lung, pancreatic, renal, mesothelioma, ovarian, or melanoma cancers.
- Exemplary tumor-associated antigens or tumor cell-derived antigens include MAGE 1, 3, and MAGE 4; PRAME; BAGE; RAGE, Lü (also known as NY ESO 1); SAGE; and HAGE or GAGE.
- MAGE 1, 3, and MAGE 4 include PRAME; BAGE; RAGE, Lü (also known as NY ESO 1); SAGE; and HAGE or GAGE.
- These non-limiting examples of tumor antigens are expressed in a wide range of tumor types such as melanoma, lung carcinoma, sarcoma, and bladder carcinoma.
- Prostate cancer tumor- associated antigens include, for example, prostate specific membrane antigen (PSMA), prostate-specific antigen (PSA), prostatic acid phosphates, NKX3.1, and six-transmembrane epithelial antigen of the prostate (STEAP).
- PSMA prostate specific membrane antigen
- PSA prostate-specific antigen
- NKX3.1 prostatic acid phosphates
- STEAP six-transmembrane epithelial antigen of the prostate
- Other tumor associated antigens include Plu-1, HASH-1, HasH-2,
- a tumor antigen may be a self peptide hormone, such as whole length gonadotrophin hormone releasing hormone, a short 10 amino acid long peptide, useful in the treatment of many cancers.
- Tumor antigens include tumor antigens derived from cancers that are characterized by tumor-associated antigen expression, such as HER-2/neu expression.
- Tumor- associated antigens of interest include lineage- specific tumor antigens such as the melanocyte- melanoma lineage antigens MART- 1/Melan-A, gplOO, gp75, mda-7, tyrosinase and tyrosinase-related protein.
- tumor-associated antigens include, but are not limited to, tumor antigens derived from or comprising any one or more of, p53, Ras, c-Myc, cytoplasmic serine/threonine kinases (e.g., A-Raf, B-Raf, and C-Raf, cyclin-dependent kinases), MAGE- Al, MAGE-A2, MAGE- A3, MAGE-A4, MAGE-A6, MAGE-A10, MAGE-A12, MART- 1, BAGE, DAM-6, -10, GAGE-1 , -2, -8, GAGE- 3, -4, -5, -6, -7B, NA88-A, MART-1, MC1R, GplOO, PSA, PSM, Tyrosinase, TRP-1 , TRP-2, ART-4, CAMEL, CEA, Cyp-B, hTERT, hTRT, iCE, MUC1, MUC2, Phosphos, M
- Antigens may include epitopic regions or epitopic peptides derived from genes mutated in tumor cells or from genes transcribed at different levels in tumor cells compared to normal cells, such as telomerase enzyme, survivin, mesothelin, mutated ras, bcr/abl rearrangement, Her2/neu, mutated or wild-type p53, cytochrome P450 1B 1, and abnormally expressed intron sequences such as N-acetylglucosaminyltransferase-V; clonal rearrangements of immunoglobulin genes generating unique idio types in myeloma and B-cell lymphomas; tumor antigens that include epitopic regions or epitopic peptides derived from oncoviral processes, such as human papilloma virus proteins E6 and E7; Epstein bar virus protein LMP2; nonmutated oncofetal proteins with a tumor-selective expression, such as carcinoembryonic antigen and al
- an antigen is obtained or derived from a pathogenic microorganism or from an opportunistic pathogenic microorganism (also called herein an infectious disease microorganism), such as a virus, fungus, parasite, and bacterium.
- an infectious disease microorganism such as a virus, fungus, parasite, and bacterium.
- antigens derived from such a microorganism include full-length proteins.
- Illustrative pathogenic organisms whose antigens are contemplated for use in the method described herein include human immunodeficiency virus (HIV), herpes simplex virus (HSV), respiratory syncytial virus (RSV), cytomegalovirus (CMV), Epstein-Barr virus (EBV), Influenza A, B, and C, vesicular stomatitis virus (VSV), vesicular stomatitis virus (VSV), polyomavirus (e.g., BK virus and JC virus), adenovirus, Staphylococcus species including Methicillin-resistant Staphylococcus aureus (MRS A), and Streptococcus species including Streptococcus pneumoniae.
- HSV human immunodeficiency virus
- HSV herpes simplex virus
- RSV respiratory syncytial virus
- CMV cytomegalovirus
- EBV Epstein-Barr virus
- Influenza A B, and C
- VSV
- proteins derived from these and other pathogenic microorganisms for use as antigen as described herein and nucleotide sequences encoding the proteins may be identified in publications and in public databases such as GENBANK®, Swiss-Prot®, and TrEMBL®.
- Antigens derived from human immunodeficiency virus include any of the HIV virion structural proteins (e.g., gpl20, gp41, pl7, p24), protease, reverse transcriptase, or HIV proteins encoded by tat, rev, nef, vif, vpr and vpu.
- Antigens derived from herpes simplex virus include, but are not limited to, proteins expressed from HSV late genes. The late group of genes predominantly encodes proteins that form the virion particle.
- Such proteins include the five proteins from (UL) which form the viral capsid: UL6, UL18, UL35, UL38 and the major capsid protein UL19, UL45, and UL27, each of which may be used as an antigen as described herein.
- Other illustrative HSV proteins contemplated for use as antigens herein include the ICP27 (HI, H2), glycoprotein B (gB) and glycoprotein D (gD) proteins.
- the HSV genome comprises at least 74 genes, each encoding a protein that could potentially be used as an antigen.
- Antigens derived from cytomegalovirus include CMV structural proteins, viral antigens expressed during the immediate early and early phases of virus replication, glycoproteins I and III, capsid protein, coat protein, lower matrix protein pp65 (ppUL83), p52 (ppUL44), IE1 and 1E2 (UL123 and UL122), protein products from the cluster of genes from UL128-UL150 (Rykman, et al , 2006), envelope glycoprotein B (gB), gH, gN, and ppl50.
- CMV proteins for use as antigens described herein may be identified in public databases such as GenBank®, Swiss-Prot®, and TrEMBL®.
- Antigens derived from Epstein-Ban virus (EBV) that are contemplated for use in certain embodiments include EBV lytic proteins gp350 and gpl lO, EBV proteins produced during latent cycle infection including Epstein-Ban nuclear antigen (EBNA)-l, EBNA-2, EBNA-3A, EBNA-3B, EBNA-3C, EBNA-leader protein (EBNA-LP) and latent membrane proteins (LMP)-l, LMP-2A and LMP-2B.
- EBV lytic proteins gp350 and gpl lO EBV proteins produced during latent cycle infection including Epstein-Ban nuclear antigen (EBNA)-l, EBNA-2, EBNA-3A, EBNA-3B, EBNA-3C, EBNA-leader protein (EBNA-LP) and latent membrane proteins (LMP)-l, LMP-2A and LMP-2B.
- Antigens derived from respiratory syncytial virus that are contemplated for use herein include any of the eleven proteins encoded by the RSV genome, or antigenic fragments thereof: NS 1, NS2, N (nucleocapsid protein), M (Matrix protein) SH, G and F (viral coat proteins), M2 (second matrix protein), M2-1 (elongation factor), M2-2 (transcription regulation), RNA polymerase, and phosphoprotein P.
- Antigens derived from Vesicular stomatitis virus (VSV) that are contemplated for use include any one of the five major proteins encoded by the VSV genome, and antigenic fragments thereof: large protein (L), glycoprotein (G), nucleoprotein (N), phosphoprotein (P), and matrix protein (M).
- Antigens derived from an influenza virus that are contemplated for use in certain embodiments include hemagglutinin (HA), neuraminidase (NA), nucleoprotein (NP), matrix proteins Ml and M2, NS1, NS2 (NEP), PA, PB1, PB1-F2, and PB2.
- Exemplary viral antigens also include, but are not limited to, adenovirus polypeptides, alphavirus polypeptides, calicivirus polypeptides (e.g., a calicivirus capsid antigen), coronavirus polypeptides, distemper virus polypeptides, Ebola virus polypeptides, enterovirus polypeptides, flavivirus polypeptides, hepatitis virus (AE) polypeptides (a hepatitis B core or surface antigen, a hepatitis C virus El or E2 glycoproteins, core, or non-structural proteins), herpesvirus polypeptides (including a herpes simplex virus or varicella zoster virus glycoprotein), infectious peritonitis virus polypeptides, leukemia virus polypeptides, Marburg virus polypeptides, orthomyxovirus polypeptides, papilloma virus polypeptides, parainfluenza virus polypeptides (e.g.
- the antigen may be bacterial antigens.
- a bacterial antigen of interest may be a secreted polypeptide.
- bacterial antigens include antigens that have a portion or portions of the polypeptide exposed on the outer cell surface of the bacteria.
- Antigens derived from Staphylococcus species including Methicillin- resistant Staphylococcus aureus (MRSA) that are contemplated for use include virulence regulators, such as the Agr system, Sar and Sae, the Arl system, Sar homologues (Rot, MgrA, SarS, SarR, SarT, SarU, SarV, SarX, SarZ and TcaR), the Srr system and TRAP.
- MRSA Methicillin- resistant Staphylococcus aureus
- Staphylococcus proteins that may serve as antigens include Clp proteins, HtrA, MsrR, aconitase, CcpA, SvrA, Msa, CfvA and CfvB (see, e.g., Staphylococcus: Molecular Genetics, 2008 Caister Academic Press, Ed. Jodi Lindsay).
- Staphylococcus Molecular Genetics, 2008 Caister Academic Press, Ed. Jodi Lindsay.
- the genomes for two species of Staphylococcus aureus N315 and Mu50 have been sequenced and are publicly available, for example at PATRIC (PATRIC: The VBI PathoSystems Resource Integration Center, Snyder et al. , 2007).
