WO2018191748A1 - Chimeric antigen receptor t cells targeting the tumor microenvironment - Google Patents

Chimeric antigen receptor t cells targeting the tumor microenvironment Download PDF

Info

Publication number
WO2018191748A1
WO2018191748A1 PCT/US2018/027783 US2018027783W WO2018191748A1 WO 2018191748 A1 WO2018191748 A1 WO 2018191748A1 US 2018027783 W US2018027783 W US 2018027783W WO 2018191748 A1 WO2018191748 A1 WO 2018191748A1
Authority
WO
WIPO (PCT)
Prior art keywords
car
cell
seq
cells
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/027783
Other languages
English (en)
French (fr)
Inventor
Marcela V. Maus
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
General Hospital Corp
Original Assignee
General Hospital Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by General Hospital Corp filed Critical General Hospital Corp
Priority to CA3059444A priority Critical patent/CA3059444A1/en
Priority to CN201880025361.8A priority patent/CN110520524A/zh
Priority to AU2018251206A priority patent/AU2018251206A1/en
Priority to JP2019555484A priority patent/JP7505885B2/ja
Priority to US16/603,675 priority patent/US12378297B2/en
Priority to EP18784599.5A priority patent/EP3609914B1/en
Publication of WO2018191748A1 publication Critical patent/WO2018191748A1/en
Priority to JP2020542979A priority patent/JP2021512635A/ja
Priority to US16/969,098 priority patent/US20210038646A1/en
Priority to CN201980024375.2A priority patent/CN111971053A/zh
Priority to CA3090546A priority patent/CA3090546A1/en
Priority to EP19751389.8A priority patent/EP3752170A4/en
Priority to PCT/US2019/017727 priority patent/WO2019157533A1/en
Priority to AU2019218989A priority patent/AU2019218989B2/en
Anticipated expiration legal-status Critical
Priority to US18/477,532 priority patent/US20240075070A1/en
Priority to AU2023278069A priority patent/AU2023278069B2/en
Priority to JP2024014208A priority patent/JP2024062986A/ja
Priority to JP2024193719A priority patent/JP2025032089A/ja
Priority to AU2025205213A priority patent/AU2025205213A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4203Receptors for growth factors
    • A61K40/4204Epidermal growth factor receptors [EGFR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/47Brain; Nervous system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • the technology described herein relates to immunotherapy.
  • Chimeric antigen receptor provide a way to direct a cytotoxic T cell response to target cells expressing a selected target antigen, most often a tumor antigen or tumor-associated antigen.
  • CARs are an adaptation of the T cell receptor, where the antigen binding domain is replaced with the antigen binding domain of an antibody that specifically binds the derived target antigen. Engagement of the target antigen on the surface of a target cell by a CAR expressed on a T cell ("CAR T cell" or "CAR-T”) promotes killing of the target cell.
  • the invention provides chimeric antigen receptor (CAR) T cells including a heterologous nucleic acid molecule, wherein the heterologous nucleic acid molecule includes: (a) a first polynucleotide encoding a CAR including an antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and (b) a second polynucleotide encoding a therapeutic agent.
  • the first and second polynucleotides are included within a single polynucleotide molecule.
  • the CAR further includes one or more co-stimulatory domains (e.g., 4-1 BB; also see below).
  • the therapeutic agent is or includes an antibody reagent (e.g., a single chain antibody, a single domain antibody (e.g., a camelid antibody), or a bispecific antibody reagent (e.g., a bispecific T cell engager (BiTE); also see below).
  • the therapeutic agent is or includes a cytokine.
  • the CAR and the therapeutic agent are produced in the form of a polyprotein (and thus may be encoded within a single nucleic acid molecule), which is cleaved to generate separate CAR and therapeutic agent molecules.
  • the polyprotein includes a cleavable moiety (e.g., a 2A peptide, such as P2A or T2A; also see below) between the CAR and the therapeutic agent.
  • the CAR and the therapeutic agent are each constitutively expressed.
  • expression of the CAR and the therapeutic agent is driven by an elongation factor-1 alpha (EF1 a) promoter.
  • EF1 a elongation factor-1 alpha
  • the therapeutic agent is expressed under the control of an inducible promoter (e.g., the NFAT promoter), which is optionally inducible by T cell receptor or CAR signaling.
  • an inducible promoter e.g., the NFAT promoter
  • the CAR is expressed under the control of a constitutive promoter and the therapeutic agent is expressed under the control of an inducible promoter (e.g., the NFAT promoter), which is optionally inducible by T cell receptor or CAR signaling.
  • the antigen-binding domain of the CAR is or includes an antibody, a single chain antibody, a single domain antibody (e.g., a camelid antibody), or a ligand.
  • the transmembrane domain of the CAR includes a CD8
  • the intracellular signaling domain includes a ⁇ 3 ⁇ intracellular signaling domain, which optionally includes or consists of the sequence of any one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, and 68, or a variant thereof.
  • a 4-1 BB co-stimulatory domain is included, which optionally includes or consists of the sequence of any one of SEQ ID NOs: 5, 1 1 , 1 7, 23, 29, 38, 47, 59, and 67, or a variant thereof.
  • the CAR antigen-binding domain or the therapeutic agent when the therapeutic agent is or includes an antibody reagent, bind to a tumor-associated antigen (see, e.g., below).
  • the tumor-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds is a solid tumor-associated antigen.
  • the tumor- associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds includes epidermal growth factor receptor variant III (EGFRvlll), EGFR, CD19, prostate-specific membrane antigen (PSMA), or IL-13 receptor alpha 2 (IL-13Ra2), and optionally the CAR antigen-binding domain or the therapeutic agent includes a sequence selected from the group consisting of SEQ ID NO: 21 , 27, 33, 36, 42, 45, 51 , 55, 57, 63, 65, and variants thereof.
  • the CAR antigen-binding domain or the therapeutic agent when the therapeutic agent is or includes an antibody reagent, binds to a Treg-associated antigen.
  • the Treg-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds is selected from the group consisting of glycoprotein A repetitions predominant (GARP), latency-associated peptide (LAP), CD25, and cytotoxic T lymphocyte-associated antigen-4 (CTLA-4), and optionally the CAR antigen-binding domain or the therapeutic agent includes a sequence selected from the group consisting of SEQ ID NO: 3, 9, 1 5, 25, and variants thereof.
  • the invention further provides CAR T cells including a polynucleotide encoding a CAR, wherein the CAR includes an antigen-binding domain, a transmembrane domain (e.g., CD8 hinge/TM; see, e.g., below for additional examples), and an intracellular signaling domain (e.g., CD3z; see, e.g., below for additional examples); and the antigen-binding domain binds to a Treg-associated antigen.
  • the Treg-associated antigen is selected from the group consisting of GARP, LAP, CD25, and CTLA-4.
  • the CAR further includes one or more co-stimulatory domains (e.g., 4-1 BB; see, e.g., below, for additional examples).
  • the antigen- binding domain of the CAR includes a scFv or a single domain antibody, which optionally includes a sequence selected from the group consisting of SEQ ID NO: 3, 9, 1 5, 25, and variants thereof.
  • the invention further provides CAR T cells including a heterologous nucleic acid molecule encoding an amino acid sequence having at least 90% (e.g., at least 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, or 1 00%) sequence identity to the amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61 , SEQ ID NO: 19, SEQ ID NO: 1 , SEQ ID NO: 7, and SEQ ID NO: 13.
  • the invention provides nucleic acid molecules encoding (i) CAR polypeptides or (ii) polyproteins including a CAR polypeptide and a therapeutic agent, as described herein.
  • the invention additional provides (i) CAR polypeptides or (ii) polyproteins including a CAR polypeptide and a therapeutic agent, as described herein. [0016] The invention additional provides pharmaceutical compositions including one or more CAR T cells, nucleic acid molecules, CAR polypeptides, or a polyproteins as described herein.
  • the methods include administering to the subject a pharmaceutical composition including one or more CAR T cells or pharmaceutical compositions described herein.
  • the methods target the tumor microenvironment, by which, e.g., systemic toxicity is reduced.
  • the cancer is characterized by the presence of one or more solid tumors.
  • the cancer is characterized by tumor-infiltrating Tregs.
  • the invention further provides methods of treating a subject (e.g., a patient, such as a human patient) having cancer.
  • the methods include administering to the subject a CAR T cell product, genetically modified to secrete a tumor-toxic antibody or cytokine, wherein by directing the cancer toxicity locally to the tumor microenvironment, systemic toxicity is reduced.
  • the CAR T cell is genetically modified to deliver an antibody against CTLA4, CD25, GARP, LAP, IL15, CSF1 R, or EGFR, or a bispecific antibody (directed against, e.g., EGFR and CD3) against to the tumor
  • the invention additionally provides methods of delivering one or more therapeutic agents to a tissue or organ in a patient to treat a disease or pathology.
  • the methods include administering to the patient a CAR T cell, genetically modified to secrete a therapeutic antibody, toxin, or agent, wherein the therapeutic antibody, toxin, or agent would, by itself, be unable to enter or penetrate the tissue or organ.
  • the tissue or organ is in the nervous system.
  • the nervous system is the central nervous system (e.g., brain).
  • the disease or pathology is glioblastoma.
  • the therapeutic antibody is anti-EGFR (anti- epidermal growth factor receptor) or anti-EGFRvlll.
  • the invention also includes use of the CAR T cells, polypeptides, nucleic acid molecules, pharmaceutical compositions, and other compositions and molecules in the use of preventing or treating a disease or condition described herein, or in the use of the preparation of a medicament therefor.
  • “decrease,” “reduced,” “reduction,” or “inhibit” are all used herein to mean a decrease by a statistically significant amount.
  • “reduce,” “reduction,” or “decrease” or “inhibit” typically means a decrease by at least 10% as compared to a reference level (e.g., the absence of a given treatment or agent) and can include, for example, a decrease by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99% , or more.
  • “reduction” or “inhibition” does not encompass a complete inhibition or reduction as compared to a reference level.
  • “Complete inhibition” is a 100% inhibition as compared to a reference level. Where applicable, a decrease can be preferably down to a level accepted as within the range of normal for an individual without a given disorder.
  • the terms “increased,” “increase,” “enhance,” or “activate” are all used herein to mean an increase by a statically significant amount.
  • the terms “increased,” “increase,” “enhance,” or “activate” can mean an increase of at least 10% as compared to a reference level, for example, an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 1 0-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3-fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, or any increase between 2-fold and 10-fold or greater as compared to a reference level.
  • an "increase” is a statistically significant increase in such
  • a "subject” means a human or animal. Usually the animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include, for example,
  • Rodents include, for example, mice, rats, woodchucks, ferrets, rabbits and hamsters.
  • Domestic and game animals include, for example, cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, canine species, e.g., dog, fox, wolf, avian species, e.g., chicken, emu, ostrich, and fish, e.g., trout, catfish and salmon.
  • the subject is a mammal, e.g., a primate, e.g., a human.
  • the terms, "individual,” “patient,” and “subject” are used interchangeably herein.
  • the subject is a mammal.
  • the mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, or cow, but is not limited to these examples. Mammals other than humans can be advantageously used as subjects that represent animal models of disease, e.g., cancer.
  • a subject can be male or female.
  • a subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment (e.g., glioblastoma, glioma, leukemia, or another type of cancer, among others) or one or more complications related to such a condition, and optionally, have already undergone treatment for the condition or the one or more complications related to the condition.
  • a subject can also be one who has not been previously diagnosed as having such condition or related complications.
  • a subject can be one who exhibits one or more risk factors for the condition or one or more complications related to the condition or a subject who does not exhibit risk factors.
  • a "subject in need" of treatment for a particular condition can be a subject having that condition, diagnosed as having that condition, or at risk of developing that condition.
  • a "disease” is a state of health of an animal, for example, a human, wherein the animal cannot maintain homeostasis, and wherein if the disease is not ameliorated, then the animal's health continues to deteriorate.
  • a "disorder" in an animal is a state of health in which the animal is able to maintain homeostasis, but in which the animal's state of health is less favorable than it would be in the absence of the disorder. Left untreated, a disorder does not necessarily cause a further decrease in the animal's state of health.
  • tumor antigen and “cancer antigen” are used interchangeably to refer to antigens that are differentially expressed by cancer cells and can thereby be exploited in order to target cancer cells.
  • Cancer antigens are antigens that can potentially stimulate apparently tumor-specific immune responses. Some of these antigens are encoded, although not necessarily expressed, by normal cells. These antigens can be characterized as those which are normally silent (i.e., not expressed) in normal cells, those that are expressed only at certain stages of differentiation and those that are temporally expressed such as embryonic and fetal antigens.
  • cancer antigens are encoded by mutant cellular genes, such as oncogenes (e.g., activated ras oncogene), suppressor genes (e.g., mutant p53), and fusion proteins resulting from internal deletions or chromosomal translocations.
  • oncogenes e.g., activated ras oncogene
  • suppressor genes e.g., mutant p53
  • tumor antigens have been defined in terms of multiple solid tumors: MAGE 1 , 2, & 3, defined by immunity; MART-1 /Melan-A, gp100, carcinoembryonic antigen (CEA), HER2, mucins (i.e., MUC-1 ), prostate-specific antigen (PSA), and prostatic acid phosphatase (PAP).
  • viral proteins such as some encoded by hepatitis B (HBV), Epstein-Barr (EBV), and human papilloma (HPV) have been shown to be important in the development of hepatocellular carcinoma, lymphoma, and cervical cancer, respectively.
  • tumor antigens are provided below and include, e.g., EGFR, EGFRvlll, CD19, PSMA, BCMA, IL13Ra2, etc.
  • Treg antigen or “Treg-associated antigen” are used interchangeably to refer to antigens that are expressed by T regulatory (Treg) cells. These antigens may optionally be targeted by the cells and methods of the invention. Examples of Treg antigens are provided below and include, e.g., GARP, LAP, CD25, and CTLA4.
  • chimeric refers to the product of the fusion of portions of at least two or more different polynucleotide molecules.
  • the term “chimeric” refers to a gene expression element produced through the manipulation of known elements or other polynucleotide molecules.
  • bi-specific T cell engagers polypeptides that each include tandemly linked single-chain variable fragments (scFvs).
  • the scFvs are linked by a linker (e.g., a glycine-rich linker).
  • TCR T cell receptor
  • target antigen e.g., a tumor-associated antigen
  • activation can refer to the state of a T cell that has been sufficiently stimulated to induce detectable cellular proliferation. In some embodiments activation can refer to induced cytokine production. In other embodiments, activation can refer to detectable effector functions. At a minimum, an "activated T cell” as used herein is a proliferative T cell.
  • specific binding refers to a physical interaction between two molecules, compounds, cells and/or particles wherein the first entity binds to the second, target, entity with greater specificity and affinity than it binds to a third entity which is a non- target.
  • specific binding can refer to an affinity of the first entity for the second target, entity, which is at least 10 times, at least 50 times, at least 100 times, at least 500 times, at least 1000 times or more greater than the affinity for the third non-target entity under the same conditions.
  • a reagent specific for a given target is one that exhibits specific binding for that target under the conditions of the assay being utilized.
  • a non-limiting example includes an antibody, or a ligand, which recognizes and binds with a cognate binding partner (for example, a stimulatory and/or costimulatory molecule present on a T cell) protein.
  • a "stimulatory ligand,” as used herein, refers to a ligand that when present on an antigen presenting cell (APC, e.g., a macrophage, a dendritic cell, a B-cell, an artificial APC, and the like) can specifically bind with a cognate binding partner (referred to herein as a "stimulatory molecule” or "co- stimulatory molecule”) on a T cell, thereby mediating a primary response by the T cell, including, but not limited to, proliferation, activation, initiation of an immune response, and the like.
  • APC antigen presenting cell
  • a cognate binding partner referred to herein as a "stimulatory molecule” or "co- stimulatory molecule”
  • Stimulatory ligands are well-known in the art and encompass, inter alia, an MHC Class I molecule loaded with a peptide, an anti- CD3 antibody, a superagonist anti-CD28 antibody, and a superagonist anti-CD2 antibody.
  • a "stimulatory molecule,” as the term is used herein, means a molecule on a T cell that specifically binds with a cognate stimulatory ligand present on an antigen presenting cell.
  • Co-stimulatory ligand includes a molecule on an APC that specifically binds a cognate co-stimulatory molecule on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
  • a co-stimulatory ligand can include, but is not limited to, 4-1 BBL, OX40L, CD7, B7-1 (CD80), B7-2 (CD86), PD-L1 , PD-L2, inducible COStimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM), CD30L, CD40, CD70, CD83, HLA-G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, HVEM, an agonist or antibody that binds Toll-like receptor and a ligand that specifically binds with B7-H3.
  • a co-stimulatory ligand also can include, but is not limited to, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as, but not limited to, CD27, CD28, 4-1 BB, OX40, CD30, CD40, PD-1 , ICOS, lymphocyte function-associated antigen-1 (LFA-1 ), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83.
  • an antibody that specifically binds with a co-stimulatory molecule present on a T cell such as, but not limited to, CD27, CD28, 4-1 BB, OX40, CD30, CD40, PD-1 , ICOS, lymphocyte function-associated antigen-1 (LFA-1 ), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83.
  • a "co-stimulatory molecule” refers to the cognate binding partner on a T cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the T cell, such as, but not limited to, proliferation.
  • Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA, a Toll-like receptor, CD27, CD28, 4-1 BB, OX40, CD30, CD40, PD-1 , ICOS, lymphocyte function-associated antigen-1 (LFA-1 ), CD2, CD7, LIGHT, NKG2C, B7-H3, and CD83.
  • engineered and its grammatical equivalents as used herein can refer to one or more human-designed alterations of a nucleic acid, e.g., the nucleic acid within an organism's genome.
  • engineered can refer to alterations, additions, and/or deletion of genes.
  • An “engineered cell” can refer to a cell with an added, deleted and/or altered gene.
  • the term “cell” or “engineered cell” and their grammatical equivalents as used herein can refer to a cell of human or non-human animal origin.
  • operably linked refers to a first polynucleotide molecule, such as a promoter, connected with a second transcribable polynucleotide molecule, such as a gene of interest, where the polynucleotide molecules are so arranged that the first polynucleotide molecule affects the function of the second polynucleotide molecule.
  • the two polynucleotide molecules may or may not be part of a single contiguous polynucleotide molecule and may or may not be adjacent.
  • a promoter is operably linked to a gene of interest if the promoter regulates or mediates transcription of the gene of interest in a cell.
  • conservative substitution variants of any of the particular polypeptides described are encompassed.
  • amino acid sequences one of ordinary skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid and retains the desired activity of the polypeptide.
  • conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles consistent with the disclosure.
  • a given amino acid can be replaced by a residue having similar physiochemical
  • polypeptides comprising conservative amino acid substitutions can be tested in any one of the assays described herein to confirm that a desired activity, e.g., ligand-mediated receptor activity and specificity of a native or reference polypeptide is retained.
  • Amino acids can be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1 ) non- polar: Ala (A), Val (V), Leu (L), He (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gin (Q); (3) acidic: Asp (D), Glu (E); (4) basic: Lys (K), Arg (R), His (H).
  • residues can be divided into groups based on common side-chain properties: (1 ) hydrophobic: Norleucine, Met, Ala, Val, Leu, lie; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe.
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • Particular conservative substitutions include, for example; Ala into Gly or into Ser; Arg into Lys; Asn into Gin or into His; Asp into Glu; Cys into Ser; Gin into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gin ; He into Leu or into Val; Leu into He or into Val; Lys into Arg, into Gin or into Glu; Met into Leu, into Tyr or into He; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and/or Phe into Val, into He or into Leu.
  • a polypeptide described herein can be a functional fragment of one of the amino acid sequences described herein.
  • a "functional fragment” is a fragment or segment of a peptide that retains at least 50% of the wildtype reference polypeptide's activity according to an assay known in the art or described below herein.
  • a functional fragment can comprise conservative substitutions of the sequences disclosed herein.
  • a polypeptide described herein can be a variant of a polypeptide or molecule as described herein.
  • the variant is a conservatively modified variant.
  • Conservative substitution variants can be obtained by mutations of native nucleotide sequences, for example.
  • a "variant,” as referred to herein, is a polypeptide substantially homologous to a native or reference polypeptide, but which has an amino acid sequence different from that of the native or reference polypeptide because of one or a plurality of deletions, insertions, or substitutions.
  • Variant polypeptide-encoding DNA sequences encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to a native or reference DNA sequence, but that encode a variant protein or fragment thereof that retains activity of the non-variant polypeptide.
  • a wide variety of PCR-based site-specific mutagenesis approaches are known in the art and can be applied by the ordinarily skilled artisan.
  • a variant amino acid or DNA sequence can be at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more, identical to a native or reference sequence.
  • the degree of homology (percent identity) between a native and a mutant sequence can be determined, for example, by comparing the two sequences using freely available computer programs commonly employed for this purpose on the world wide web (e.g., BLASTp or BLASTn with default settings).
  • Alterations of the native amino acid sequence can be accomplished by any of a number of techniques known to one of skill in the art. Mutations can be introduced, for example, at particular loci by synthesizing oligonucleotides containing a mutant sequence, flanked by restriction sites permitting ligation to fragments of the native sequence. Following ligation, the resulting reconstructed sequence encodes an analog having the desired amino acid insertion, substitution, or deletion. Alternatively, oligonucleotide- directed site-specific mutagenesis procedures can be employed to provide an altered nucleotide sequence having particular codons altered according to the substitution, deletion, or insertion required. Techniques for making such alterations are well established and include, for example, those disclosed by Walder et al.
  • Any cysteine residue not involved in maintaining the proper conformation of a polypeptide also can be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. Conversely, cysteine bond(s) can be added to a polypeptide to improve its stability or facilitate oligomerization.
  • DNA is defined as deoxyribonucleic acid.
  • polynucleotide is used herein interchangeably with “nucleic acid” to indicate a polymer of nucleosides.
  • a polynucleotide is composed of nucleosides that are naturally found in DNA or RNA (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine) joined by phosphodiester bonds.
  • nucleosides or nucleoside analogs containing chemically or biologically modified bases, modified backbones, etc., whether or not found in naturally occurring nucleic acids, and such molecules may be preferred for certain applications.
  • this application refers to a polynucleotide it is understood that both DNA, RNA, and in each case both single- and double-stranded forms (and complements of each single-stranded molecule) are provided.
  • Polynucleotide sequence as used herein can refer to the polynucleotide material itself and/or to the sequence information (i.e., the succession of letters used as abbreviations for bases) that biochemically characterizes a specific nucleic acid. A polynucleotide sequence presented herein is presented in a 5' to 3' direction unless otherwise indicated.
  • polypeptide refers to a polymer of amino acids.
  • a peptide is a relatively short polypeptide, typically between about 2 and 60 amino acids in length.
  • Polypeptides used herein typically contain amino acids such as the 20 L-amino acids that are most commonly found in proteins. However, other amino acids and/or amino acid analogs known in the art can be used.
  • One or more of the amino acids in a polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a phosphate group, a fatty acid group, a linker for conjugation, functionalization, etc.
  • a polypeptide that has a nonpolypeptide moiety covalently or noncovalently associated therewith is still considered a "polypeptide.” Exemplary modifications include glycosylation and palmitoylation.
  • Polypeptides can be purified from natural sources, produced using recombinant DNA technology or synthesized through chemical means such as conventional solid phase peptide synthesis, etc.
  • polypeptide sequence or "amino acid sequence” as used herein can refer to the polypeptide material itself and/or to the sequence information (i.e., the succession of letters or three letter codes used as abbreviations for amino acid names) that biochemically characterizes a polypeptide.
  • a polypeptide sequence presented herein is presented in an N-terminal to C-terminal direction unless otherwise indicated.
  • a nucleic acid encoding a polypeptide as described herein is comprised by a vector.
  • a nucleic acid sequence encoding a given polypeptide as described herein, or any module thereof is operably linked to a vector.
  • the term "vector,” as used herein, refers to a nucleic acid construct designed for delivery to a host cell or for transfer between different host cells.
  • a vector can be viral or non-viral.
  • the term “vector” encompasses any genetic element that is capable of replication when associated with the proper control elements and that can transfer gene sequences to cells.
  • a vector can include, but is not limited to, a cloning vector, an expression vector, a plasmid, phage, transposon, cosmid, artificial chromosome, virus, virion, etc.
  • expression vector refers to a vector that directs expression of an RNA or polypeptide from sequences linked to transcriptional regulatory sequences on the vector.
  • the sequences expressed will often, but not necessarily, be heterologous to the cell.
  • An expression vector may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example, in human cells for expression and in a prokaryotic host for cloning and amplification.
  • expression refers to the cellular processes involved in producing RNA and proteins and as appropriate, secreting proteins, including where applicable, but not limited to, for example, transcription, transcript processing, translation and protein folding, modification and processing.
  • “Expression products” include RNA transcribed from a gene, and polypeptides obtained by translation of mRNA transcribed from a gene.
  • the term “gene” means the nucleic acid sequence which is transcribed (DNA) to RNA in vitro or in vivo when operably linked to appropriate regulatory sequences.
  • the gene may or may not include regions preceding and following the coding region, e.g. 5' untranslated (5'UTR) or "leader” sequences and 3' UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
  • viral vector refers to a nucleic acid vector construct that includes at least one element of viral origin and has the capacity to be packaged into a viral vector particle.
  • the viral vector can contain a nucleic acid encoding a polypeptide as described herein in place of non-essential viral genes.
  • the vector and/or particle may be utilized for the purpose of transferring nucleic acids into cells either in vitro or in vivo. Numerous forms of viral vectors are known in the art.
  • recombinant vector is meant a vector that includes a heterologous nucleic acid sequence or "transgene” that is capable of expression in vivo. It should be understood that the vectors described herein can, in some embodiments, be combined with other suitable compositions and therapies. In some embodiments, the vector is episomal. The use of a suitable episomal vector provides a means of maintaining the nucleotide of interest in the subject in high copy number extra-chromosomal DNA thereby eliminating potential effects of chromosomal integration.
  • the terms “treat,” “treatment,” “treating,” or “amelioration” refer to therapeutic treatments, wherein the object is to reverse, alleviate, ameliorate, inhibit, slow down, or stop the progression or severity of a condition associated with a disease or disorder, e.g., glioblastoma, glioma, acute lymphoblastic leukemia or other cancer, disease, or disorder.
  • the term “treating” includes reducing or alleviating at least one adverse effect or symptom of a condition, disease or disorder. Treatment is generally “effective” if one or more symptoms or clinical markers are reduced. Alternatively, treatment is “effective” if the progression of a disease is reduced or halted.