- Staphylococcus proteins for use as antigens may also be identified in other public databases such as GenBank®, Swiss-Prot®, and TrEMBL®.
- Antigens derived from Streptococcus pneumoniae that are contemplated for use in certain embodiments described herein include pneumolysin, PspA, choline-binding protein A (CbpA), NanA, NanB, SpnHL, PavA, LytA, Pht, and pilin proteins (RrgA; RrgB; RrgC).
- Antigenic proteins of Streptococcus pneumoniae are also known in the art and may be used as an antigen in some embodiments.
- S. pneumoniae proteins for use herein may also be identified in other public databases such as GenBank®, Swiss-Prot®, and TrEMBL®. Proteins of particular interest for antigens according to the present disclosure include virulence factors and proteins predicted to be exposed at the surface of the pneumococci.
- bacterial antigens examples include, but are not limited to, Actinomyces polypeptides, Bacillus polypeptides, Bacteroides polypeptides, Bordetella polypeptides, Bartonella polypeptides, Borrelia polypeptides (e.g., B.
- influenzae type b outer membrane protein Helicobacter polypeptides, Klebsiella polypeptides, L-form bacteria polypeptides, Leptospira polypeptides, Listeria polypeptides, Mycobacteria polypeptides, Mycoplasma polypeptides, Neisseria polypeptides, Neorickettsia polypeptides, Nocardia polypeptides, Pasteurella polypeptides, Peptococcus polypeptides, Peptostreptococcus polypeptides, Pneumococcus polypeptides (i.e., S.
- pneumoniae polypeptides (see description herein), Proteus polypeptides, Pseudomonas polypeptides, Rickettsia polypeptides, Rochalimaea polypeptides, Salmonella polypeptides, Shigella polypeptides, Staphylococcus polypeptides, group A streptococcus polypeptides (e.g., S. pyogenes M proteins), group B streptococcus (S. agalactiae) polypeptides, Treponema polypeptides, and Yersinia polypeptides (e.g., Y pestis Fl and V antigens).
- group A streptococcus polypeptides e.g., S. pyogenes M proteins
- group B streptococcus (S. agalactiae) polypeptides e.g., Treponema polypeptides
- fungal antigens include, but are not limited to, Absidia polypeptides, Acremonium polypeptides, Alternaria polypeptides, Aspergillus polypeptides, Basidiobolus polypeptides, Bipolaris polypeptides, Blastomyces polypeptides, Candida polypeptides, Coccidioides polypeptides, Conidiobolus polypeptides, Cryptococcus polypeptides, Curvalaria polypeptides, Epidermophyton polypeptides, Exophiala polypeptides, Geotrichum polypeptides, Histoplasma polypeptides, Madurella polypeptides, Malassezia polypeptides, Microsporum polypeptides, Moniliella polypeptides, Mortierella polypeptides, Mucor polypeptides, Paecilomyces polypeptides, Penicillium polypeptides, Phialemonium polypeptides, Phialophora polypeptides, Prototheca polypeptide
- Babesia polypeptides Balantidium polypeptides, Besnoitia polypeptides, Cryptosporidium polypeptides, Eimeria polypeptides, Encephalitozoon polypeptides, Entamoeba polypeptides, Giardia polypeptides, Hammondia polypeptides, Hepatozoon polypeptides, Isospora polypeptides, Leishmania polypeptides, Microsporidia polypeptides, Neospora polypeptides, Nosema polypeptides, Pentatrichomonas polypeptides, Plasmodium polypeptides.
- helminth parasite antigens include, but are not limited to, Acanthocheilonema polypeptides, Aelurostrongylus polypeptides, Ancylostoma polypeptides, Angiostrongylus polypeptides, Ascaris polypeptides, Brugia polypeptides, Bunostomum polypeptides, Capillaria polypeptides, Chabertia polypeptides, Cooperia polypeptides, Crenosoma polypeptides, Dictyocaulus polypeptides, Dioctophyme polypeptides, Dipetalonema polypeptides, Diphyllobothrium polypeptides, Diplydium polypeptides, Dirofilaria polypeptides, Dracunculus polypeptides, Enterobius polypeptides, Filaroides polypeptides, Haemonchus polypeptides, Lagochilascaris polypeptides, Loa polypeptides, Mansonella polypeptides,
- P. falciparum circumsporozoite P. falciparum circumsporozoite (PfCSP)
- PfSSP2 sporozoite surface protein 2
- PfLSAl c-term carboxyl terminus of liver state antigen 1
- PfExp-1 exported protein 1
- ectoparasite antigens include, but are not limited to, polypeptides (including antigens as well as allergens) from fleas; ticks, including hard ticks and soft ticks; flies, such as midges, mosquitoes, sand flies, black flies, horse flies, horn flies, deer flies, tsetse flies, stable flies, myiasis-causing flies and biting gnats; ants; spiders, lice; mites; and true bugs, such as bed bugs and kissing bugs.
- polypeptides including antigens as well as allergens
- ticks including hard ticks and soft ticks
- flies such as midges, mosquitoes, sand flies, black flies, horse flies, horn flies, deer flies, tsetse flies, stable flies, myiasis-causing flies and biting gnats
- the CAR contains an extracellular antigen- recognition domain that specifically binds to an antigen.
- the antigen is a protein expressed on the surface of cells.
- the CAR is a TCR-like CAR and the antigen is a processed peptide antigen, such as a peptide antigen of an intracellular protein, which, like a TCR, is recognized on the cell surface in the context of a major histocompatibility complex (MHC) molecule.
- MHC major histocompatibility complex
- the chimeric antigen receptor comprises: a) an intracellular signaling domain, b) a hinge and transmembrane domain, such as a Ev3 hinge, and c) an extracellular domain comprising an antigen binding region.
- the engineered antigen receptors include chimeric antigen receptors (CARs), including activating or stimulatory CARs, costimulatory CARs (see WO2014/055668), and/or inhibitory CARs (iCARs, see Fedorov et al, 2013).
- CARs generally include an extracellular antigen (or ligand) binding domain linked to one or more intracellular signaling components, in some aspects via linkers and/or transmembrane domain(s).
- Such molecules typically mimic or approximate a signal through a natural antigen receptor, a signal through such a receptor in combination with a costimulatory receptor, and/or a signal through a costimulatory receptor alone.
- nucleic acids including nucleic acids encoding an antigen-specific CAR polypeptide, including a CAR that has been humanized to reduce immunogenicity (hCAR), comprising an intracellular signaling domain, a transmembrane domain, and an extracellular domain comprising one or more signaling motifs.
- the CAR may recognize an epitope comprising the shared space between one or more antigens.
- the binding region can comprise complementary determining regions of a monoclonal antibody, variable regions of a monoclonal antibody, and/or antigen binding fragments thereof.
- that specificity is derived from a peptide (e.g.
- the human CAR nucleic acids may be human genes used to enhance cellular immunotherapy for human patients.
- the invention includes a full-length CAR cDNA or coding region.
- the antigen binding regions or domain can comprise a fragment of the VH and VL chains of a single-chain variable fragment (scFv) derived from a particular human monoclonal antibody, such as those described in U.S. Patent 7,109,304, incorporated herein by reference.
- the fragment can also be any number of different antigen binding domains of a human antigen- specific antibody.
- the fragment is an antigen-specific scFv encoded by a sequence that is optimized for human codon usage for expression in human cells.
- the arrangement could be multimeric, such as a diabody or multimers.
- the multimers are most likely formed by cross pairing of the variable portion of the light and heavy chains into a diabody.
- the hinge portion of the construct can have multiple alternatives from being totally deleted, to having the first cysteine maintained, to a proline rather than a serine substitution, to being truncated up to the first cysteine.
- the Fc portion can be deleted. Any protein that is stable and/or dimerizes can serve this purpose.
- One could use just one of the Fc domains, e.g. , either the CH2 or CH3 domain from human immunoglobulin.
- One could also use just the hinge portion of an immunoglobulin.
- the CAR nucleic acid comprises a sequence encoding other costimulatory receptors, such as a transmembrane domain and a modified CD28 intracellular signaling domain.
- costimulatory receptors include, but are not limited to one or more of CD28, CD27, OX-40 (CD134), DAP10, DAP12, and 4-1BB (CD137).
- CD28 CD27
- OX-40 CD134
- DAP10 DAP12
- 4-1BB CD137
- an additional signal provided by a human costimulatory receptor inserted in a human CAR is important for full activation of NK cells and could help improve in vivo persistence and the therapeutic success of the adoptive immunotherapy.
- the CAR may express one or more cytokines, such as IL-15.
- the inclusion of one or more cytokines may promote in vivo persistence.
- the CAR comprises the antigen binding domain, such as humanized scFv, CD3 ⁇ , DAP12, and IL-15, optionally in combination with the Ev3 hinge.
- CAR is constructed with a specificity for a particular antigen (or marker or ligand), such as an antigen expressed in a particular cell type to be targeted by adoptive therapy, e.g., a cancer marker, and/or an antigen intended to induce a dampening response, such as an antigen expressed on a normal or non-diseased cell type.
- a particular antigen or marker or ligand
- the CAR typically includes in its extracellular portion one or more antigen binding molecules, such as one or more antigen-binding fragment, domain, or portion, or one or more antibody variable domains, and/or antibody molecules.
- the CAR includes an antigen-binding portion or portions of an antibody molecule, such as a single-chain antibody fragment (scFv) derived from the variable heavy (VH) and variable light (VL) chains of a monoclonal antibody (mAb).