  • treatment includes not just the improvement of symptoms or markers, but also a cessation of, or at least slowing of, progress or worsening of symptoms compared to what would be expected in the absence of treatment.
  • Beneficial or desired clinical results include, but are not limited to, alleviation of one or more symptom(s), diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, remission (whether partial or total), and/or decreased mortality, whether detectable or undetectable.
  • treatment also includes providing relief from the symptoms or side effects of the disease (including palliative treatment).
  • composition refers to the active agent in combination with a pharmaceutically acceptable carrier e.g. a carrier commonly used in the
  • a pharmaceutically acceptable carrier can be a carrier other than water.
  • a pharmaceutically acceptable carrier can be a cream, emulsion, gel, liposome, nanoparticle, and/or ointment.
  • a pharmaceutically acceptable carrier can be an artificial or engineered carrier, e.g., a carrier in which the active ingredient would not be found to occur in nature.
  • administering refers to the placement of a therapeutic or pharmaceutical composition as disclosed herein into a subject by a method or route that results in at least partial delivery of the agent at a desired site.
  • Pharmaceutical compositions comprising agents as disclosed herein can be administered by any appropriate route that results in an effective treatment in the subject.
  • statically significant or “significantly” refers to statistical significance and generally means a two standard deviation (2SD) or greater difference.
  • compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
  • the term "consisting essentially of” refers to those elements required for a given embodiment. The term permits the presence of additional elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the technology.
  • the disclosure described herein does not concern a process for cloning human beings, processes for modifying the germ line genetic identity of human beings, uses of human embryos for industrial or commercial purposes or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes.
  • the CAR T cells of the invention can be used to deliver therapeutic molecules for cancer treatment.
  • the CAR T cells of the invention can be used to deliver otherwise toxic antibodies (e.g., anti-CTLA4 or anti-CD25 (e.g., daclizumab) or other molecules (e.g., cytokines) to the tumor microenvironment, where they can advantageously enable activation of surrounding tumor infiltrating lymphocytes, provide checkpoint blockade, and deplete regulatory T cells (Tregs).
  • the CAR T cells of the invention can further be directed against Treg antigens, to facilitate targeting of Treg cells.
  • CAR T cells of the invention can be used to deliver genetically encoded molecules (e.g., antibodies or cytokines) to regions of the body (e.g., the central nervous system, including the brain) that these molecules otherwise cannot reach.
  • CAR T cells targeting EGFRvlll can be used to target brain tumors, and can deliver antibodies (e.g., antibodies against EGFR, such as cetuximab; also see below) to the tumors.
  • the invention thus provides genetically-encoded Treg targeting in the tumor microenvironment.
  • the invention provides genetically-encoded delivery of antibodies that cannot get into certain tissues, and could enhance the potency of T cell therapies by broadening the specificity of the anti-tumor target.
  • the invention accordingly provides for gene-modified T cell therapy for cancer.
  • Fig. 1 is a graph showing killing of human glioma target cell line U87vlll by CART-EGFRvlll cells as a function of CART-EGFRvlll :U87vlll target cell ratio. Untransduced cells were incubated with target cells as a negative control.
  • Figs. 2A and 2B are a series of x-ray overlays showing the location of EGFRvlll expressing tumor (U87vlll) in a subcutaneous model of human glioma.
  • Fig. 2A shows mice treated with
  • FIG. 2B shows mice treated with CART-EGFRvlll on day 4 after implantation (top row), with successful treatment by day 21 (bottom row).
  • Figs. 3A and 3B are a series of x-ray overlays showing the location of EGFRvlll expressing tumor (U87vlll) in a intracranial model of human glioma.
  • Fig. 2A shows mice treated with untransduced (UTD) cells as a negative control at day 5 (D5; top) and D1 1 (bottom).
  • Fig. 2B shows mice treated with CART-EGFRvlll on day 2 after implantation at D5 (top row) and at D21 (bottom row).
  • Figs. 4A and 4B are photomicrographs showing immunohistochemistry of tumor tissue in one patient five days following infusion of CART-EGFRvlll.
  • Fig. 4A shows T cells stained for CD3.
  • Fig. 4B shows CD25+ cells.
  • CD25 is the IL-2 receptor alpha chain, a marker of activated or regulatory T cells.
  • Figs. 5A-5C are fluorescence micrographs qualitatively demonstrating Treg suppression of CAR T cell (red) antitumor activity after 18 hours of coincubation with human glioma cells (green) in vitro.
  • Fig. 5A shows relative concentration of CART-nonspecific cells to glioma cells.
  • Fig. 5B shows relative concentration of CART-EGFRvlll cells to glioma cells with no Tregs in the culture.
  • Fig. 5C shows relative concentration of CART-EGFRvlll cells to glioma cells with Tregs included in the culture.
  • Fig. 5A-5C are fluorescence micrographs qualitatively demonstrating Treg suppression of CAR T cell (red) antitumor activity after 18 hours of coincubation with human glioma cells (green) in vitro.
  • Fig. 5A shows relative concentration of CART-nonspecific cells to glioma cells.
  • Fig. 5B shows relative concentration of CART-EG
  • 5D is a graph showing quantitative readouts of green object confluence as a measure of glioma cell viability as a function of time (up to 48 hours).
  • the top line represents the results shown in Fig. 5A (glioma cell growth), the bottom line represents the results shown in Fig. 5B (glioma cell killing), and the middle line represents the results shown in Fig. 5C (glioma cell resistance to CART-killing).
  • Figs. 6A-6C are flow cytometry plots showing expression of LAP (x-axis) and GARP (y-axis) on control T cells (Fig. 6A), unactivated Tregs (Fig. 6B), and activated Tregs (Fig. 6C).
  • Tregs were sorted from leukopak on CD4+CD25+CD127- and expanded with CD3/CD28 beads for seven days in the presence of IL-2. On day 1 , they were transduced to expressed GFP. After debeading on day 7, expanded Tregs were rested for four days before freezing.
  • Tregs were stained for LAP and GARP expression after overnight rest (non-activated) or overnight activation with anti-CD3 and anti- CD28. Untransduced T cells (CD4+ and CD8+) from the same donor were used as controls for expression (Fig. 6A).
  • Figs. 7A and 7B are flow cytometry histograms corresponding to the results shown in Figs. 6A-6C showing expression of LAP (Fig. 7A) and GARP (Fig. 7B).
  • Figs. 8A-8D are schematic drawings of CAR constructs for targeting Treg-associated antigens.
  • Fig. 8A shows a LAP-targeting CAR construct having an anti-LAP scFv with its light chain (L) and heavy chain (H) arranged in a 5'-to-3' direction, respectively (CART-LAP-L-H).
  • Fig. 8B shows a LAP- targeting CAR construct having an anti-LAP scFv with its heavy chain (H) and light chain (L) arranged in a 5'-to-3' direction, respectively (CART-LAP-H-L).
  • Fig. 8C shows a GARP-targeting CAR construct having an anti-GARP camelid antibody binding domain (CART-GARP).
  • Fig. 8D shows an EGFR-targeted CAR construct having an anti-GARP camelid antibody.
  • Figs. 9A and 9B are graphs showing target Treg killing as a function of CAR T cell-to-target Treg cell ratio. Tregs were transduced with GFP, and cytotoxicity was quantified by monitoring GFP expression. Fig. 9A shows killing of activated Tregs, and Fig. 9B shows killing of non-activated Tregs. CART-LAP-H-L was more effective at killing non-activated Tregs in comparison to CART-LAP-L-H.
  • Figs. 10A and 10B are graphs showing target Treg killing by various anti-Treg CAR T cells (i.e., CART-GARP, CART-LAP-H-L, CART-LAP-L-H, or untransduced control cells) at a 1 :1 ratio of CAR T cells to Tregs for four days.
  • Fig. 10A and 10B show results from the same experiment conducted in two different donors.
  • Figs. 1 1 A-1 1 D are graphs showing target Treg killing as a function of CAR T cell-to-target Treg cell ratio by LAP-targeted CAR T cells after three days of coculture.
  • Figs. 1 1 A and 1 1 B show number of target cells remaining in coculture as measured by flow cytometry.
  • a dashed line indicates the number of target cells in a control sample containing no CAR cells.
  • Fig. 1 1 A shows non-activated Tregs as target cells, whereas Fig. 1 1 B shows activated Tregs as target cells.
  • Figs. 1 1 C and 1 1 D show percent cytotoxicity as measured by luciferase expression by target cells.
  • 1 1 C shows non-activated Tregs as target cells
  • Fig. 1 1 D shows activated Tregs as target cells.
  • circles represent CART-LAP-H-L
  • squares represent CART-LAP-L-H
  • triangles represent untransduced CAR cells.
  • Figs. 12A and 12B are flow cytometry histograms showing the expression of GARP (Fig. 12A) and LAP (Fig. 12B) by HUT78 cells.
  • Figs. 13A and 13B are graphs showing killing of target HUT78 cells as a function of CAR T cell-to-target cell ratio by LAP-targeted CAR T cells after three days of coculture.
  • Fig. 13A shows the number of target cells remaining in culture after three days, as measured by flow cytometry.
  • a dashed line indicates the number of target cells in a control sample containing no CAR cells.
  • Fig. 13B shows percent cytotoxicity as measured by luciferase expression by target cells. Circles represent CART-LAP- H-L, squares represent CART-LAP-L-H, and triangles represent untransduced CAR cells.
  • Figs. 14A and 14B are flow cytometry histograms showing the expression of GARP (Fig. 14A) and LAP (Fig. 14B) by SeAx cells.
  • Figs. 15A and 15B are graphs showing killing of target SeAx cells as a function of CAR T cell- to-target cell ratio by GARP and LAP-targeted CAR T cells after 24 (Fig. 1 5A) hours and 48 hours (Fig. 15B) of coculture, as measured by luciferase expression by target cells.
  • Squares represent CART- GARP
  • upward-facing triangles represent CART-LAP-H-L
  • downward-facing triangles represent CART- LAP-H-L cells
  • diamonds represent untransduced CAR cells.
  • FIGs. 16A-16C are photographs of western blots showing the presence of protein
  • Fig. 16A and 16B show the full gel, including molecular weight reference ladders.
  • Fig. 16C is a longer exposure of the bottom region of the gel shown in Fig. 16B, in which a band between 10 and 1 5 kD is identified with an arrow, indicating the presence of a camelid antibody.
  • Fig. 1 7 is a schematic drawing of CAR-EGFR-BiTE-(EGFR-CD3), an exemplary nucleic acid molecule encoding a CAR and a BiTE.
  • Fig. 1 8 is a schematic drawing of a BiTE having an anti-EGFR domain derived from cetuximab and an anti-CD3 domain derived from blinatumomab.
  • Fig. 1 9 is a set of photographs showing a western blot experiment verifying the presence of BiTE in lane 2.
  • Figs. 20A and 20B are a set of flow cytometry graphs showing binding of BiTE expressed by HEK293 cells transduced with CAR-EGFR-BiTE-(EGFR-CD3) to EGFR expressed by K562 cells (Fig. 20A) and CD3 expressed by Jurkat cells (Fig. 20B).
  • Figs. 21 A and 21 B are a set of flow cytometry graphs showing binding of BiTE expressed by SupT1 cells transduced with CAR-EGFR-BiTE-(EGFR-CD3) to EGFR expressed by K562 cells (Fig. 21 A) and CD3 expressed by CAR-EGFR-BiTE-(EGFR-CD3)-expressing SupT1 cells (Fig. 21 B).
  • Figs. 22A and 22B are a set of flow cytometry graphs showing binding of BiTE expressed by ND4 cells transduced with CAR-EGFR-BiTE-(EGFR-CD3) to EGFR expressed by K562 cells (Fig. 21 A) and CD3 expressed by CAR-EGFR-BiTE-(EGFR-CD3)-expressing ND4 cells (Fig. 21 B).
  • Fig. 23 is a graph showing killing of U87vlll cells by ND4 cells incubated with BiTE secreted by HEK293T cells that were transduced with CAR-EGFR-BiTE-(EGFR-CD3), as a function of effector
  • Fig. 24 is a drawing of an exemplary nucleic acid molecule encoding a CAR under control of an EF1 a promoter and GFP under control of an NFAT promoter.
  • Figs. 25A and 25B are a set of flow cytometry graphs showing GFP expression by cells transduced with the construct of Fig. 24. The red histogram shows GFP expression in unstimulated cells; the blue histogram shows GFP expression in cells stimulated with PMA and ionomycin; and the orange histogram shows GFP expression in cells coated with PEPvlll.
  • Fig. 26A is a schematic drawing of GFP-CAR-EGFR-BiTE-(EGFR-CD3), an exemplary nucleic acid molecule encoding a CAR and a constitutively expressed BiTE.
  • Fig. 26B is a schematic drawing of GFP-CAR-EGFR-BiTE-(CD19-CD3), an exemplary nucleic acid molecule encoding a CAR and a constitutively expressed BiTE.
  • Fig. 27A is a schematic drawing of BiTE-(CD19-CD3)-CAR-EGFR, an exemplary nucleic acid molecule encoding a CAR and an inducibly expressed BiTE.
  • Fig. 27B is a schematic drawing of BiTE-(CD19-CD3)-CAR-EGFR, an exemplary nucleic acid molecule encoding a CAR and an inducibly expressed BiTE.
  • the invention provides improved approaches to chimeric antigen receptor T cell ("CAR T cell”)-based therapy.
  • the improvements relate to different aspects of targeting in antitumor therapy, for example, targeting of the tumor microenvironment.