- an antibody molecule such as a single-chain antibody fragment (scFv) derived from the variable heavy (VH) and variable light (VL) chains of a monoclonal antibody (mAb).
- the antigen- specific portion of the receptor (which may be referred to as an extracellular domain comprising an antigen binding region) comprises a tumor associated antigen or a pathogen- specific antigen binding domain.
- Antigens include carbohydrate antigens recognized by pattern-recognition receptors, such as Dectin-1.
- a tumor associated antigen may be of any kind so long as it is expressed on the cell surface of tumor cells.
- tumor associated antigens include CD19, CD319 (CS1), CD20, carcinoembryonic antigen, alphafetoprotein, CA-125, MUC-1, CD56, EGFR, c-Met, AKT, Her2, Her3, epithelial tumor antigen, melanoma-associated antigen, mutated p53, mutated ras, and so forth.
- the CAR may be co-expressed with a cytokine to improve persistence when there is a low amount of tumor-associated antigen.
- CAR may be co-expressed with IL-15.
- the sequence of the open reading frame encoding the chimeric receptor can be obtained from a genomic DNA source, a cDNA source, or can be synthesized (e.g. , via PCR), or combinations thereof. Depending upon the size of the genomic DNA and the number of introns, it may be desirable to use cDNA or a combination thereof as it is found that introns stabilize the mRNA. Also, it may be further advantageous to use endogenous or exogenous non-coding regions to stabilize the mRNA. [00157] It is contemplated that the chimeric construct can be introduced into immune cells as naked DNA or in a suitable vector. Methods of stably transfecting cells by electroporation using naked DNA are known in the art. Naked DNA generally refers to the DNA encoding a chimeric receptor contained in a plasmid expression vector in proper orientation for expression.
- a viral vector e.g., a retroviral vector, adenoviral vector, adeno-associated viral vector, or lentiviral vector
- Suitable vectors for use in accordance with the method of the present disclosure are non-replicating in the immune cells.
- a large number of vectors are known that are based on viruses, where the copy number of the virus maintained in the cell is low enough to maintain the viability of the cell, such as, for example, vectors based on HIV, SV40, EBV, HSV, or BPV.
- the antigen-specific binding, or recognition component is linked to one or more transmembrane and intracellular signaling domains.
- the CAR includes a transmembrane domain fused to the extracellular domain of the CAR.
- the transmembrane domain that naturally is associated with one of the domains in the CAR is used.
- the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain in some embodiments is derived either from a natural or from a synthetic source. Where the source is natural, the domain in some aspects is derived from any membrane -bound or transmembrane protein. Transmembrane regions include those derived from (i.e.
- the transmembrane domain in some embodiments is synthetic.
- the synthetic transmembrane domain comprises predominantly hydrophobic residues such as leucine and valine.
- the platform technologies disclosed herein to genetically modify immune cells comprise (i) non- viral gene transfer using an electroporation device (e.g. , a nucleofector), (ii) CARs that signal through endodomains (e.g.
- CARs with variable lengths of extracellular domains connecting the antigen-recognition domain to the cell surface, and, in some cases, (iv) artificial antigen presenting cells (aAPC) derived from K562 to be able to robustly and numerically expand CAR "1" immune cells (Singh et al , 2008; Singh et al , 2011).
- aAPC artificial antigen presenting cells
- the CAR may be retrovirally tranduced in the cells.
- the retroviral vector may be the pSFG4 vector.
- the retroviral transfer vector pSFG4 comprises a backbone based on pUC19 plasmid (large fragment [2.63kb] in between Hindlll and EcoRI restriction enzyme sites) carrying viral components from Moloney Murine Leukemia Virus (MoMLV) including 5' LTR, psi packaging sequence, and 3' LTR.
- MoMLV Moloney Murine Leukemia Virus
- LTRs are long terminal repeats found on either side of a retroviral provirus, and in the case of transfer vector, brackets the genetic cargo of interest (in our case mainly CARs and associated genetic components).
- the psi packaging sequence which is a target site for packaging by nucleocapsid, is also incorporated in cis, sandwiched between the 5' LTR and the CAR coding sequence.
- the basic structure of the pSFG4 transfer vector can be outlined as such: pUC19 sequence - 5' LTR - psi packaging sequence - genetic cargo of interest - 3' LTR - pUC19 sequence.
- Antigen-presenting cells which include macrophages, B lymphocytes, and dendritic cells, are distinguished by their expression of a particular MHC molecule. APCs internalize antigen and re-express a part of that antigen, together with the MHC molecule on their outer cell membrane.
- the major histocompatibility complex (MHC) is a large genetic complex with multiple loci. The MHC loci encode two major classes of MHC membrane molecules, referred to as class I and class II MHCs. T helper lymphocytes generally recognize antigen associated with MHC class II molecules, and T cytotoxic lymphocytes recognize antigen associated with MHC class I molecules. In humans the MHC is referred to as the HLA complex and in mice the H-2 complex.
- aAPC systems may comprise at least one exogenous assisting molecule. Any suitable number and combination of assisting molecules may be employed.
- the assisting molecule may be selected from assisting molecules such as co-stimulatory molecules and adhesion molecules. Exemplary co-stimulatory molecules include CD86, CD64 (FcyRI), 4 IBB ligand, and IL-21.
- Adhesion molecules may include carbohydrate -binding glycoproteins such as selectins, transmembrane binding glycoproteins such as integrins, calcium-dependent proteins such as cadherins, and single-pass transmembrane immunoglobulin (Ig) superfamily proteins, such as intercellular adhesion molecules (ICAMs), which promote, for example, cell- to-cell or cell-to-matrix contact.
- Ig intercellular adhesion molecules
- exemplary adhesion molecules include LFA-3 and ICAMs, such as ICAM-1. Techniques, methods, and reagents useful for selection, cloning, preparation, and expression of exemplary assisting molecules, including co- stimulatory molecules and adhesion molecules.
- the present disclosure provides methods for immunotherapy comprising administering an effective amount of the immune cells expressing CARs (e.g., CARs with Ev3 hinge and/or humanized scFv) of the present disclosure.
- a medical disease or disorder is treated by transfer of an immune cell population that elicits an immune response.
- cancer or infection is treated by transfer of an immune cell population that elicits an immune response.
- methods for treating or delaying progression of cancer in an individual comprising administering to the individual an effective amount an antigen-specific cell therapy.
- the present methods may be applied for the treatment of immune disorders, solid cancers, hematologic cancers, and viral infections.
- methods are provided for treating cancer patients by administering immune cells, such as NK cells and/or T cells, expressing CARs provided herein with an antigen-binding domain specific for the antigen expressed by said cancer.
- immune cells such as NK cells and/or T cells
- CLL chronic lymphocytic leukemia
- ALL B cell acute lymphoblastic leukemia
- NHL non-Hodgkin lymphoma
- CD 19- Ev3-CAR immune cells to ablate CD19-positive cells such as cancer stem cells.
- the subject may have acute myeloid leukemia (AML), chronic myeloid leukemia (CML), myelodysplastic syndromes (MDS), or plasmacytoid dendritic cell leukemia (PDCL) and be treated with CD123-Ev3-CAR immune cells.
- the subject may have T-cell leukemia and lymphoma and be treated with CD5-Ev3-CAR immune cells.
- Subjects with CLL, breast cancer, pancreatic cancer or lung cancer may be treated with RORl-Ev3- CAR immune cells.
- Patients with cervical, endometrial or ovarian cancer may be treated with Meso-Ev3-CAR immune cells.
- Subjects with multiple myeloma (MM) or other CD319-expressig cancers may be treated with CD319-CAR immune cells.
- patient with amyloidosis are treated by ablating CD319-positive cells, such as cancer stem cells.
- patients with monoclonal gammopathy of unknown significance (MGUS) or smoldering myeloma are treated with CD319-CAR immune cells.
- Subjects with CD319- positive cells in autoimmune disorders, such as rheumatoid arthritis, SLE, or autoimmune hemolytic anemia may be treated by immune cells of the present embodiments.
- a CD319-expressing cancer is treated by administering immune cells expressing Ev3- CAR with CD319 scFv, CO3C,, DAP12, and IL- 15.
- cells comprising the Ev3 CARs provided herein may be ablated and/or detected by anti-EGFR antibodies.
- anti-EGFR antibodies include, but are not limited to, cetuximab (Erbitux) and panitumumab (Vectibix) as well as biosimilars. Both of these antibodies have been approved by the FDA for treatment of colorectal cancer.
- the detection of cells expressing Ev3-CARs comprises the administration of an anti-EGFR antibody with a detectable tag.
- the ablation of cells expressing Ev3-CARs comprises the administration of an anti-EGFR antibody which induces ADCC.
- the anti-EGFR antibody may be fused to a pro-drug or cytotoxic agent, such as a toxin.
- Tumors for which the present treatment methods are useful include any malignant cell type, such as those found in a solid tumor or a hematological tumor.
- Exemplary solid tumors can include, but are not limited to, a tumor of an organ selected from the group consisting of pancreas, colon, cecum, stomach, brain, head, neck, ovary, kidney, larynx, sarcoma, lung, bladder, melanoma, prostate, and breast.
- Exemplary hematological tumors include tumors of the bone marrow, T or B cell malignancies, leukemias, lymphomas, blastomas, myelomas, and the like.
- cancers that may be treated using the methods provided herein include, but are not limited to, lung cancer (including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), cancer of the peritoneum, gastric or stomach cancer (including gastrointestinal cancer and gastrointestinal stromal cancer), pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, various types of head and neck cancer, and melanoma.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung
- cancer of the peritoneum gastric or stomach cancer (including gastrointestinal cancer and gastrointestinal stromal cancer)
- pancreatic cancer cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon
- the cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo- alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma;
- Leukemia is a cancer of the blood or bone marrow and is characterized by an abnormal proliferation (production by multiplication) of blood cells, usually white blood cells (leukocytes). It is part of the broad group of diseases called hematological neoplasms. Leukemia is a broad term covering a spectrum of diseases. Leukemia is clinically and pathologically split into its acute and chronic forms.
- immune cells are delivered to an individual in need thereof, such as an individual that has cancer or an infection.
- the cells then enhance the individual's immune system to attack the respective cancer or pathogenic cells.
- the individual is provided with one or more doses of the immune cells.
- the duration between the administrations should be sufficient to allow time for propagation in the individual, and in specific embodiments the duration between doses is 1, 2, 3, 4, 5, 6, 7, or more days.
- Certain embodiments of the present disclosure provide methods for treating or preventing an immune-mediated disorder.
- the subject has an autoimmune disease.
- autoimmune diseases include: alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune diseases of the adrenal gland, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune oophoritis and orchitis, autoimmune thrombocytopenia, Behcet's disease, bullous pemphigoid, cardiomyopathy, celiacdynamis-dermatitis, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, Churg- Strauss syndrome, cicatrical pemphigoid, CREST syndrome, cold agglutinin disease, Crohn's disease, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia-fibromyositis, glomerulone
- an autoimmune disease that can be treated using the methods disclosed herein include, but are not limited to, multiple sclerosis, rheumatoid arthritis, systemic lupus erythematosis, type I diabetes mellitus, Crohn's disease; ulcerative colitis, myasthenia gravis, glomerulonephritis, ankylosing spondylitis, vasculitis, or psoriasis.
- the subject can also have an allergic disorder such as Asthma.
- the subject is the recipient of a transplanted organ or stem cells and immune cells are used to prevent and/or treat rejection.
- the subject has or is at risk of developing graft versus host disease.
- GVHD is a possible complication of any transplant that uses or contains stem cells from either a related or an unrelated donor.
- Acute GVHD appears within the first three months following transplantation. Signs of acute GVHD include a reddish skin rash on the hands and feet that may spread and become more severe, with peeling or blistering skin.
- Acute GVHD can also affect the stomach and intestines, in which case cramping, nausea, and diarrhea are present. Yellowing of the skin and eyes (jaundice) indicates that acute GVHD has affected the liver.
- Chronic GVHD is ranked based on its severity: stage/grade 1 is mild; stage/grade 4 is severe. Chronic GVHD develops three months or later following transplantation.
- chronic GVHD The symptoms of chronic GVHD are similar to those of acute GVHD, but in addition, chronic GVHD may also affect the mucous glands in the eyes, salivary glands in the mouth, and glands that lubricate the stomach lining and intestines.
- a transplanted organ include a solid organ transplant, such as kidney, liver, skin, pancreas, lung and/or heart, or a cellular transplant such as islets, hepatocytes, myoblasts, bone marrow, or hematopoietic or other stem cells.
- the transplant can be a composite transplant, such as tissues of the face. Immune cells can be administered prior to transplantation, concurrently with transplantation, or following transplantation.
- the immune cells are administered prior to the transplant, such as at least 1 hour, at least 12 hours, at least 1 day, at least 2 days, at least 3 days, at least 4 days, at least 5 days, at least 6 days, at least 1 week, at least 2 weeks, at least 3 weeks, at least 4 weeks, or at least 1 month prior to the transplant.
- administration of the therapeutically effective amount of immune cells occurs 3-5 days prior to transplantation.
- the subject can be administered nonmyeloablative lymphodepleting chemotherapy prior to the immune cell therapy.
- the nonmyeloablative lymphodepleting chemotherapy can be any suitable such therapy, which can be administered by any suitable route.
- the nonmyeloablative lymphodepleting chemotherapy can comprise, for example, the administration of cyclophosphamide and fludarabine, particularly if the cancer is melanoma, which can be metastatic.
- An exemplary route of administering cyclophosphamide and fludarabine is intravenously.
- any suitable dose of cyclophosphamide and fludarabine can be administered.
- a growth factor that promotes the growth and activation of the immune cells is administered to the subject either concomitantly with the immune cells or subsequently to the immune cells.
- the immune cell growth factor can be any suitable growth factor that promotes the growth and activation of the immune cells.
- Suitable immune cell growth factors include interleukin (IL)-2, IL-7, IL- 15 , and IL- 12, which can be used alone or in various combinations, such as IL-2 and IL-7, IL-2 and IL-15, IL-7 and IL-15, IL-2, IL-7 and IL-15, IL-12 and IL-7, IL-12 and IL-15, or IL-12 and IL2.
- IL interleukin
- Therapeutically effective amounts of immune cells can be administered by a number of routes, including parenteral administration, for example, intravenous, intraperitoneal, intramuscular, intrasternal, or intraarticular injection, or infusion.
- parenteral administration for example, intravenous, intraperitoneal, intramuscular, intrasternal, or intraarticular injection, or infusion.
- the therapeutically effective amount of immune cells for use in adoptive cell therapy is that amount that achieves a desired effect in a subject being treated. For instance, this can be the amount of immune cells necessary to inhibit advancement, or to cause regression of an autoimmune or alloimmune disease, or which is capable of relieving symptoms caused by an autoimmune disease, such as pain and inflammation. It can be the amount necessary to relieve symptoms associated with inflammation, such as pain, edema and elevated temperature. It can also be the amount necessary to diminish or prevent rejection of a transplanted organ.
- the immune cell population can be administered in treatment regimens consistent with the disease, for example a single or a few doses over one to several days to ameliorate a disease state or periodic doses over an extended time to inhibit disease progression and prevent disease recurrence.
- the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances.
- the therapeutically effective amount of immune cells will be dependent on the subject being treated, the severity and type of the affliction, and the manner of administration.
- doses that could be used in the treatment of human subjects range from at least 3.8xl0 4 , at least 3.8xl0 5 , at least 3.8xl0 6 , at least 3.8xl0 7 , at least 3.8xl0 8 , at least 3.8xl0 9 , or at least 3.8xl0 10 immune cells/m 2 .
- the dose used in the treatment of human subjects ranges from about 3.8xl0 9 to about 3.8xl0 10 immune cells/m 2 .
- a therapeutically effective amount of immune cells can vary from about 5xl0 6 cells per kg body weight to about 7.5xl0 8 cells per kg body weight, such as about 2xl0 7 cells to about 5xl0 8 cells per kg body weight, or about 5xl0 7 cells to about 2xl0 8 cells per kg body weight.
- the exact amount of immune cells is readily determined by one of skill in the art based on the age, weight, sex, and physiological condition of the subject. Effective doses can be extrapolated from dose -response curves derived from in vitro or animal model test systems.
- the immune cells may be administered in combination with one or more other therapeutic agents for the treatment of the immune-mediated disorder.
- Combination therapies can include, but are not limited to, one or more anti-microbial agents (for example, antibiotics, anti-viral agents and anti-fungal agents), anti-tumor agents (for example, fluorouracil, methotrexate, paclitaxel, fludarabine, etoposide, doxorubicin, or vincristine), immune-depleting agents (for example, fludarabine, etoposide, doxorubicin, or vincristine), immunosuppressive agents (for example, azathioprine, or glucocorticoids, such as dexamethasone or prednisone), anti-inflammatory agents (for example, glucocorticoids such as hydrocortisone, dexamethasone or prednisone, or non-steroidal anti-inflammatory agents such as acetyls alicylic acid, ibuprof
- immunosuppressive or tolerogenic agents including but not limited to calcineurin inhibitors (e.g., cyclosporin and tacrolimus); mTOR inhibitors (e.g., Rapamycin); mycophenolate mofetil, antibodies (e.g., recognizing CD3, CD4, CD40, CD154, CD45, IVIG, or B cells); chemotherapeutic agents (e.g., Methotrexate, Treosulfan, Busulfan); irradiation; or chemokines, interleukins or their inhibitors (e.g., BAFF, IL-2, anti-IL-2R, IL-4, JAK kinase inhibitors) can be administered.
- additional pharmaceutical agents can be administered before, during, or after administration of the immune cells, depending on the desired effect. This administration of the cells and the agent can be by the same route or by different routes, and either at the same site or at a different site.
- compositions and formulations comprising immune cells (e.g., T cells or NK cells) and a pharmaceutically acceptable carrier.
- compositions and formulations as described herein can be prepared by mixing the active ingredients (such as an antibody or a polypeptide) having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 22 nd edition, 2012), in the form of lyophilized formulations or aqueous solutions.
- active ingredients such as an antibody or a polypeptide
- optional pharmaceutically acceptable carriers Remington's Pharmaceutical Sciences 22 nd edition, 2012
- Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arg
- compositions and methods of the present embodiments involve an immune cell population in combination with at least one additional therapy.
- the additional therapy may be radiation therapy, surgery (e.g. , lumpectomy and a mastectomy), chemotherapy, gene therapy, DNA therapy, viral therapy, RNA therapy, immunotherapy, bone marrow transplantation, nanotherapy, monoclonal antibody therapy, or a combination of the foregoing.
- the additional therapy may be in the form of adjuvant or neoadjuvant therapy.
- the additional therapy is the administration of small molecule enzymatic inhibitor or anti-metastatic agent.
- the additional therapy is the administration of side- effect limiting agents (e.g. , agents intended to lessen the occurrence and/or severity of side effects of treatment, such as anti-nausea agents, etc.).
- the additional therapy is radiation therapy.
- the additional therapy is surgery.
- the additional therapy is a combination of radiation therapy and surgery.