  • regulatory T cells also referred to herein as "Tregs”
  • Tregs regulatory T cells
  • the invention thus provides CAR T cells, in which the CAR is directed against a Treg antigen or marker (e.g., GARP, LAP, CTLA4, or CD25; also see below).
  • a Treg antigen or marker e.g., GARP, LAP, CTLA4, or CD25; also see below.
  • the invention provides CAR T cells that secrete antibodies (e.g., single chain antibodies, single domain antibodies (e.g., camelid antibodies), or bispecific antibodies (e.g., bispecific T cell engagers)) against one or more Treg antigens or markers (e.g., GARP, LAP, CTLA4 and CD25; also see below).
  • the invention provides CAR T cells and related methods for delivering other therapeutic agents (e.g., antibodies and related molecules) to tumors.
  • a CAR T cell having a CAR specific for EGFRvlll is used to target brain tumors (e.g., glioblastomas).
  • Such CAR T cells may also be used to deliver therapeutic molecules, such as antibody reagents (e.g., single chain antibodies, single domain antibodies (e.g., camelid antibodies), or bi-specific antibodies (e.g., bispecific T cell engagers)) to these tumors.
  • antibody reagents e.g., single chain antibodies, single domain antibodies (e.g., camelid antibodies), or bi-specific antibodies (e.g., bispecific T cell engagers)
  • chimeric antigen receptor or "CAR” or “CARs” as used herein refer to engineered T cell receptors, which graft a ligand or antigen specificity onto T cells (for example, na ' ive T cells, central memory T cells, effector memory T cells or combinations thereof). CARs are also known as artificial T- cell receptors, chimeric T-cell receptors or chimeric immunoreceptors.
  • a CAR places a chimeric extracellular target-binding domain that specifically binds a target, e.g., a polypeptide, expressed on the surface of a cell to be targeted for a T cell response onto a construct including a transmembrane domain and intracellular domain(s) of a T cell receptor molecule.
  • the chimeric extracellular target-binding domain comprises the antigen-binding domain(s) of an antibody that specifically binds an antigen expressed on a cell to be targeted for a T cell response.
  • the properties of the intracellular signaling domain(s) of the CAR can vary as known in the art and as disclosed herein, but the chimeric target/antigen-binding domains(s) render the receptor sensitive to signaling activation when the chimeric target/antigen binding domain binds the target/antigen on the surface of a targeted cell.
  • first- generation CARs include those that solely provide CD3zeta ( ⁇ 3 ⁇ ) signals upon antigen binding.
  • second-generation CARs include those that provide both co-stimulation (e.g., CD28 or CD 137) and activation ( ⁇ 3 ⁇ ) domains, and so-called “third-generation” CARs include those that provide multiple costimulatory (e.g., CD28 and CD 137) domains and activation domains (e.g., CD3 ⁇ ).
  • the CAR is selected to have high affinity or avidity for the target/antigen - for example, antibody-derived target or antigen binding domains will generally have higher affinity and/or avidity for the target antigen than would a naturally-occurring T cell receptor. This property, combined with the high specificity one can select for an antibody provides highly specific T cell targeting by CAR T cells.
  • CAR T cell or “CAR-T” refers to a T cell that expresses a CAR.
  • CARs When expressed in a T cell, CARs have the ability to redirect T-cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, exploiting the antigen-binding properties of monoclonal antibodies.
  • the non-MHC-restricted antigen recognition gives T-cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
  • extracellular target binding domain refers to a polypeptide found on the outside of the cell that is sufficient to facilitate binding to a target.
  • the extracellular target binding domain will specifically bind to its binding partner, i.e., the target.
  • the extracellular target-binding domain can include an antigen-binding domain of an antibody or antibody reagent, or a ligand, which recognizes and binds with a cognate binding partner protein.
  • a ligand is a molecule that binds specifically to a portion of a protein and/or receptor.
  • the cognate binding partner of a ligand useful in the methods and compositions described herein can generally be found on the surface of a cell.
  • Ligand :cognate partner binding can result in the alteration of the ligand-bearing receptor, or activate a physiological response, for example, the activation of a signaling pathway.
  • the ligand can be non-native to the genome.
  • the ligand has a conserved function across at least two species.
  • the CARs described herein comprise an antibody reagent or an antigen-binding domain thereof as an extracellular target-binding domain.
  • an antibody reagent refers to a polypeptide that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and which specifically binds a given antigen.
  • An antibody reagent can comprise an antibody or a polypeptide comprising an antigen-binding domain of an antibody.
  • an antibody reagent can comprise a monoclonal antibody or a polypeptide comprising an antigen-binding domain of a monoclonal antibody.
  • an antibody can include a heavy (H) chain variable region
  • an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions.
  • antibody reagent encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab')2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g. , de Wildt et al. , Eur. J. Immunol.
  • An antibody can have the structural features of IgA, IgG , IgE, Ig D, or IgM (as well as subtypes and combinations thereof).
  • Antibodies can be from any source, including mouse, rabbit, pig, rat, and primate (human and non-human primate) and primatized antibodies.
  • Antibodies also include midibodies, humanized antibodies, chimeric antibodies, and the like. Fully human antibody binding domains can be selected, for example, from phage display libraries using methods known to those of ordinary skill in the art.
  • antibody reagents include single domain antibodies, such as camelid antibodies.
  • VH and VL regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions” ("CDR"), interspersed with regions that are more conserved, termed “framework regions” ("FR").
  • CDR complementarity determining regions
  • FR framework regions
  • the extent of the framework region and CDRs has been precisely defined (see, Kabat, E. A. et al. (1 991 ) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91 -3242, and Chothia et al. , J. Mol. Biol. 1 96:901 -91 7, 1 987; each of which is incorporated by reference herein in its entirety).
  • Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR
  • the antibody or antibody reagent is not a human antibody or antibody reagent (i.e. , the antibody or antibody reagent is mouse), but has been humanized.
  • a "humanized antibody or antibody reagent” refers to a non-human antibody or antibody reagent that has been modified at the protein sequence level to increase its similarity to antibody or antibody reagent variants produced naturally in humans.
  • One approach to humanizing antibodies employs the grafting of murine or other non-human CDRs onto human antibody frameworks.
  • the extracellular target binding domain of a CAR comprises or consists essentially of a single-chain Fv (scFv) fragment created by fusing the VH and VL domains of an antibody, generally a monoclonal antibody, via a flexible linker peptide.
  • the scFv is fused to a transmembrane domain and to a T cell receptor intracellular signaling domain , e.g. , an engineered intracellular signaling domain as described herein.
  • the extracellular target binding domain of a CAR comprises a camelid antibody.
  • the antibody reagent is an anti-GARP antibody reagent and comprises the sequence of SEQ I D NO: 3 or 25, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 3 or 25.
  • the antibody reagent is an anti-LAP antibody reagent and comprises the sequence of SEQ I D NO: 9 or 1 5, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 9 or 1 5.
  • the antibody reagent is an anti-EGFR or anti-EGFRvlll antibody reagent and comprises the sequence of SEQ ID NO: 21 , 27, 33, 36, 42, 45, 55, 57, or 65, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 21 , 27, 33, 36, 42, 45, 55, 57, or 65.
  • the antibody reagent is an anti-CD19 antibody reagent and comprises the sequence of SEQ ID NO: 51 or 63, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 51 or 63.
  • the antibody reagent is an anti-CD3 antibody reagent and comprises the sequence of SEQ ID NO: 34, 43, 52, 56, or 64, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 34, 43, 52, 56, or 64.
  • the antibody can be selected from C225, 3C10, Cetuximab, and 2173.
  • the CARs useful in the technology described herein comprise at least two antigen-specific targeting regions, an extracellular domain, a transmembrane domain, and an intracellular signaling domain.
  • the two or more antigen-specific targeting regions target at least two different antigens and may be arranged in tandem and separated by linker sequences.
  • the CAR is a bispecific CAR. A bispecific CAR is specific to two different antigens.
  • Any cell-surface moiety can be targeted by a CAR.
  • the target will be a cell-surface polypeptide that may be differentially or preferentially expressed on a cell that one wishes to target for a T cell response.
  • antibody reagents can be targeted against, e.g., Glycoprotein A
  • Predominant SERP
  • LAP latency-associated peptide
  • CD25 CD25
  • CTLA-4 CCD25
  • CTLA-4 latency-associated peptide
  • ICOS TNFR2
  • GITR GITR
  • OX40 4-1 BB
  • LAG-3 LAG-3
  • antibody domains can be targeted against, e.g., EGFR or EGFRvlll, as described herein.
  • Targeting tumor antigens or tumor-associated antigens that are specific to the tumors can provide a means to target tumor cells while avoiding or at least limiting collateral damage to non-tumor cells or tissues.
  • tumor antigens include CD19, CD37, BCMA (tumor necrosis factor receptor superfamily member 17 (TNFRSF17); NCBI Gene ID: 608; NCBI Ref Seq
  • RNA_001 183.2 and mRNA (e.g., NCBI Ref Seq NM_ 001 192.2), CEA, immature laminin receptor, TAG- 72, HPV E6 and E7, BING-4, calcium-activated chloride channel 2, cyclin B1 , 9D7, Ep-CAM, EphA3, her2/neu, telomerase, mesotheliun, SAP-1 , survivin, BAGE family, CAGE family, GAGE family, MAGE family, SAGE family, XAGE family, NY-ESO-1 /LAGE-1 , PRAME, SSX-2, Melan-A/MART-1 ,
  • gp100/pmel17 tyrosinase
  • TRP-1 /-2 MC1 R
  • BRCA1 /2 CDK4
  • MART-2 MART-2
  • p53 Ras
  • MUC1 TGF- RII
  • IL- 15 IL13Ra2
  • CSF1 R CSF1 R
  • Each CAR as described herein includes a transmembrane domain that joins the extracellular target-binding domain to the intracellular signaling domain.
  • transmembrane domain refers to the generally hydrophobic region of the CAR which crosses the plasma membrane of a cell.
  • the TM domain can be the transmembrane region or fragment thereof of a transmembrane protein (for example a Type I transmembrane protein or other transmembrane protein), an artificial hydrophobic sequence, or a combination thereof. While specific examples are provided herein and used in the Examples, other transmembrane domains will be apparent to those of skill in the art and can be used in connection with alternate embodiments of the technology. A selected transmembrane region or fragment thereof would preferably not interfere with the intended function of the CAR.
  • fragment thereof refers to a portion of a transmembrane domain that is sufficient to anchor or attach a protein to a cell surface.
  • the transmembrane domain of a CAR or fragment thereof is derived from or comprises the transmembrane domain of CD8 (e.g., any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, or 66, or variants thereof).
  • the transmembrane domain or fragment thereof of the CAR described herein comprises a transmembrane domain selected from the
  • transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CDI la, CD18), ICOS (CD278), 4-1 BB (CD137), 4-1 BBL, GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRFI), CD160, CD1 9, IL2R beta, IL2R gamma, IL7R a, ITGA1 , VLA1 , CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDI Id, ITGAE, CD103, ITGAL, CDI la, LFA-1 , ITGAM, CD
  • CD8 is an antigen preferentially found on the cell surface of cytotoxic T lymphocytes. CD8 mediates cell-cell interactions within the immune system, and acts as a T cell co-receptor. CD8 consists of an alpha (CD8a) and beta (CD8 ) chain. CD8a sequences are known for a number of species, e.g., human CD8a, (NCBI Gene ID: 925) polypeptide (e.g., NCBI Ref Seq NP_001 139345.1 ) and mRNA (e.g., NCBI Ref Seq NM_ 000002.12). CD8 can refer to human CD8, including naturally occurring variants, molecules, and alleles thereof.
  • CD8 can refer to the CD8 of, e.g., dog, cat, cow, horse, pig, and the like.
  • Homologs and/or orthologs of human CD8 are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference CD8 sequence.
  • 4-1 BBL is a type 2 transmembrane glycoprotein belonging to the TNF superfamily. 4-1 BBL is expressed on activated T lymphocytes. 4-1 BBL sequences are known for a number of species, e.g., human 4-1 BBL, also known as TNFSF9 (NCBI Gene ID: 8744) polypeptide (e.g., NCBI Ref Seq
  • 4-1 BBL can refer to human 4-1 BBL, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, 4-1 BBL can refer to the 4-1 BBL of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human 4-1 BBL are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference 4-1 BBL sequence. [00124] Co-stimulatory Domain
  • Each CAR described herein optionally comprises the intracellular domain of one or more co- stimulatory molecule or co-stimulatory domain.
  • co-stimulatory domain refers to an intracellular signaling domain of a co-stimulatory molecule.
  • Co-stimulatory molecules are cell surface molecules other than antigen receptors or Fc receptors that provide a second signal required for efficient activation and function of T lymphocytes upon binding to antigen.
  • a 4-1 BB intracellular domain ICD
  • SEQ ID NOs: 5 1 1 , 17, 23, 29, 38, 47, 59, 67, or variants thereof see, e.g., below and SEQ ID NOs: 5, 1 1 , 17, 23, 29, 38, 47, 59, 67, or variants thereof).
  • co-stimulatory molecules include CARD1 1 , CD2, CD7, CD27, CD28, CD30, CD40, CD54 (ICAM), CD83, CD134 (OX40), CD137 (4-1 BB), CD150 (SLAMF1 ), CD152 (CTLA4), CD223 (LAG3), CD270 (HVEM), CD273 (PD-L2), CD274 (PD-L1 ), CD278 (ICOS), DAP10, LAT, NKD2C SLP76, TRIM, and ZAP70.