- the additional therapy is gamma irradiation.
- the additional therapy is therapy targeting PBK/AKT/mTOR pathway, HSP90 inhibitor, tubulin inhibitor, apoptosis inhibitor, and/or chemopreventative agent.
- the additional therapy may be one or more of the chemotherapeutic agents known in the art.
- An immune cell therapy may be administered before, during, after, or in various combinations relative to an additional cancer therapy, such as immune checkpoint therapy. The administrations may be in intervals ranging from concurrently to minutes to days to weeks. In embodiments where the immune cell therapy is provided to a patient separately from an additional therapeutic agent, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the two compounds would still be able to exert an advantageously combined effect on the patient.
- chemotherapeutic agents may be used in accordance with the present embodiments.
- the term "chemotherapy” refers to the use of drugs to treat cancer.
- a "chemotherapeutic agent” is used to connote a compound or composition that is administered in the treatment of cancer. These agents or drugs are categorized by their mode of activity within a cell, for example, whether and at what stage they affect the cell cycle. Alternatively, an agent may be characterized based on its ability to directly cross-link DNA, to intercalate into DNA, or to induce chromosomal and mitotic aberrations by affecting nucleic acid synthesis.
- chemotherapeutic agents include alkylating agents, such as thiotepa and cyclosphosphamide; alkyl sulfonates, such as busulfan, improsulfan, and piposulfan; aziridines, such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines, including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide, and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC- 1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8);
- DNA damaging factors include what are commonly known as ⁇ -rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells.
- Other forms of DNA damaging factors are also contemplated, such as microwaves, proton beam irradiation, and UV-irradiation. It is most likely that all of these factors affect a broad range of damage on DNA, on the precursors of DNA, on the replication and repair of DNA, and on the assembly and maintenance of chromosomes.
- Dosage ranges for X-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 wk), to single doses of 2000 to 6000 roentgens.
- Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
- immunotherapeutics generally, rely on the use of immune effector cells and molecules to target and destroy cancer cells.
- Rituximab (RITUXAN ® ) is such an example.
- the immune effector may be, for example, an antibody specific for some marker on the surface of a tumor cell.
- the antibody alone may serve as an effector of therapy or it may recruit other cells to actually affect cell killing.
- the antibody also may be conjugated to a drug or toxin (chemotherapeutic, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc.) and serve as a targeting agent.
- the effector may be a lymphocyte carrying a surface molecule that interacts, either directly or indirectly, with a tumor cell target.
- Various effector cells include cytotoxic T cells and NK cells
- ADCs Antibody-drug conjugates
- MAbs monoclonal antibodies
- This approach combines the high specificity of MAbs against their antigen targets with highly potent cytotoxic drugs, resulting in "armed" MAbs that deliver the payload (drug) to tumor cells with enriched levels of the antigen. Targeted delivery of the drug also minimizes its exposure in normal tissues, resulting in decreased toxicity and improved therapeutic index.
- Exemplary ADC drugs inlcude ADCETRIS ® (brentuximab vedotin) and KADCYLA ® (trastuzumab emtansine or T-DM1).
- the tumor cell must bear some marker that is amenable to targeting, i.e., is not present on the majority of other cells.
- Common tumor markers include CD20, carcinoembryonic antigen, tyrosinase (p97), gp68, TAG-72, HMFG, Sialyl Lewis Antigen, MucA, MucB, PLAP, laminin receptor, erb B, and pl55.
- An alternative aspect of immunotherapy is to combine anticancer effects with immune stimulatory effects.
- Immune stimulating molecules also exist including: cytokines, such as IL-2, IL-4, IL-12, GM-CSF, gamma-IFN, chemokines, such as MIP-1, MCP-1, IL-8, and growth factors, such as FLT3 ligand.
- cytokines such as IL-2, IL-4, IL-12, GM-CSF, gamma-IFN
- chemokines such as MIP-1, MCP-1, IL-8
- growth factors such as FLT3 ligand.
- immunotherapies include immune adjuvants, e.g., Mycobacterium bovis, Plasmodium falciparum, dinitrochlorobenzene, and aromatic compounds); cytokine therapy, e.g., interferons ⁇ , ⁇ , and ⁇ , IL-1, GM-CSF, and TNF; gene therapy, e.g., TNF, IL-1, IL-2, and p53; and monoclonal antibodies, e.g., anti-CD20, anti- ganglioside GM2, and anti-pl85. It is contemplated that one or more anti-cancer therapies may be employed with the antibody therapies described herein.
- immune adjuvants e.g., Mycobacterium bovis, Plasmodium falciparum, dinitrochlorobenzene, and aromatic compounds
- cytokine therapy e.g., interferons ⁇ , ⁇ , and ⁇ , IL-1, GM-CSF, and TNF
- the immunotherapy may be an immune checkpoint inhibitor.
- Immune checkpoints either turn up a signal (e.g., co-stimulatory molecules) or turn down a signal.
- Inhibitory immune checkpoints that may be targeted by immune checkpoint blockade include adenosine A2A receptor (A2AR), B7-H3 (also known as CD276), B and T lymphocyte attenuator (BTLA), cytotoxic T-lymphocyte-associated protein 4 (CTLA-4, also known as CD152), indoleamine 2,3-dioxygenase (IDO), killer-cell immunoglobulin (KIR), lymphocyte activation gene-3 (LAG3), programmed death 1 (PD-1), T-cell immunoglobulin domain and mucin domain 3 (TIM-3) and V-domain Ig suppressor of T cell activation (VISTA).
- the immune checkpoint inhibitors target the PD-1 axis and/or CTLA-4.
- the immune checkpoint inhibitors may be drugs such as small molecules, recombinant forms of ligand or receptors, or, in particular, are antibodies, such as human antibodies.
- Known inhibitors of the immune checkpoint proteins or analogs thereof may be used, in particular chimerized, humanized or human forms of antibodies may be used.
- alternative and/or equivalent names may be in use for certain antibodies mentioned in the present disclosure.
- Such alternative and/or equivalent names are interchangeable in the context of the present disclosure. For example it is known that lambrolizumab is also known under the alternative and equivalent names MK-3475 and pembrolizumab.
- the PD- 1 binding antagonist is a molecule that inhibits the binding of PD- 1 to its ligand binding partners.
- the PD-1 ligand binding partners are PDLl and/or PDL2.
- a PDLl binding antagonist is a molecule that inhibits the binding of PDLl to its binding partners.
- PDLl binding partners are PD-1 and/or B7-1.
- the PDL2 binding antagonist is a molecule that inhibits the binding of PDL2 to its binding partners.
- a PDL2 binding partner is PD-1.
- the antagonist may be an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide.
- the PD-1 binding antagonist is an anti-PD-1 antibody (e.g. , a human antibody, a humanized antibody, or a chimeric antibody).
- the anti-PD-1 antibody is selected from the group consisting of nivolumab, pembrolizumab, and CT-011.
- the PD- 1 binding antagonist is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PDLl or PDL2 fused to a constant region (e.g.
- the PD- 1 binding antagonist is AMP- 224.
- Nivolumab also known as MDX- 1106-04, MDX- 1106, ONO-4538, BMS-936558, and OPDIVO ® , is an anti- PD- 1 antibody that may be used.
- Pembrolizumab also known as MK-3475, Merck 3475, lambrolizumab, KEYTRUDA ® , and SCH-900475, is an exemplary anti-PD- 1 antibody.
- CT- 011 also known as hBAT or hBAT-1 , is also an anti-PD-1 antibody.
- AMP- 224 also known as B7-DCIg, is a PDL2-Fc fusion soluble receptor.
- Another immune checkpoint that can be targeted in the methods provided herein is the cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), also known as CD 152.
- CTLA-4 is found on the surface of T cells and acts as an "off switch when bound to CD80 or CD86 on the surface of antigen-presenting cells.
- CTLA4 is a member of the immunoglobulin superfamily that is expressed on the surface of Helper T cells and transmits an inhibitory signal to T cells.
- CTLA4 is similar to the T-cell co-stimulatory protein, CD28, and both molecules bind to CD80 and CD86, also called B7- 1 and B7-2 respectively, on antigen-presenting cells.
- CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal.
- Intracellular CTLA4 is also found in regulatory T cells and may be important to their function. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA-4, an inhibitory receptor for B7 molecules.
- the immune checkpoint inhibitor is an anti- CTLA-4 antibody (e.g. , a human antibody, a humanized antibody, or a chimeric antibody), an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide.
- Anti-human-CTLA-4 antibodies (or VH and/or VL domains derived therefrom) suitable for use in the present methods can be generated using methods well known in the art. Alternatively, art recognized anti-CTLA-4 antibodies can be used.
- An exemplary anti-CTLA-4 antibody is ipilimumab (also known as 10D1, MDX- 010, MDX- 101, and Yervoy®) or antigen binding fragments and variants thereof.
- the antibody comprises the heavy and light chain CDRs or VRs of ipilimumab. Accordingly, in one embodiment, the antibody comprises the CDRl, CDR2, and CDR3 domains of the VH region of ipilimumab, and the CDRl, CDR2 and CDR3 domains of the VL region of ipilimumab. In another embodiment, the antibody competes for binding with and/or binds to the same epitope on CTLA-4 as the above- mentioned antibodies. In another embodiment, the antibody has at least about 90% variable region amino acid sequence identity with the above- mentioned antibodies (e.g. , at least about 90%, 95%, or 99% variable region identity with ipilimumab). 4. Surgery
- Curative surgery includes resection in which all or part of cancerous tissue is physically removed, excised, and/or destroyed and may be used in conjunction with other therapies, such as the treatment of the present embodiments, chemotherapy, radiotherapy, hormonal therapy, gene therapy, immunotherapy, and/or alternative therapies.