  • the intracellular domain is the intracellular domain of 4-1 BB.
  • 4-1 BB (CD137; TNFRS9) is an activation-induced costimulatory molecule, and is an important regulator of immune responses.
  • CARs as described herein comprise an intracellular signaling domain.
  • An "intracellular signaling domain,” refers to the part of a CAR polypeptide that participates in transducing the message of effective CAR binding to a target antigen into the interior of the immune effector cell to elicit effector cell function, e.g., activation, cytokine production, proliferation and cytotoxic activity, including the release of cytotoxic factors to the CAR-bound target cell, or other cellular responses elicited following antigen binding to the extracellular CAR domain.
  • the intracellular signaling domain is from ⁇ 3 ⁇ (see, e.g., below and SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, 68, or variants thereof).
  • ITAM-containing intracellular signaling domains that are of particular use in the technology include those derived from ⁇ , FcRy, FcRp, CD3y, CD39, CD35, CD3e, ⁇ 3 ⁇ , CD22, CD79a, CD79b, and CD66d.
  • CD3 is a T cell co-receptor that facilitates T lymphocyte activation when simultaneously engaged with the appropriate co-stimulation (e.g., binding of a co-stimulatory molecule).
  • a CD3 complex consists of 4 distinct chains; mammal CD3 consists of a CD3y chain, a CD35 chain, and two CD3e chains. These chains associate with a molecule known as the T cell receptor (TCR) and the CD3 ⁇ to generate an activation signal in T lymphocytes.
  • TCR T cell receptor
  • a complete TCR complex comprises a TCR, ⁇ 3 ⁇ , and the complete CD3 complex.
  • a CAR polypeptide described herein comprises an intracellular signaling domain that comprises an Immunoreceptor Tyrosine-based Activation Motif or ITAM from CD3 zeta ( ⁇ 3 ⁇ ).
  • the ITAM comprises three motifs of ITAM of ⁇ 3 ⁇ (ITAM3).
  • the three motifs of ITAM of ⁇ 3 ⁇ are not mutated and, therefore, include native or wild-type sequences.
  • the CD3 ⁇ sequence comprises the sequence of a CD3 ⁇ as set forth in the sequences provided herein.
  • CAR and other construct components as described herein can be used with one another and swapped in and out of various constructs described herein, as can be determined by those of skill in the art. Each of these components can comprise or consist of any of the corresponding sequences set forth herein, or variants thereof.
  • a more detailed description of CARs and CAR T cells can be found in Maus et al., Blood 123:2624-2635, 2014; Reardon et al., Neuro-Oncology 16:1441 -1458, 2014; Hoyos et al., Haematologica 97:1 622, 2012; Byrd et al., J. Clin. Oncol.
  • the CAR further comprises a linker domain.
  • linker domain refers to an oligo- or polypeptide region from about 2 to 100 amino acids in length, which links together any of the domains/regions of the CAR as described herein.
  • linkers can include or be composed of flexible residues such as glycine and serine so that the adjacent protein domains are free to move relative to one another. Longer linkers may be used when it is desirable to ensure that two adjacent domains do not sterically interfere with one another.
  • Linkers may be cleavable or non-cleavable. Examples of cleavable linkers include 2A linkers (for example T2A), 2A-like linkers or functional equivalents thereof and combinations thereof.
  • linkers having sequences as set forth herein, or variants thereof are used. It is to be understood that the indication of a particular linker in a construct in a particular location does not mean that only that linker can be used there. Rather, different linker sequences (e.g., P2A and T2A) can be swapped with one another (e.g., in the context of the constructs of the present invention), as can be determined by those of skill in the art.
  • the linker region is T2A derived from Thosea asigna virus.
  • Non-limiting examples of linkers that can be used in this technology include T2A, P2A, E2A, BmCPV2A, and BmlFV2A.
  • Linkers such as these can be used in the context of polyproteins, such as those described below. For example, they can be used to separate a CAR component of a polyprotein from a therapeutic agent (e.g., an antibody, such as a scFv, single domain antibody (e.g., a camelid antibody), or a bispecific antibody (e.g., a BiTE)) component of a polyprotein (see below).
  • a therapeutic agent e.g., an antibody, such as a scFv, single domain antibody (e.g., a camelid antibody), or a bispecific antibody (e.g., a BiTE) component of a polyprotein (see below).
  • a CAR as described herein optionally further comprises a reporter molecule, e.g., to permit for non-invasive imaging (e.g., positron-emission tomography PET scan).
  • a reporter molecule e.g., to permit for non-invasive imaging (e.g., positron-emission tomography PET scan).
  • the first extracellular binding domain and the second extracellular binding domain can include different or the same reporter molecule.
  • the first CAR and the second CAR can express different or the same reporter molecule.
  • a CAR as described herein further comprises a reporter molecule (for example hygromycin phosphotransferase (hph)) that can be imaged alone or in combination with a substrate or chemical (for example 9-[4-[ 18 F]fluoro-3-(hydroxymethyl)butyl]guanine ([ 18 F]FHBG)).
  • a CAR as described herein further comprises nanoparticles at can be readily imaged using non-invasive techniques (e.g., gold nanoparticles (GNP) functionalized with 64 Cu 2+ ). Labeling of CAR T cells for non-invasive imaging is reviewed, for example in Bhatnagar et al., Integr. Biol. (Camb). 5(1 ):231 -238, 2013, and Keu et al., Sci. Transl. Med. 18; 9(373), 201 7, which are incorporated herein by reference in their entireties.
  • GNP gold nanoparticles
  • GFP and mCherry are demonstrated herein as fluorescent tags useful for imaging a CAR expressed on a T cell (e.g., a CAR T cell). It is expected that essentially any fluorescent protein known in the art can be used as a fluorescent tag for this purpose. For clinical applications, the CAR need not include a fluorescent tag or fluorescent protein. In each instance of particular constructs provided herein, therefore, any markers present in the constructs can be removed.
  • the invention includes the constructs with or without the markers. Accordingly, when a specific construct is referenced herein, it can be considered with or without any markers or tags (including, e.g., histidine tags) as being included within the invention.
  • the CAR polypeptide sequence corresponds to, comprises, or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity of a sequence selected from SEQ ID NOs: 1 , 7, or 13, or the combination of SEQ ID NOs: 21 -24, 27-30, 36-39, 45-48, 57-60, or 65-68.
  • various functionally similar or equivalent components of these CARs can be swapped or substituted with one another, as well as other similar or functionally equivalent components known in the art or listed herein.
  • the CAR T cells of the invention can optionally be used to deliver antibody reagents (or other therapeutic molecules, e.g., cytokines) to tumors, such as to the tumor
  • the antibody reagents are encoded by the same nucleic acid molecule as the CAR, thus facilitating transduction of cells (e.g., T cells) to express both a CAR and an antibody reagent.
  • the antibody reagent can be expressed, e.g., such that it is separated from the CAR (and optionally other proteins, e.g., markers) by cleavable linker sequences (e.g., a 2A linker, such as, e.g., P2A or T2A; see above).
  • the antibody reagent can be expressed under the control of the same promoter as the CAR (e.g., by an EF1 a promoter), and can be constitutively expressed.
  • the antibody reagent is expressed under the control of an inducible promoter, e.g., a promoter that is expressed upon T cell activation (e.g., an NFAT promoter).
  • an inducible promoter can be used, e.g., to ensure that the antibody is expressed only upon T cell activation, and thus only, e.g., when the CAR T cell is within the tumor microenvironment, to which locale it may be advantageous to have antibody production limited.
  • the CAR coding sequences can be 5' or 3' to the antibody reagent coding sequences in various vector designs within the invention.
  • the antibodies expressed within a CAR T cell are single chain antibodies or single domain antibodies as described herein (scFV or camelids).
  • the chains may be in the order L-H or H-L, and optionally may be separated from one another by a linker (e.g., a glycine-based linker).
  • the antibodies are bi-specific antibodies including, e.g., bispecific T cell engagers (BiTEs).
  • BiTEs bispecific T cell engagers
  • Such molecules can target T cells (e.g., by binding CD3) as well as a tumor antigen (e.g., EGFR, EGFRvlll, or CD19; also see above), and can be used to augment the T cell response in, e.g., the tumor microenvironment.
  • a linker e.g., a glycine-based linker.
  • Antibody reagents can be targeted against, e.g., tumor antigens or Treg antigens, such as those described herein, or other antigens (e.g., EGFR, EGFRvlll, CD19, CTLA4, CD25, GARP, LAP, IL- 15, IL13Ra2, CSF1 R etc.)
  • tumor antigens or Treg antigens such as those described herein, or other antigens (e.g., EGFR, EGFRvlll, CD19, CTLA4, CD25, GARP, LAP, IL- 15, IL13Ra2, CSF1 R etc.)
  • the CAR T cells of the invention can be used to delivery other therapeutic molecules including, e.g., cytokines and toxins.
  • CARs and related constructs or variants thereof, as described herein, such as IgK (e.g., SEQ ID NO: 32, 41 , 50, 54, 62, or variants thereof), CD8 leader (e.g., SEQ ID NO: 2, 14, 20, or variants thereof), and related sequences, can be selected for use in making constructs of the invention, as will be apparent to those of skill in the art.
  • IgK e.g., SEQ ID NO: 32, 41 , 50, 54, 62, or variants thereof
  • CD8 leader e.g., SEQ ID NO: 2, 14, 20, or variants thereof
  • related sequences can be selected for use in making constructs of the invention, as will be apparent to those of skill in the art.
  • One aspect of the technology described herein relates to a mammalian cell comprising any of the CAR polypeptides described herein (optionally together with another therapeutic molecule, e.g., an antibody reagent (e.g., a scFv, a camelid antibody, or a BiTE) or a cytokine); or a nucleic acid encoding any of the CAR polypeptides described herein (optionally together with another therapeutic molecule, e.g., an antibody reagent (e.g., a scFv, a camelid antibody, or a cytokine).
  • another therapeutic molecule e.g., an antibody reagent (e.g., a scFv, a camelid antibody, or a cytokine).
  • the mammalian cell comprises an antibody, antibody reagent, antigen-binding portion thereof, any of the CARs described herein, or a cytokine, or a nucleic acid encoding such an antibody, antibody reagent, antigen-binding portion thereof, any of the CARs described herein, or a cytokine.
  • the mammalian cell or tissue can be of human, primate, hamster, rabbit, rodent, cow, pig, sheep, horse, goat, dog or cat origin, but any other mammalian cell may be used. In a preferred embodiment of any aspect, the mammalian cell is human.
  • the cell is a T cell.
  • the cell is an immune cell.
  • immune cell refers to a cell that plays a role in the immune response. Immune cells are of hematopoietic origin, and include lymphocytes, such as B cells and T cells; natural killer cells; myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes.
  • the cell is a T cell; a NK cell; a NKT cell; lymphocytes, such as B cells and T cells; and myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes.
  • lymphocytes such as B cells and T cells
  • myeloid cells such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes.
  • the cell is obtained from an individual having or diagnosed as having cancer, a plasma cell disorder, or autoimmune disease.
  • Cancer can refer to a hyperproliferation of cells whose unique trait, loss of normal cellular control, results in unregulated growth, lack of differentiation, local tissue invasion, and metastasis, and can be glioblastoma, glioma, leukemia, lymphoma, multiple myeloma, or a solid tumor.
  • leukemia include acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), and chronic lymphocytic leukemia (CLL).
  • AML acute myeloid leukemia
  • CML chronic myeloid leukemia
  • ALL acute lymphocytic leukemia
  • CLL chronic lymphocytic leukemia
  • the cancer is ALL or CLL.
  • Non-limiting examples of lymphoma include diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), mantle cell lymphoma (MCL), marginal zone lymphomas, Burkitt lymphoma, hairy cell leukemia (HCL), and T cell lymphoma (e.g., peripheral T cell lymphoma (PTCL), including cutaneous T cell lymphoma (CTCL) and anaplastic large cell lymphoma (ALCL)).
  • the cancer is DLBCL or follicular lymphoma.
  • Non-limiting examples of solid tumors include adrenocortical tumor, alveolar soft part sarcoma, carcinoma, chondrosarcoma, colorectal carcinoma, desmoid tumors, desmoplastic small round cell tumor, endocrine tumors, endodermal sinus tumor, epithelioid hemangioendothelioma, Ewing sarcoma, germ cell tumors (solid tumor), giant cell tumor of bone and soft tissue, hepatoblastoma, hepatocellular carcinoma, melanoma, nephroma, neuroblastoma, non-rhabdomyosarcoma soft tissue sarcoma (NRSTS), osteosarcoma, paraspinal sarcoma, renal cell carcinoma, retinoblastoma, rhabdomyosarcoma, synovial sarcoma, and Wilms tumor.
  • solid tumor include adrenocortical tumor, alveolar soft part sarcom
  • Solid tumors can be found in bones, muscles, or organs, and can be sarcomas or carcinomas. It is contemplated that any aspect of the technology described herein can be used to treat all types of cancers, including cancers not listed in the instant application.
  • tumor refers to an abnormal growth of cells or tissues, e.g., of malignant type or benign type.
  • an "autoimmune disease or disorder” is characterized by the inability of one's immune system to distinguish between a foreign cell and a healthy cell. This results in one's immune system targeting one's healthy cells for programmed cell death.
  • Non-limiting examples of an autoimmune disease or disorder include inflammatory arthritis, type 1 diabetes mellitus, multiples sclerosis, psoriasis, inflammatory bowel diseases, SLE, and vasculitis, allergic inflammation, such as allergic asthma, atopic dermatitis, and contact hypersensitivity.
  • auto-immune-related disease or disorder examples include rheumatoid arthritis, multiple sclerosis (MS), systemic lupus erythematosus, Graves' disease (overactive thyroid), Hashimoto's thyroiditis (underactive thyroid), celiac disease, Crohn's disease and ulcerative colitis, Guillain-Barre syndrome, primary biliary sclerosis/cirrhosis, sclerosing cholangitis, autoimmune hepatitis, Raynaud's phenomenon, scleroderma, Sjogren's syndrome, Goodpasture's syndrome, Wegener's granulomatosis, polymyalgia rheumatica, temporal arteritis/giant cell arteritis, chronic fatigue syndrome CFS), psoriasis, autoimmune Addison's Disease, ankylosing spondylitis, acute disseminated encephalomyelitis
  • the mammalian cell is obtained for a patient having an immune system disorder that results in abnormally low activity of the immune system, or immune deficiency disorders, which hinders one's ability to fight a foreign agent (e.g., a virus or bacterial cell).
  • a foreign agent e.g., a virus or bacterial cell
  • a plasma cell is a white blood cell produces from B lymphocytes which function to generate and release antibodies needed to fight infections.
  • a "plasma cell disorder or disease” is characterized by abnormal multiplication of a plasma cell. Abnormal plasma cells are capable of "crowding out” healthy plasma cells, which results in a decreased capacity to fight a foreign object, such as a virus or bacterial cell.
  • Non-limiting examples of plasma cell disorders include amyloidosis,
  • T cells can be obtained from a subject using standard techniques known in the field.
  • T cells can be isolated from peripheral blood taken from a donor or patient.
  • T cells can be isolated from a mammal.
  • T cells are isolated from a human.
  • a cell for example a T cell, can be engineered to comprise any of the CAR polypeptides described herein (including CAR polypeptides that are cleavably linked to antibody reagents or cytokines, as described herein); or a nucleic acid encoding any of the CAR polypeptides (and optionally also a genetically encoded antibody reagent or cytokine) described herein.
  • the any of the CAR polypeptides (optionally together with an antibody reagent as described herein or a cytokine) described herein are expressed from a lentiviral vector.
  • Retroviruses such as lentiviruses, provide a convenient platform for delivery of nucleic acid sequences encoding a gene or chimeric gene of interest.
  • a selected nucleic acid sequence can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
  • the recombinant virus can then be isolated and delivered to cells, e.g. , in vitro or ex vivo.
  • Retroviral systems are well known in the art and are described in, for example, U.S. Patent No. 5,21 9,740; Kurth and
  • the CAR polypeptide (and optionally the antibody reagent or cytokine) of any of the CARS described herein are expressed in the mammalian cell via transfection or electroporation of an expression vector comprising nucleic acid encoding the CAR. Transfection or electroporation methods are known in the art.
  • Efficient expression of the CAR polypeptide (and optionally the antibody reagent or cytokine) of any of the polypeptides described herein can be assessed using standard assays that detect the m RNA, DNA, or gene product of the nucleic acid encoding the CAR (and optional antibody reagent or cytokine). For example, RT-PCR, FACS, northern blotting, western blotting, ELISA, or
  • the CAR polypeptide (and optional antibody reagent or cytokine) described herein is constitutively expressed. In one embodiment, the CAR polypeptide is constitutively expressed and the optional antibody reagent or cytokine is inducible expressed. In one embodiment, the CAR polypeptide (and optional antibody reagent or cytokine) described herein is encoded by recombinant nucleic acid sequence.
  • One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising : engineering a T cell to comprise any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein on the T cell surface; and administering the engineered T cell to the subject.
  • the method can be for treating diagnosed cancer, preventing recurrence of cancer, or for use in an adjuvant or neoadjuvant setting.
  • One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising : administering the cell of any of the mammalian cells comprising the any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein.
  • CD Cluster differentiation
  • a leukocyte As a leukocyte differentiates and matures its CD profile changes.
  • a cancer cell i.e. , a lymphoma
  • its CD profile is important in diagnosing the disease.
  • the treatment and prognosis of certain types of cancers is reliant on determining the CD profile of the cancer cell.
  • One skilled in the art will be capable of assessing the CD molecules present on a cancer cell using standard techniques, for example, using immunofluorescence to detect commercially available antibodies bound to the CD molecules.
  • the engineered CAR-T cell is stimulated and/or activated prior to administration to the subject.
  • the methods described herein relate to treating a subject having or diagnosed as having cancer, a plasma cell disease or disorder, or an autoimmune disease or disorder with a mammalian cell comprising any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein, or a nucleic acid encoding any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein.
  • a "CAR T cells as described herein” refers to a mammalian cell comprising any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein, or a nucleic acid encoding any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein.
  • a "condition” refers to a cancer, a plasma cell disease or disorder, or an autoimmune disease or disorder. Subjects having a condition can be identified by a physician using current methods of diagnosing the condition. Symptoms and/or complications of the condition, which characterize these conditions and aid in diagnosis are well known in the art and include but are not limited to, fatigue, persistent infections, and persistent bleeding.
  • Tests that may aid in a diagnosis of, e.g., the condition, but are not limited to, blood screening and bone marrow testing, and are known in the art for a given condition.
  • a family history for a condition, or exposure to risk factors for a condition can also aid in determining if a subject is likely to have the condition or in making a diagnosis of the condition.
  • compositions described herein can be administered to a subject having or diagnosed as having a condition.
  • the methods described herein comprise administering an effective amount of activated CAR T cells described herein to a subject in order to alleviate a symptom of the condition.
  • "alleviating a symptom of the condition” is ameliorating any condition or symptom associated with the condition. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique.
  • a variety of means for administering the compositions described herein to subjects are known to those of skill in the art.
  • the compositions described herein are administered systemically or locally.
  • the compositions described herein are administered intravenously.
  • the compositions described herein are administered at the site of a tumor.
  • the term "effective amount” as used herein refers to the amount of activated CAR T cells needed to alleviate at least one or more symptom of the disease or disorder, and relates to a sufficient amount of the cell preparation or composition to provide the desired effect.
  • the term “therapeutically effective amount” therefore refers to an amount of activated CAR T cells that is sufficient to provide a particular anti-condition effect when administered to a typical subject.
  • An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example but not limited to, slowing the progression of a condition), or reverse a symptom of the condition.
  • Effective amounts, toxicity, and therapeutic efficacy can be evaluated by standard pharmaceutical procedures in cell cultures or experimental animals.
  • the dosage can vary depending upon the dosage form employed and the route of administration utilized.
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50.
  • compositions and methods that exhibit large therapeutic indices are preferred.
  • a therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of activated CAR T cells, which achieves a half-maximal inhibition of symptoms) as determined in cell culture, or in an appropriate animal model.
  • Levels in plasma can be measured, for example, by high performance liquid chromatography.
  • the effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for bone marrow testing, among others. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
  • the technology described herein relates to a pharmaceutical composition comprising activated CAR T cells as described herein, and optionally a pharmaceutically acceptable carrier.
  • the active ingredients of the pharmaceutical composition at a minimum comprise activated CAR T cells as described herein.
  • the active ingredients of the pharmaceutical composition consist essentially of activated CAR T cells as described herein.
  • the active ingredients of the pharmaceutical composition consist of activated CAR T cells as described herein.
  • Pharmaceutically acceptable carriers for cell-based therapeutic formulation include saline and aqueous buffer solutions, Ringer's solution, and serum component, such as serum albumin, HDL and LDL.
  • serum component such as serum albumin, HDL and LDL.
  • the pharmaceutical composition comprising activated CAR T cells as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, the components apart from the CAR T cells themselves are preferably sterile or capable of being sterilized prior to administration to a patient.
  • parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. Any of these can be added to the activated CAR T cells preparation prior to administration.
  • Suitable vehicles that can be used to provide parenteral dosage forms of activated CAR T cells as disclosed within are well known to those skilled in the art. Examples include, without limitation: saline solution; glucose solution; aqueous vehicles including but not limited to, sodium chloride injection, Ringer's injection, dextrose injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
  • Unit dosage form refers to a dosage for suitable one
  • a unit dosage form can be an amount of therapeutic disposed in a delivery device, e.g., a syringe or intravenous drip bag.
  • a unit dosage form is administered in a single administration. In another, embodiment more than one unit dosage form can be administered simultaneously.
  • the activated CAR T cells described herein are administered as a monotherapy, i.e., another treatment for the condition is not concurrently administered to the subject.
  • a pharmaceutical composition comprising the T cells described herein can generally be administered at a dosage of 10 4 to 1 0 9 cells/kg body weight, in some instances 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. If necessary, T cell compositions can also be administered multiple times at these dosages.
  • the cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. Med. 319:1676, 1 988).
  • T cells can be activated from blood draws of from I0 cc to 400 cc.
  • T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or I00 cc.
  • Modes of administration can include, for example intravenous (i.v.) injection or infusion.
  • the compositions described herein can be administered to a patient transarterially, intratumorally, intranodally, or intramedullary.
  • the compositions of T cells may be injected directly into a tumor, lymph node, or site of infection.
  • the compositions described herein are administered into a body cavity or body fluid (e.g., ascites, pleural fluid, peritoneal fluid, or cerebrospinal fluid).
  • subjects may undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells.
  • T cell isolates can be expanded by contact with an artificial APC, e.g., an aAPC expressing anti- CD28 and anti-CD3 CDRs, and treated such that one or more CAR constructs of the technology may be introduced, thereby creating a CAR T cell.
  • Subjects in need thereof can subsequently undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. Following or concurrent with the transplant, subjects can receive an infusion of the expanded CAR T cells.
  • expanded cells are administered before or following surgery.
  • lymphodepletion is performed on a subject prior to administering one or more CAR T cell as described herein.
  • the lymphodepletion can comprise administering one or more of melphalan, Cytoxan, cyclophosphamide, and fludarabine.
  • the dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment.
  • the scaling of dosages for human administration can be performed according to art-accepted practices.
  • a single treatment regimen is required.
  • administration of one or more subsequent doses or treatment regimens can be performed. For example, after treatment biweekly for three months, treatment can be repeated once per month, for six months or a year or longer. In some embodiments, no additional treatments are administered following the initial treatment.
  • the dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to administer further cells, discontinue treatment, resume treatment, or make other alterations to the treatment regimen.
  • the dosage should not be so large as to cause adverse side effects, such as cytokine release syndrome.
  • the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art.
  • the dosage can also be adjusted by the individual physician in the event of any complication.
  • the activated CAR T cells described herein can optionally be used in combination with each other and with other known agents and therapies, as can determined to be appropriate by those of skill in the art.
  • two or more CAR T cells targeting different Treg markers e.g., GARP, LAP, etc.
  • two or more CAR T cells targeting different cancer antigens are administered in combination.
  • one or more CAR T cell targeting a Treg marker e.g., GARP, LAP, etc.
  • one or more CAR T cell targeting one or more tumor antigens are administered in combination.
  • Administered "in combination,” as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons.
  • the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous" or “concurrent delivery.”
  • the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration.
  • the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment.
  • delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
  • the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
  • the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
  • the activated CAR T cells described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially.
  • the CAR- expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed.
  • the CAR T therapy and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease.
  • the CAR T therapy can be administered before another treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
  • the activated CAR T cells and the additional agent can be administered in an amount or dose that is higher, lower or the same as the amount or dosage of each agent used individually, e.g., as a monotherapy.
  • the administered amount or dosage of the activated CAR T cells, the additional agent (e.g., second or third agent), or all is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually.
  • the amount or dosage of the activated CAR T cells, the additional agent (e.g., second or third agent), or all, that results in a desired effect is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50% lower) than the amount or dosage of each agent individually required to achieve the same therapeutic effect.
  • the activated CAR T cells described herein can be used in a treatment regimen in combination with surgery, chemotherapy, radiation, an mTOR pathway inhibitor,
  • immunosuppressive agents such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, or a peptide vaccine, such as that described in Izumoto et al., J. Neurosurg. 1 08:963- 971 , 2008.
  • the activated CAR T cells described herein can be used in combination with a checkpoint inhibitor.
  • exemplary checkpoint inhibitors include anti-PD-1 inhibitors (Nivolumab, MK- 3475, Pembrolizumab, Pidilizumab, AMP-224, AMP-514), anti-CTLA4 inhibitors (Ipilimumab and
  • Tremelimumab anti-PDL1 inhibitors
  • anti-PDL1 inhibitors Atezolizumab, Avelomab, MSB0010718C, MEDI4736, and
  • the activated CAR T cells described herein can be used in combination with a chemotherapeutic agent.