- Tumor resection refers to physical removal of at least part of a tumor.
- treatment by surgery includes laser surgery, cryosurgery, electrosurgery, and microscopically-controlled surgery (Mohs' surgery).
- a cavity may be formed in the body.
- Treatment may be accomplished by perfusion, direct injection, or local application of the area with an additional anti-cancer therapy. Such treatment may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months. These treatments may be of varying dosages as well.
- agents may be used in combination with certain aspects of the present embodiments to improve the therapeutic efficacy of treatment.
- additional agents include agents that affect the upregulation of cell surface receptors and GAP junctions, cytostatic and differentiation agents, inhibitors of cell adhesion, agents that increase the sensitivity of the hyperproliferative cells to apoptotic inducers, or other biological agents. Increases in intercellular signaling by elevating the number of GAP junctions would increase the anti-hyperproliferative effects on the neighboring hyperproliferative cell population.
- cytostatic or differentiation agents can be used in combination with certain aspects of the present embodiments to improve the anti- hyperproliferative efficacy of the treatments.
- Inhibitors of cell adhesion are contemplated to improve the efficacy of the present embodiments.
- cell adhesion inhibitors are focal adhesion kinase (FAKs) inhibitors and Lovastatin. It is further contemplated that other agents that increase the sensitivity of a hyperproliferative cell to apoptosis, such as the antibody c225, could be used in combination with certain aspects of the present embodiments to improve the treatment efficacy.
- An article of manufacture or a kit comprising immune cells is also provided herein.
- the article of manufacture or kit can further comprise a package insert comprising instructions for using the immune cells to treat or delay progression of cancer in an individual or to enhance immune function of an individual having cancer.
- Any of the antigen- specific immune cells described herein may be included in the article of manufacture or kits.
- Suitable containers include, for example, bottles, vials, bags and syringes.
- the container may be formed from a variety of materials such as glass, plastic (such as polyvinyl chloride or poly olefin), or metal alloy (such as stainless steel or hastelloy).
- the container holds the formulation and the label on, or associated with, the container may indicate directions for use.
- the article of manufacture or kit may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
- the article of manufacture further includes one or more of another agent (e.g., a chemotherapeutic agent, and anti-neoplastic agent).
- Suitable containers for the one or more agent include, for example, bottles, vials, bags and syringes.
- Ev3-CAR was designed in which the Ev3 stalk serves as an integrative structure to transduce signals from antigen binding, such as by scFv, as well as an "off switch, meaning it can be recognized by clinically accessible antibodies such as cetuximab to ablate CAR-positive immune cells (FIG. 1A).
- the Ev3-CAR may further comprise DAP12 signaling domain and is designated Ev3-DAP12-CAR.
- a schematic depicting Ev3 as compared to EGFR which comprise the endodomain and the EGF binding domain is shown in FIG. 2.
- Retroviral vectors encoding the Ev3-CAR or Ev3-DAP12-CAR with various antigen binding domains were generated as depicted in FIGS. 3A-3D.
- the antigen- binding domain was both the scFv derived from the mouse anti-human antibody as well as a humanized scFv.
- the vectors comprise CD28 and CD3 ⁇ signaling domains and, optionally, DAP12.
- the vectors also comprise a suicide gene, inducible caspase 9.
- the CD19-specific CARs including CAR19.Ev3.CD28.CD3 , CAR19.Ev3.DAP12.CD3 or humanized CAR19.Ev3.CD3 were transduced into NK cells (FIG. 4A).
- the CAR-NK cells were tested for their efficacy at killing CD19 + Raji or K562 cells (FIG. 4B).
- the CAR19-Ev3-CD28-DAP12-CAR NK cells were observed to have the highest cytoxicity.
- Ev3 in the hinge region of the CAR in combination with DAP12 endodomain produces CARs that are highly cytotoxic against target cells.
- Example 2 Development of Humanized CARs
- a platform was developed to generate humanized scFvs for use in producing humanized CARs. Due to structural constraints, some residues contribute more to antigen binding, thus 3-D modeling was used to identify potentially critical interactions to generate the humanized CARs. The stepwise process detailed below may be repeated iteratively to improve on previous cycles.
- the CAR humanization workflow provided herein comprises 5 basic process modules as detailed below and depicted in FIG. 5A.
- Module I comprises monoclonal antibody (mAb) sequence analysis.
- the BLAST program was harnessed in search of immunoglobulin (IG) sequences for the best match against the starting queries, such as the murine mAb sequences (FIG. 5B).
- IG immunoglobulin
- BLAST can analyze nucleotide and amino acid sequences, either in series (one-by-one) or in parallel (in batches), as well as search against germline gene databases including curated sequence databases simultaneously thus maximizing the chance of getting the best matching variable (V gene.
- databases of germline variable (V), diversity (D) and joining (J) genes were used to delineate IG V domain framework regions (FRl-4s) and complementarity determining regions (CDRs).
- variable domains were analyzed for the light and heavy chains, each are encoded by multiple genes, including the gene V, D and J genes.
- the focus of this study was mainly on the V genes to compare variations in the context of defined regions, finding the boundaries for each FR and CDR regions and comparing with other IG sequences in a database.
- the germline IG sequences Due to individual variations within the genomic sequences (i.e., estimated at 1 single nucleotide polymorphism per 1,000 bp DNA sequence), the germline IG sequences comprise many thousands of allotypes (i.e., alleles or versions of a gene) (FIG. 6). Databases of human allotypes were generated and exploited for CAR humanization.
- a humanized domain was derived using a particular human allotype by CDR-grafting to transform an anti-human CD19-binding domain VL and VH sequences from a mouse antibody (clone FMC63) (FIG. 7 A). The CDR regions are underlined in FIG. 7A.
- Module II comprised 3D structure modeling. To identify critical residues for antigen binding, 3D structures were built to evaluate the constructs.
- SWISS- MODEL is a protein structure homology-modeler that was used to make 3 -dimensional models of humanized mAbs. Structure files were extracted from SAbDab, a structural antibody database, as templates for homology modeling. As an example of characterizing the 3D conformation of CDR regions of VL and VH domains, homology modeling was employed using SWISS-MODEL (Arnold et al, 2006; Benkert et al, 2011) algorithms with the following primary amino acid sequences: hCD19 V L (SEQ ID NO:9): DIQMTQSPSSLSASVGDRVTITCRASQDIS
- EDVATYYCQQGNTLPYTFGQGTKVEIKR hCD19 V H (SEQ ID NO:8): EVQLVESGGGLVQPGGSLRL SCAASGVSLPDYGVSWVRQAPGKGLEWIGVIWGSETTYYNSALKSKFIISRD NAKNSLYL QMNSLRAEDTAVYYCARHYYYGGSYAMDYWGQGTLVTVSS
- SWISS-MODEL template library (SMTL version 2017-06-28, PDB release 2017-06-23) was searched with BLAST (Altschul et al, 1997) and HHBlits (Remmert et al, 2012) for evolutionary related structures matching the target sequences hCD19 V L and hCD19 V H .
- the target sequence (hCD19 VL) was searched with BLAST against the primary amino acid sequence contained in the SMTL. A total of 755 templates were found.
- An initial HHblits profile had been built using the procedure outlined by Remmert et al, followed by 1 iteration of HHblits against NR20. The profile thus obtained was then searched against all profiles of the SMTL. A total of 13,964 templates were found.
- Template Selection For each identified template, the template's quality had been predicted from features of the target-template alignment. The templates with the highest quality were then been selected for model building.
- Model Building Models were built based on the target-template alignment using ProMod3. Coordinates which were conserved between the target and the template were copied from the template to the model. Insertions and deletions were remodeled using a fragment library. Side chains were then rebuilt. Finally, the geometry of the resulting model was regularized by using a force field. In case loop modeling with ProMod3 failed, an alternative model was built with PROMOD-II (Geux et al, 1997).
- Model Quality Estimation The global and per-residue model quality had been assessed using the QMEAN scoring function (Benkert et al, 2011). For improved performance, weights of the individual QMEAN terms had been trained specifically for SWISS-MODEL. [00223] The 3-dimensional models of hCD 19 V L and hCD 19 V H showed that the
- Module III comprised human framework grafting. As part of the synthetic CAR building process, a robust and reliable CDR grafting technique was included in the platform technology.
- the antigen binding sequences (CDRs) were identified and spliced using custom analysis algorithms (a combination of traditional Kabat/IMGT and novel methods) from antibody variable domains into selective human framework sequences (carefully curated custom databases based homology and position of key residues) to create a panel of full length humanized scFvs for robust expression.
- Fully humanized scFvs are an essential step in the process of incorporating the antigen-binding domains of mAbs into CARs for clinical application while reducing the possibility of human anti-mouse reactivity ensuring persistence and viability of CAR-modified therapeutic cells.
- the present CAR humanization platform's efficacy was shown by the de novo creation of a panel of at least 5 high quality, full-length, humanized CARs for expression characterization, functional verification, and pre-clinical testing.
- Module IV comprises humanization scoring. Scoring metrics were used to quantify and objectively evaluate the synthetic constructs as part of the CAR humanization process.
- the T20 1 scoring algorithm was applied to a series of commercially available and FDA-approved monoclonal antibodies (mAbs) as listed in FIG. 10B to test its utility.
- mAbs monoclonal antibodies
- the VL and VH (FIG. IOC) sequences score higher with increasing degrees of humanization.
- VL sequences trend higher in T20 scores as compared to paired VH sequences.
- T20 scores for the VL and VH sequences were evaluated before and after the humanization process for mCD19CAR vs hCD19CAR (FIGS. 10F-G). Indeed, higher T20 scores were observed for both processed fragments (humanized VL and VH). Since the workflow can be iterative, the CAR humanization process can be used to produce CARs with lower immunogenicity, better persistence, and robust function.
- Gao SH Gao SH, et al. , BMC Biotechnolo gy. 13 : 55 , 2013.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Hematology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Oncology (AREA)
- Transplantation (AREA)
- Mycology (AREA)
- Pain & Pain Management (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201880058794.3A CN111432823A (zh) | 2017-07-25 | 2018-07-25 | 增强的嵌合抗原受体及其用途 |
| JP2020503988A JP2020530989A (ja) | 2017-07-25 | 2018-07-25 | 強化されたキメラ抗原受容体およびその使用 |
| EP18838056.2A EP3658163A4 (en) | 2017-07-25 | 2018-07-25 | IMPROVED ANTIGENIC CHEMICAL RECEPTORS AND THEIR USES |
| KR1020207005375A KR20200032174A (ko) | 2017-07-25 | 2018-07-25 | 강화된 키메라 항원 수용체 및 이의 용도 |
| CN202410061631.8A CN118206655A (zh) | 2017-07-25 | 2018-07-25 | 增强的嵌合抗原受体及其用途 |
| CA3070998A CA3070998A1 (en) | 2017-07-25 | 2018-07-25 | Enhanced chimeric antigen receptors and use thereof |
| US16/632,762 US20230159618A1 (en) | 2017-07-25 | 2018-07-25 | Enhanced chimeric antigen receptors and use thereof |
| EP25169707.4A EP4582146A2 (en) | 2017-07-25 | 2018-07-25 | Enhanced chimeric antigen receptors and use thereof |
| AU2018306307A AU2018306307B2 (en) | 2017-07-25 | 2018-07-25 | Enhanced chimeric antigen receptors and use thereof |
| US17/233,157 US20210253729A1 (en) | 2017-07-25 | 2021-04-16 | Enhanced chimeric antigen receptors and use thereof |
| JP2023117421A JP2023134735A (ja) | 2017-07-25 | 2023-07-19 | 強化されたキメラ抗原受容体およびその使用 |
| US18/750,233 US20240336699A1 (en) | 2017-07-25 | 2024-06-21 | Enhanced chimeric antigen receptors and use thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762536934P | 2017-07-25 | 2017-07-25 | |
| US62/536,934 | 2017-07-25 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/632,762 A-371-Of-International US20230159618A1 (en) | 2017-07-25 | 2018-07-25 | Enhanced chimeric antigen receptors and use thereof |
| US17/233,157 Continuation US20210253729A1 (en) | 2017-07-25 | 2021-04-16 | Enhanced chimeric antigen receptors and use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019023396A1 true WO2019023396A1 (en) | 2019-01-31 |
Family
ID=65040821
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/043779 Ceased WO2019023396A1 (en) | 2017-07-25 | 2018-07-25 | ENHANCED CHIMERIC ANTIGENIC RECEPTORS AND USES THEREOF |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20240336699A1 (enExample) |
| EP (2) | EP4582146A2 (enExample) |
| JP (2) | JP2020530989A (enExample) |
| KR (1) | KR20200032174A (enExample) |
| CN (2) | CN118206655A (enExample) |
| AU (1) | AU2018306307B2 (enExample) |
| CA (1) | CA3070998A1 (enExample) |
| TW (1) | TW201908335A (enExample) |
| WO (1) | WO2019023396A1 (enExample) |
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020106621A1 (en) * | 2018-11-19 | 2020-05-28 | Board Of Regents, The University Of Texas System | A modular, polycistronic vector for car and tcr transduction |
| WO2021032783A1 (en) | 2019-08-21 | 2021-02-25 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Methods for detecting, quantifying and monitoring immune-cell mediated cytotoxicity of cell populations comprising immune cells and/or stem cells |
| WO2021225532A1 (en) * | 2020-05-08 | 2021-11-11 | Mahidol University | A chimeric antigen receptor and modified cells carrying the receptor |
| WO2022120334A1 (en) | 2020-12-03 | 2022-06-09 | Century Therapeutics, Inc. | Genetically engineered cells and uses thereof |
| US20220195396A1 (en) * | 2020-12-03 | 2022-06-23 | Century Therapeutics, Inc. | Genetically Engineered Cells and Uses Thereof |
| CN114729026A (zh) * | 2020-07-29 | 2022-07-08 | 蒂卡洛斯有限公司 | 用于稳定免疫突触的嵌合抗原受体(car)t细胞 |
| WO2022216857A1 (en) | 2021-04-07 | 2022-10-13 | Century Therapeutics, Inc. | Gene transfer vectors and methods of engineering cells |
| WO2022216514A1 (en) | 2021-04-07 | 2022-10-13 | Century Therapeutics, Inc. | Compositions and methods for generating gamma-delta t cells from induced pluripotent stem cells |
| WO2022216624A1 (en) | 2021-04-07 | 2022-10-13 | Century Therapeutics, Inc. | Compositions and methods for generating alpha-beta t cells from induced pluripotent stem cells |
| WO2022221548A1 (en) * | 2021-04-14 | 2022-10-20 | Board Of Regents, The University Of Texas System | Chimeric antigen receptors to target cd5-positive cancers |
| WO2023069936A1 (en) * | 2021-10-18 | 2023-04-27 | Kite Pharma, Inc. | Signaling domains for chimeric antigen receptors |
| US11661459B2 (en) | 2020-12-03 | 2023-05-30 | Century Therapeutics, Inc. | Artificial cell death polypeptide for chimeric antigen receptor and uses thereof |
| WO2023129937A1 (en) | 2021-12-29 | 2023-07-06 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof |
| WO2023240212A2 (en) | 2022-06-08 | 2023-12-14 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd133 / anti-egfr chimeric antigen receptors, and uses thereof |
| WO2023240169A1 (en) | 2022-06-08 | 2023-12-14 | Century Therapeutics, Inc. | Immunoeffector cells derived from induced pluripotent stem cells genetically engineered with membrane bound il12 and uses thereof |
| WO2024102838A1 (en) | 2022-11-09 | 2024-05-16 | Century Therapeutics, Inc. | Engineered interleukin-7 receptors and uses thereof |
| WO2024103017A2 (en) | 2022-11-10 | 2024-05-16 | Century Therapeutics, Inc. | Genetically engineered cells having anti-nectin4 chimeric antigen receptors, and uses thereof |
| WO2025101938A2 (en) | 2023-11-10 | 2025-05-15 | Century Therapeutics, Inc. | Genetically engineered cells having multi-transmembrane domain chimeric antigen receptors utilizing g protein-coupled receptor scaffolds, and uses thereof |
| WO2025106626A1 (en) | 2023-11-15 | 2025-05-22 | Century Therapeutics, Inc. | Genetically engineered cells expressing c-x-c chemokine receptor type 4, and uses thereof |
| WO2025207795A1 (en) | 2024-03-26 | 2025-10-02 | Juno Therapeutics, Inc. | Genetically engineered cells having anti-cd33 / anti-cd123 chimeric antigen receptors, and uses thereof |
| WO2025207798A1 (en) | 2024-03-26 | 2025-10-02 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd123 chimeric antigen receptors, and uses thereof |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL2023924B1 (nl) * | 2019-10-01 | 2021-06-01 | Lely Patent Nv | Meetsysteem voor levensmiddelen |
| CN113234169B (zh) * | 2020-12-11 | 2022-11-01 | 广州百暨基因科技有限公司 | 靶向cll1嵌合抗原受体及其应用 |
| CN113980134B (zh) | 2020-12-11 | 2022-05-31 | 广州百暨基因科技有限公司 | 抗cll1抗体及其应用 |
| CN121152880A (zh) * | 2023-05-25 | 2025-12-16 | 南京传奇生物科技有限公司 | 嵌合抗原受体及其用途 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160145337A1 (en) * | 2012-05-25 | 2016-05-26 | Cellectis | Cd19 specific chimeric antigen receptor and uses thereof |
| US20170008963A1 (en) * | 2013-02-20 | 2017-01-12 | Jennifer Brogdon | TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR |
| US20170152480A1 (en) * | 2009-11-03 | 2017-06-01 | City Of Hope | Truncated Epiderimal Growth Factor Receptor (EGFRt) for Transduced T Cell Selection |
| WO2017096329A1 (en) * | 2015-12-03 | 2017-06-08 | Juno Therapeutics, Inc. | Modified chimeric receptors and related compositions and methods |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1993011794A1 (en) * | 1991-12-13 | 1993-06-24 | Xoma Corporation | Methods and materials for preparation of modified antibody variable domains and therapeutic uses thereof |
| EP2216342B1 (en) | 2003-07-31 | 2015-04-22 | Immunomedics, Inc. | Anti-CD19 antibodies |
| CN104853766A (zh) | 2012-10-02 | 2015-08-19 | 纪念斯隆-凯特琳癌症中心 | 用于免疫疗法的组合物和方法 |
| EP3783098A1 (en) * | 2013-05-14 | 2021-02-24 | Board Of Regents, The University Of Texas System | Human application of engineered chimeric antigen receptor (car) t-cells |
| CA2956667A1 (en) * | 2013-07-29 | 2015-02-05 | Bluebird Bio, Inc. | Multipartite signaling proteins and uses thereof |
| CN106459924A (zh) * | 2014-04-23 | 2017-02-22 | 得克萨斯州大学系统董事会 | 用于疗法中的嵌合抗原受体(car)及其制备方法 |
| EP3215535A2 (en) * | 2014-11-05 | 2017-09-13 | Board of Regents, The University of Texas System | Gene modified immune effector cells and engineered cells for expansion of immune effector cells |