  • chemotherapeutic agents include an anthracycline (e.g., doxorubicin (e.g., liposomal doxorubicin)), a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine), an alkylating agent (e.g., cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide), an immune cell antibody (e.g., alemtuzamab, gemtuzumab, rituximab, tositumomab), an antimetabolite (including, e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors (e.g., fludarabine
  • General chemotherapeutic agents considered for use in combination therapies include anastrozole (Arimidex®), bicalutamide (Casodex®), bleomycin sulfate (Blenoxane®), busulfan (Myleran®), busulfan injection (Busulfex®), capecitabine (Xeloda®), N4-pentoxycarbonyl-5- deoxy-5-fluorocytidine, carboplatin
  • Rubex® etoposide
  • Fludarabine phosphate Fludara®
  • 5- fluorouracil Adrucil®, Efudex®
  • flutamide Eulexin®
  • tezacitibine Gemcitabine (difluorodeoxycitidine), hydroxyurea (Hydrea®), Idarubicin (Idamycin®), ifosfamide (IFEX®), irinotecan (Camptosar®), L-asparaginase (ELSPAR®), leucovorin calcium, melphalan (Alkeran®), 6-mercaptopurine (Purinethol®), methotrexate (Folex®), mitoxantrone (Novantrone®), mylotarg, paclitaxel (Taxol®), phoenix (Yttrium90/MX-DTPA), pentostatin, polifeprosan 20 with carmustine implant (
  • alkylating agents include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard®, Chlorethaminacil®, Demethyldopan®,
  • Alkeran® Chlorambucil (Leukeran®), pipobroman (Amedel®, Vercyte®), triethylenemelamine (Hemel®, Hexalen®, Hexastat®), triethylenethiophosphoramine, Temozolomide (Temodar®), thiotepa (Thioplex®), busulfan (Busilvex®, Myleran®), carmustine (BiCNU®), lomustine (CeeNU®), streptozocin (Zanosar®), and dacarbazine (DTIC-Dome®).
  • Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin®); Temozolomide (Temodar® and Temodal®); Dactinomycin (also known as actinomycin-D, Cosmegen®); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran®); Altretamine (also known as hexamethylmelamine (HMM), Hexalen®); Carmustine (BiCNU®); Bendamustine (Treanda®); Busulfan (Busulfex® and Myleran®); Carboplatin (Paraplatin®); Lomustine (also known as CCNU, CeeNU®); Cisplatin (also known as CDDP, Platinol® and Platinol®- AQ); Chlorambucil (Leukeran®); Cyclophosphamide (Cytoxan® and Neosar®); dacarbazine (also
  • HMM hexamethylmelamine
  • Hexalen® Ifosfamide
  • Prednumustine Prednumustine
  • Procarbazine Muspane®
  • Mechlorethamine also known as nitrogen mustard, mustine and mechloroethamine hydrochloride
  • mTOR inhibitors include, e.g., temsirolimus; ridaforolimus (formally known as deferolimus, (IR,2R,45)-4-[(2R)-2
  • WO 03/064383 everolimus (Afinitor® or RADOOI); rapamycin (AY22989, Sirolimus®); simapimod (CAS 164301 -51 -3); emsirolimus, (5- ⁇ 2,4- Bis[(35,)-3-methylmorpholin-4-yl]pyrido[2,3-(i]pyrimidin-7-yl ⁇ -2- methoxyphenyl)methanol (AZD8055); 2- Amino-8-[iraw5,-4-(2-hydroxyethoxy)cyclohexyl]-6- (6-methoxy-3-pyridinyl)-4-methyl-pyrido[2,3- JJpyrimidin-7(8H)-one (PF04691 502, CAS 1013101 -36-4); and N2-[l,4-dioxo-4-[[4-(4-oxo-8-phenyl-4H-l- benzopyran-2- yl)morpholinium-4-yl]me
  • IRX-2 mixture of human cytokines including interleukin 1 , interleukin 2, and interferon ⁇ , CAS 951209-71 -5, available from IRX Therapeutics.
  • anthracyclines include, e.g., doxorubicin (Adriamycin® and Rubex®) ; bleomycin (lenoxane®); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine®); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome®); mitoxantrone (DHAD, Novantrone®); epirubicin
  • vinca alkaloids include, e.g., vinorelbine tartrate (Navelbine®), Vincristine (Oncovin®), and Vindesine (Eldisine®)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ® and Velban®); and vinorelbine
  • proteosome inhibitors include bortezomib (Velcade®); carfilzomib (PX- 171 - 007, (5)-4-Methyl-N-((5)-l-(((5)-4-methyl-l-((R)-2-methyloxiran-2-yl)-l-oxopentan-2- yl)amino)-l-oxo-3- phenylpropan-2-yl)-2-((5,)-2-(2-morpholinoacetamido)-4- phenylbutanamido)-pentanamide); marizomib (NPT0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); and 0-Methyl-N-[(2-methyl-5- thiazolyl)carbonyl]-L-seryl-0- methyl-N-[(IIS')-2-[(2R)-2-methyl
  • chemotherapeutic agent of use e.g., see
  • activated CAR T cells described herein are administered to a subject in combination with a molecule that decreases the level and/or activity of a molecule targeting GITR and/or modulating GITR functions, a molecule that decreases the Treg cell population, an mTOR inhibitor, a GITR agonist, a kinase inhibitor, a non-receptor tyrosine kinase inhibitor, a CDK4 inhibitor, and/or a BTK inhibitor.
  • the efficacy of activated CAR T cells in, e.g., the treatment of a condition described herein, or to induce a response as described herein (e.g., a reduction in cancer cells) can be determined by the skilled clinician.
  • a treatment is considered "effective treatment," as the term is used herein, if one or more of the signs or symptoms of a condition described herein is altered in a beneficial manner, other clinically accepted symptoms are improved, or even ameliorated, or a desired response is induced, e.g., by at least 10% following treatment according to the methods described herein.
  • Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate.
  • Treatment according to the methods described herein can reduce levels of a marker or symptom of a condition, e.g. by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80 % or at least 90% or more.
  • Efficacy can also be measured by a failure of an individual to worsen as assessed by hospitalization, or need for medical interventions (i.e., progression of the disease is halted). Methods of measuring these indicators are known to those of skill in the art and/or are described herein.
  • Treatment includes any treatment of a disease in an individual or an animal (some non- limiting examples include a human or an animal) and includes: (1 ) inhibiting the disease, e.g., preventing a worsening of symptoms (e.g., pain or inflammation); or (2) relieving the severity of the disease, e.g., causing regression of symptoms.
  • An effective amount for the treatment of a disease means that amount which, when administered to a subject in need thereof, is sufficient to result in effective treatment as that term is defined herein, for that disease.
  • Efficacy of an agent can be determined by assessing physical indicators of a condition or desired response.
  • CAR T cells having an EGFRvlll antigen-binding moiety represent a promising cellular therapy for specific targeting of cytolytic cells to the tumor
  • EGFRvlll is specifically expressed on tumor tissue while generally absent from healthy tissue.
  • CART-EGFRvlll cells were tested in vitro and in vivo in two animal models.
  • T cells from leukapheresis products obtained from deidentified healthy donors were stimulated with Dynabeads (Human T-Activator CD3/CD28) at a bead to cell ratio of 3:1 and cultured in complete RPMI 1640 medium.
  • Dynabeads Human T-Activator CD3/CD28
  • U87vlll tumor cells were collected in logarithmic growth phase, washed, and administered to mice subcutaneously in a xenograft model of human glioblastoma (Figs. 2A and 2B) or intracranially in a model of human glioma (Figs. 3A and 3B).
  • the needle of a 50 microliter Hamilton syringe was positioned using a stereotactic frame at 2 mm to the right of the bregma and 4 mm below the surface of the skull at the coronal suture.
  • mice were infused once with CAR T cells (1 x 10 6 CAR-transduced T cells per mouse) via tail vein.
  • Tregs regulatory T cells
  • Figs. 4A and 4B The presence of regulatory T cells (Tregs) was observed in human patient tumor tissues after treatment with CART-EGFRvlll cells.
  • Figs. 4A and 4B To determine if brain-infiltrating Tregs have a functional role in suppressing CART-EGFRvlll cells, an in vitro Treg suppression assay was performed in which CART-EGFRvlll cells (red) and glioma cells (green) were incubated in the presence of Tregs for 1 8 hours. Results were obtained by IncyCyte live cell analysis, as shown in Figs. 5A-5C. While non-specific CAR cells permitted proliferation of glioma cells (Figs.
  • CART-EGFRvlll cells killed glioma cells (Figs. 5B and 5D, bottom line).
  • Tregs in the co-culture significantly reduced the ability of CART-EGFRvlll cells to kill target glioma cells (Figs. 5C and 5D, middle line).
  • Example 2 Design and characterization of CAR T cells targeted to Treg-associated antigens
  • Figs. 6A-6C, 7A, and 7B show results of an experiment in which LAP and GARP were identified as Treg-associated markers on human peripheral blood cells.
  • LAP and GARP were identified as Treg-associated markers on human peripheral blood cells.
  • approximately 27% expressed LAP approximately 4% were double positive for LAP and GARP (Fig. 6B).
  • anti-CD3, anti-CD8, and IL-2 approximately 30% expressed LAP, and the number of LAP/GARP double positive Tregs increased to 12.3% (Fig. 6C).
  • CAR constructs encoding CARs targeting LAP and GARP were designed. Schematic illustrations of these constructs are shown in Figs. 8A-8D.
  • Treg-targeting constructs include two LAP- targeting CARs (CAR-LAP-L-H (Fig. 8A) and CAR-LAP-H-L (Fig. 8B); in which each anti-LAP scFv contains a reversal in heavy (H) and light (L) chain arrangement), a GARP-targeting CAR construct (CAR-GARP; Fig. 8C), and an EGFR-targeting CAR construct further encoding an anti-GARP camelid antibody (CAR-EGFR-GARP; Fig. 8D). Transduction efficiencies of each construct were assessed using flow cytometry by measuring the percentage of mCherry-positive cells and are provided below.
  • CAR T cells were co-cultured with isolated Tregs expanded from the same donor and transduced to express GFP as a Treg marker.
  • Tregs were activated overnight with anti-CD3 and anti-CD28 (Fig. 9B) or rested overnight (Fig. 9A) prior to the killing assay. 62,500 Tregs per well were plated. CARs were added at the indicated ratio to Tregs. Cultures were incubated for three days in the presence of 300 U/mL IL-2. Flow cytometry was performed on day 3 by collecting 30,000 events per well. Percent cytotoxicity was calculated as the percent reduction in GFP-positive cells compared to the untransduced T cell culture with Tregs.
  • CART-LAP-H-L was more effective at killing non-activated Tregs in comparison to CART-LAP-L-H.
  • LAP-targeted CAR T cells were then compared to GARP-targeted CART cells in an analogous Treg killing assay across two different donors at a CAR T cell-to-Treg ratio of 1 :1 for four days (Figs. 10A and 10B).
  • Figs. 1 1 A and 1 1 B characterize non-activated and activated Treg killing by LAP-targeted CAR T cells, relative to untransduced controls, by the number of target Tregs remaining at the end of a three-day coculture as a function of CAR T cell-to-Treg cell ratio.
  • Figs. 1 1 C and 1 1 D show analogous data from the same donor, in which cytotoxicity is measured by luciferase expression.
  • SeAx an IL-2 dependent human Sezary syndrome-derived cell
  • GARP and LAP Figs. 14A and 14B, respectively
  • SeAx cells were cocultured with CART-GARP cells, CART-LAP-H-L cells, CART-LAP-L-L cells, and untransduced cells to quantify CAR T cell-mediated killing at 24 hours (Fig. 15A) and 48 hours (Fig. 15B).
  • CART-GARP and CART-LAP-H-L killed target SeAx cells with greater efficiency than CART-LAP-L-H cells by 48 hours.
  • CAR T cell activity within tumor microenvironments e.g., to overcome immune regulation by Tregs
  • a CAR T cell that secretes a immune-modulating antibodies, such as a BiTE.
  • an immune-modulating antibody e.g., a BiTE
  • expression of an immune-modulating antibody from a construct that also encodes a CAR can further amplify antitumor effects.
  • CAR-EGFR-BiTE-(EGFR-CD3) shown schematically in Fig. 1 7, includes a CAR-encoding polynucleotide operatively linked 5' to a BiTE-encoding
  • the CAR features a tumor-antigen binding domain that binds to EGFRvlll, which directs the CAR T cell to the microenvironment of an EGFRvlll-positive tumor.
  • the BiTE binds at one domain to EGFR and at the other domain to CD3, as shown in Fig. 18, which can (a) further enhance binding avidity of the host CAR T cell to the tumor cell or (b) arm neighboring (e.g., endogenous) T cells against the tumor.
  • the BiTE is flanked by cleavable linkers P2A and T2A to enable separate secretion of the BiTE, while the CAR is targeted to the cell surface.
  • Other exemplary BiTE-encoding CAR constructs are depicted in Figs. 26A and 26B.
  • HEK293T cells were transduced with CAR-EGFR-BiTE-(EGFR-CD3), and supernatants containing secreted BiTEs were collected and incubated with K562 cells (Fig. 20A) and Jurkat cells (Fig. 20B).
  • Fig. 20A BiTEs bound K562 cells expressing EGFR and did not bind K562 cells expressing CD19, confirming function of the EGFR-binding domain of the BiTE.
  • Fig. 20A BiTEs bound K562 cells expressing EGFR and did not bind K562 cells expressing CD19, confirming function of the EGFR-binding domain of the BiTE.
  • CD3-expressing Jurkat cells showed stronger staining for BiTE after incubation with supernatant from CAR-EGFR-BiTE-(EGFR-CD3)- expressing HEK293T cells, compared to staining for BiTE after incubation with supernatant from untransduced HEK293T cells, indicating that BiTEs also functionally bind to CD3.