| KR102329836B1 (ko) * | 2015-01-26 | 2021-11-19 | 셀렉티스 | 암 면역치료를 위한 항-CLL1 특이적 단일-체인 키메라 항원 수용체들(scCARS) |
| EP3286225B1 (en) * | 2015-04-23 | 2020-07-01 | Baylor College of Medicine | Cd5 chimeric antigen receptor for adoptive t cell therapy |
| WO2017112877A1 (en) * | 2015-12-22 | 2017-06-29 | Icell Gene Therapeutics, Llc | Chimeric antigen receptors and enhancement of anti-tumor activity |
-
2018
- 2018-07-25 AU AU2018306307A patent/AU2018306307B2/en active Active
- 2018-07-25 CN CN202410061631.8A patent/CN118206655A/zh active Pending
- 2018-07-25 JP JP2020503988A patent/JP2020530989A/ja not_active Withdrawn
- 2018-07-25 CA CA3070998A patent/CA3070998A1/en active Pending
- 2018-07-25 KR KR1020207005375A patent/KR20200032174A/ko not_active Ceased
- 2018-07-25 CN CN201880058794.3A patent/CN111432823A/zh active Pending
- 2018-07-25 WO PCT/US2018/043779 patent/WO2019023396A1/en not_active Ceased
- 2018-07-25 EP EP25169707.4A patent/EP4582146A2/en active Pending
- 2018-07-25 EP EP18838056.2A patent/EP3658163A4/en not_active Withdrawn
- 2018-07-25 TW TW107125720A patent/TW201908335A/zh unknown
-
2023
- 2023-07-19 JP JP2023117421A patent/JP2023134735A/ja active Pending
-
2024
- 2024-06-21 US US18/750,233 patent/US20240336699A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170152480A1 (en) * | 2009-11-03 | 2017-06-01 | City Of Hope | Truncated Epiderimal Growth Factor Receptor (EGFRt) for Transduced T Cell Selection |
| US20160145337A1 (en) * | 2012-05-25 | 2016-05-26 | Cellectis | Cd19 specific chimeric antigen receptor and uses thereof |
| US20170008963A1 (en) * | 2013-02-20 | 2017-01-12 | Jennifer Brogdon | TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR |
| WO2017096329A1 (en) * | 2015-12-03 | 2017-06-08 | Juno Therapeutics, Inc. | Modified chimeric receptors and related compositions and methods |
Non-Patent Citations (1)
| Title |
|---|
| JOHNSON, LA ET AL.: "Rational development and characterization of humanized anti-EGFR variant III chimeric antigen receptor T cells for glioblastoma", SCIENCE TRANSLATIONAL MEDICINE, vol. 7, no. 275, 18 February 2015 (2015-02-18), XP055362795 * |
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020106621A1 (en) * | 2018-11-19 | 2020-05-28 | Board Of Regents, The University Of Texas System | A modular, polycistronic vector for car and tcr transduction |
| WO2021032783A1 (en) | 2019-08-21 | 2021-02-25 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Methods for detecting, quantifying and monitoring immune-cell mediated cytotoxicity of cell populations comprising immune cells and/or stem cells |
| CN115461361A (zh) * | 2020-05-08 | 2022-12-09 | 玛希敦大学 | 嵌合抗原受体和携带该受体的经修饰的细胞 |
| WO2021225532A1 (en) * | 2020-05-08 | 2021-11-11 | Mahidol University | A chimeric antigen receptor and modified cells carrying the receptor |
| CN114729026A (zh) * | 2020-07-29 | 2022-07-08 | 蒂卡洛斯有限公司 | 用于稳定免疫突触的嵌合抗原受体(car)t细胞 |
| CN114729026B (zh) * | 2020-07-29 | 2024-01-05 | 蒂卡洛斯有限公司 | 用于稳定免疫突触的嵌合抗原受体(car)t细胞 |
| WO2022120334A1 (en) | 2020-12-03 | 2022-06-09 | Century Therapeutics, Inc. | Genetically engineered cells and uses thereof |
| US20220195396A1 (en) * | 2020-12-03 | 2022-06-23 | Century Therapeutics, Inc. | Genetically Engineered Cells and Uses Thereof |
| US12269888B2 (en) | 2020-12-03 | 2025-04-08 | Century Therapeutics, Inc. | Artificial cell death polypeptide for chimeric antigen receptor and uses thereof |
| US11661459B2 (en) | 2020-12-03 | 2023-05-30 | Century Therapeutics, Inc. | Artificial cell death polypeptide for chimeric antigen receptor and uses thereof |
| WO2022216857A1 (en) | 2021-04-07 | 2022-10-13 | Century Therapeutics, Inc. | Gene transfer vectors and methods of engineering cells |
| WO2022216514A1 (en) | 2021-04-07 | 2022-10-13 | Century Therapeutics, Inc. | Compositions and methods for generating gamma-delta t cells from induced pluripotent stem cells |
| WO2022216624A1 (en) | 2021-04-07 | 2022-10-13 | Century Therapeutics, Inc. | Compositions and methods for generating alpha-beta t cells from induced pluripotent stem cells |
| WO2022221548A1 (en) * | 2021-04-14 | 2022-10-20 | Board Of Regents, The University Of Texas System | Chimeric antigen receptors to target cd5-positive cancers |
| WO2023069936A1 (en) * | 2021-10-18 | 2023-04-27 | Kite Pharma, Inc. | Signaling domains for chimeric antigen receptors |
| WO2023129937A1 (en) | 2021-12-29 | 2023-07-06 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof |
| WO2023240212A2 (en) | 2022-06-08 | 2023-12-14 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd133 / anti-egfr chimeric antigen receptors, and uses thereof |
| WO2023240169A1 (en) | 2022-06-08 | 2023-12-14 | Century Therapeutics, Inc. | Immunoeffector cells derived from induced pluripotent stem cells genetically engineered with membrane bound il12 and uses thereof |
| WO2024102838A1 (en) | 2022-11-09 | 2024-05-16 | Century Therapeutics, Inc. | Engineered interleukin-7 receptors and uses thereof |
| WO2024103017A2 (en) | 2022-11-10 | 2024-05-16 | Century Therapeutics, Inc. | Genetically engineered cells having anti-nectin4 chimeric antigen receptors, and uses thereof |
| WO2025101938A2 (en) | 2023-11-10 | 2025-05-15 | Century Therapeutics, Inc. | Genetically engineered cells having multi-transmembrane domain chimeric antigen receptors utilizing g protein-coupled receptor scaffolds, and uses thereof |
| WO2025106626A1 (en) | 2023-11-15 | 2025-05-22 | Century Therapeutics, Inc. | Genetically engineered cells expressing c-x-c chemokine receptor type 4, and uses thereof |
| WO2025207795A1 (en) | 2024-03-26 | 2025-10-02 | Juno Therapeutics, Inc. | Genetically engineered cells having anti-cd33 / anti-cd123 chimeric antigen receptors, and uses thereof |
| WO2025207798A1 (en) | 2024-03-26 | 2025-10-02 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd123 chimeric antigen receptors, and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3658163A1 (en) | 2020-06-03 |
| AU2018306307B2 (en) | 2025-04-17 |
| JP2023134735A (ja) | 2023-09-27 |
| AU2018306307A1 (en) | 2020-02-20 |
| CN111432823A (zh) | 2020-07-17 |
| EP3658163A4 (en) | 2021-08-04 |
| JP2020530989A (ja) | 2020-11-05 |
| KR20200032174A (ko) | 2020-03-25 |
| TW201908335A (zh) | 2019-03-01 |
| CN118206655A (zh) | 2024-06-18 |
| EP4582146A2 (en) | 2025-07-09 |
| CA3070998A1 (en) | 2019-01-31 |
| US20240336699A1 (en) | 2024-10-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240336699A1 (en) | Enhanced chimeric antigen receptors and use thereof | |
| US20210253729A1 (en) | Enhanced chimeric antigen receptors and use thereof | |
| EP3886874B1 (en) | Methods for ex vivo expansion of natural killer cells and use thereof | |
| AU2018256436A1 (en) | Immune cells expressing engineered antigen receptors | |
| TW202124711A (zh) | 用於過繼細胞療法之免疫細胞 | |
| JP7529265B2 (ja) | CD8abおよびクラス1制限T細胞受容体の強制発現による細胞傷害性CD8細胞へのCD4 T細胞の再プログラミング | |
| AU2019345052B2 (en) | Protein L for activation and expansion of chimeric antigen receptor-modified immune cells | |
| US20240261332A1 (en) | Inhibitory chimeric antigen receptor prevents on-target off-tumor effects of adoptive cell therapy | |
| US20220033848A1 (en) | A modular, polycistronic vector for car and tcr transduction | |
| US20240125765A1 (en) | A method for selection of cryopreserved cord blood units for the manufacture of engineered natural killer cells with enhanced potency against cancer | |
| CN117098543A (zh) | 用于选择冷冻保存的脐带血单位以制备具有增强的抗癌效力的工程化自然杀伤细胞的方法 | |
| AU2024280012A1 (en) | Selection of cryopreserved cord blood units for the manufacture of natural killer cells with enhanced potency | |
| WO2024249728A2 (en) | Selection of cryopreserved cord blood units for the manufacture of natural killer cells with enhanced potency |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18838056 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3070998 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020503988 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018306307 Country of ref document: AU Date of ref document: 20180725 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20207005375 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018838056 Country of ref document: EP Effective date: 20200225 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2018838056 Country of ref document: EP |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020207005375 Country of ref document: KR |