  • FIG. 21 A shows BiTEs bound K562 cells expressing EGFR and did not bind K562 cells expressing CD19, confirming function of the EGFR-binding domain of the BiTE expressed by transduced SupT1 cells.
  • the transduced SupT1 cells were stained for BiTE.
  • ND4 cells were also assessed for ability to secrete functional BiTEs upon transduction with CAR-EG FR-BiTE-(EG FR-CD3).
  • FIG. 22A shows BiTEs secreted by transduced ND4 cells bound K562 cells expressing EGFR and did not bind K562 cells expressing CD1 9.
  • Fig. 22B BiTEs bound to CD3 expressed on the transduced ND4 cells from which they were secreted.
  • a construct containing an NFAT promoter was designed and synthesized.
  • the NFAT promoter precedes a G FP-encoding polynucleotide, and the construct further includes a downstream CAR-encoding polynucleotide driven by EF1 a, a constitutive promoter.
  • G FP expression was assessed by FACS in response to TCR stimulation by PMA/ionomycin.
  • stimulation triggered the expression of G FP. This inducible expression was inhibited by incubation with PEPvl l l.
  • Inducible BiTE constructs encoding CARs are designed by positioning the BiTE downstream of an inducible promoter, such as an NFAT promoter, as shown in Figs. 27A and 27B.
  • Anti-GARP CAR - MGH 97 CD8 Leader - anti-GARP - CD8 hinge + TM - 4-1 BB - CD3z
  • SEQ ID NO: 1 comprising CD8 leader sequence (amino acids 1 -21 of SEQ I D NO: 1 ; SEQ I D NO: 2) ; anti-GARP camelid (amino acids 22-128 of SEQ I D NO: 1 ; SEQ I D NO: 3) ; CD8 hinge/TM domain (amino acids 129-1 97 of SEQ ID NO: 1 ; SEQ I D NO: 4) ; 4-1 BB ICD (amino acids 1 98-239 of SEQ I D NO: 1 ; SEQ ID NO: 1 ; SEQ ID NO: 1 ) comprising CD8 leader sequence (amino acids 1 -21 of SEQ I D NO: 1 ; SEQ I D NO: 2) ; anti-GARP camelid (amino acids 22-128 of SEQ I D NO: 1 ; SEQ I D NO: 3) ; CD8 hinge/TM domain (amino acids 129-1 97 of SEQ ID NO: 1 ; SEQ I D NO: 4) ; 4-1
  • CD8 leader sequence (amino acids 1 -21 of SEQ I D NO:1 ; SEQ ID NO: 2)
  • anti-GARP camelid (amino acids 22-128 of SEQ I D NO:1 ; SEQ ID NO: 3)
  • CD8 hinge/TM domain (amino acids 129-1 97 of SEQ I D NO:1 ; SEQ I D NO: 4) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGT CGVLLLSLVITLYC
  • RVKFSRSADAPAYQQGQNQLYN ELNLGRREEYDVLDKRRGRDPEMGGKPRR KNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDA LHMQALPPR
  • Anti-LAP CAR (H-L) - MGH 99 CD8 Leader - anti-LAP - CD8 hinge + TM - 4-1 BB - CD3z (SEQ ID NO: 7) comprising CD8 leader sequence (amino acids 1 -21 of SEQ I D NO: 7; SEQ ID NO: 8), anti-LAP scFv (H-L) (amino acids 22-307 of SEQ ID NO: 7; SEQ I D NO: 9), CD8 hinge/TM domain (amino acids 308-376 of SEQ ID NO: 7; SEQ I D NO: 1 0), 4-1 BB ICD (amino acids 377-41 8 of SEQ ID NO: 7; SEQ ID NO: 1 1 ), and ⁇ 3 ⁇ (amino acids 41 9-530 of SEQ ID NO: 7; SEQ I D NO: 1 2).
  • CD8 leader sequence (amino acids 1 -21 of SEQ I D NO: 7; SEQ I D NO: 8)
  • Anti-LAP scFv H-L (amino acids 22-307 of SEQ I D NO: 7; SEQ I D NO: 9)
  • CD8 hinge/TM domain amino acids 308-376 of SEQ I D NO: 7; SEQ I D NO: 1 0
  • Anti-LAP CAR (L-H) - MGH 100 CD8 Leader - anti-LAP - CD8 hinge + TM - 4-1 BB - CD3z (SEQ ID NO: 13) comprising CD8 leader (amino acids 1 -21 of SEQ ID NO: 13; SEQ ID NO: 14), anti-LAP scFv (L-H) (amino acids 22-307 of SEQ ID NO: 13; SEQ ID NO: 15), CD8 hinge/TM (amino acids 308-376 of SEQ ID NO: 13; SEQ ID NO: 1 6), 4-1 BB ICD (amino acids 377-418 of SEQ ID NO: 13;
  • SEQ ID NO: 17 SEQ ID NO: 17
  • CD3z amino acids 419-530 of SEQ ID NO: 13; SEQ ID NO: 18.
  • CD8 leader (amino acids 1 -21 of SEQ ID NO: 13; SEQ ID NO: 14)
  • Anti-LAP scFv (amino acids 22-307 of SEQ ID NO: 13; SEQ ID NO: 1 5)
  • CD8 hinge/TM amino acids 308-376 of SEQ ID NO: 13; SEQ ID NO: 16
  • CD3z amino acids 419-530 of SEQ ID NO: 13; SEQ ID NO: 18
  • Anti-EGFR CAR secreting anti-GARP Camelid - MGH 105 CD8 Leader - anti-EGFR - CD8 hinge + TM - 4-1 BB - CD3z - anti-GARP camelid (SEQ ID NO: 19) comprising CD8 leader (amino acids 1 -21 of SEQ ID NO: 19; SEQ ID NO: 20), anti-EGFR scFv (amino acids 22-267 of SEQ ID NO: 19; SEQ ID NO: 21 ), CD8 hinge/TM (amino acids 268-336 of SEQ ID NO: 19; SEQ ID NO: 22), 4- 1 BB (amino acids 337-378 of SEQ ID NO: 19; SEQ ID NO: 23), CD3z (amino acids 379-490 of SEQ ID
  • IgK leader amino acids 519-539 of SEQ ID NO: 19; SEQ ID NO: 32
  • anti-GARP camelid amino acids 540-646 of SEQ ID NO: 19; SEQ ID NO: 25.
  • CD8 leader (amino acids 1 -21 of SEQ ID NO: 19; SEQ ID NO: 20)
  • Anti-EGFR scFv (amino acids 22-267 of SEQ ID NO: 1 9; SEQ ID NO: 21 )
  • CD8 hinge/TM amino acids 268-336 of SEQ ID NO: 19; SEQ ID NO: 22
  • CD3z amino acids 379-490 of SEQ ID NO: 1 9; SEQ ID NO: 24
  • IgK leader (amino acids 519-539 of SEQ ID NO: 19; SEQ ID NO: 32)
  • Anti-GARP camelid (amino acids 540-646 of SEQ ID NO: 19; SEQ ID NO: 25).
  • CD8 hinge/TM amino acids 244-312 of SEQ ID NO: 26; SEQ ID NO: 28
  • CD3z (amino acids 355-466 of SEQ ID NO: 26; SEQ ID NO: 30) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRR KNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDA LHMQALPPR
  • P2A amino acids 467-488 of SEQ ID NO: 26; SEQ ID NO: 31 )
  • IgK leader (amino acids 491 -51 1 of SEQ ID NO: 26; SEQ ID NO: 32)
  • CD3 scFv amino acids 758-1000 of SEQ ID NO: 26; SEQ ID NO: 34
  • Cetuximab scFv - CD3 scFv - His-tag (SEQ ID NO: 35) comprising 21 73 scFv (amino acids 1 -246 of SEQ ID NO: 35; SEQ ID NO: 36), CD8 hinge/TM (amino acids 247-315 of SEQ ID NO: 35; SEQ ID NO: 37), 4-1 BB ICD (amino acids 316-357 of SEQ ID NO: 36; SEQ ID NO: 38), CD3z (amino acids 358-469 of SEQ ID NO: 35; SEQ ID NO: 39), P2A (amino acids 470-491 of SEQ ID NO: 35; SEQ ID NO: 40), IgK leader (amino acids 494-514 of SEQ ID NO: 35; SEQ ID NO: 41 ), Cetuximab scFv (amino acids 51 5-755 of SEQ ID NO: 35; SEQ ID NO: 42), and CD3 scFv (amino acids 7
  • CD8 hinge/TM amino acids 247-315 of SEQ ID NO: 35; SEQ ID NO: 37
  • CD3z amino acids 358-469 of SEQ ID NO: 35; SEQ ID NO: 39
  • P2A amino acids 470-491 of SEQ ID NO: 35; SEQ ID NO: 40
  • IgK leader (amino acids 494-514 of SEQ ID NO: 35; SEQ ID NO: 41 )
  • CD3 scFv amino acids 761 -1003 of SEQ ID NO: 35; SEQ ID NO: 43
  • CD8 hinge/TM amino acids 247-315 of SEQ ID NO: 44; SEQ ID NO: 46
  • CD3z amino acids 358-469 of SEQ ID NO: 44; SEQ ID NO: 48
  • P2A amino acids 470-491 of SEQ ID NO: 44; SEQ ID NO: 49
  • IgK leader (amino acids 494-514 of SEQ ID NO: 44; SEQ ID NO: 50) METDTLLLWVLLLWVPGSTGD
  • CD19 scFv amino acids 515-764 of SEQ ID NO: 44; SEQ ID NO: 51 .
  • CD3 scFv amino acids 770-1012 of SEQ ID NO: 44; SEQ ID NO: 52
  • IgK leader (amino acids 1 -21 of SEQ ID NO: 53; SEQ ID NO: 54)
  • CD3 scFv amino acids 268-510 of SEQ ID NO: 53; SEQ ID NO: 56
  • CD8 hinge/TM amino acids 763-831 of SEQ ID NO: 53; SEQ ID NO: 58
  • CD3z amino acids 874-985 of SEQ ID NO: 53; SEQ ID NO: 60
  • IgK leader (amino acids 1 -21 of SEQ ID NO: 61 ; SEQ ID NO: 62)
  • CD19 scFv amino acids 22-271 of SEQ ID NO: 61 ; SEQ ID NO: 63
  • CD3 scFv amino acids 277-519 of SEQ ID NO: 61 ; SEQ ID NO: 64
  • 2173 scFv (amino acids 526-771 of SEQ ID NO: 61 ; SEQ ID NO: 65) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGRIDP ENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRGGVYWGQ GTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLGERATINC KSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDRFSGSGSGTDF TLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK
  • CD8 hinge/TM amino acids 772-840 of SEQ ID NO: 61 ; SEQ ID NO: 66
  • CD3z amino acids 883-994 of SEQ ID NO: 61 ; SEQ ID NO: 68
  • a chimeric antigen receptor (CAR) T cell comprising a heterologous nucleic acid molecule, wherein the heterologous nucleic acid molecule comprises:
  • bispecific antibody reagent comprises a bispecific T cell engager (BiTE).
  • the CAR T cell of any one of paragraphs 1 to 1 1 wherein the CAR and the therapeutic agent are each constitutively expressed.
  • EF1 a elongation factor-1 alpha
  • transmembrane domain of the CAR comprises a CD8 hinge/transmembrane domain, which optionally comprises the sequence of any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, and 66, or a variant thereof.
  • the intracellular signaling domain comprises a CD3 ⁇ intracellular signaling domain, which optionally comprises the sequence of any one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, and 68, or a variant thereof .
  • the tumor-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds comprises epidermal growth factor receptor variant III (EGFRvlll), EGFR, CD19, prostate-specific membrane antigen (PSMA), or IL-13 receptor alpha 2 (IL-13Ra2), and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 21 , 27, 33, 36, 42, 45, 51 ,
  • the Treg-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds is selected from the group consisting of glycoprotein A repetitions predominant (GARP), latency-associated peptide (LAP), CD25, and cytotoxic T lymphocyte-associated antigen-4 (CTLA-4), and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, and variants thereof.
  • a CAR T cell comprising a polynucleotide encoding a CAR, wherein the CAR comprises an antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and the antigen-binding domain binds to a Treg-associated antigen.
  • Treg-associated antigen is selected from the group consisting of GARP, LAP, CD25, and CTLA-4.
  • a CAR T cell comprising a heterologous nucleic acid molecule encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61 , SEQ ID NO: 19, SEQ ID NO:
  • the CAR T cell of paragraph 31 comprising a heterologous nucleic acid molecule encoding an amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61 , SEQ ID NO: 19, SEQ ID NO: 1 , SEQ ID NO: 7, and SEQ ID NO: 13.
  • a pharmaceutical composition comprising one or more CAR T cells, nucleic acid molecules, CAR polypeptides, or a polyproteins of any one of paragraphs 1 to 34.
  • a method of treating a patient having cancer comprising administering to the patient a pharmaceutical composition comprising one or more CAR T cell of any one of paragraphs 1 - 32 or a pharmaceutical composition of paragraph 35.
  • a method of treating a patient having cancer comprising administering to the patient a CAR T cell product, genetically modified to secrete a tumor-toxic antibody or cytokine, wherein by directing the cancer toxicity locally to the tumor microenvironment, systemic toxicity is reduced.
  • the CAR T cell is genetically modified to deliver an antibody against CTLA4, CD25, GARP, LAP, IL15, CSF1 R, or EGFR, or a bispecific antibody against to the tumor microenvironment.
  • a method of delivering a therapeutic agent to a tissue or organ in a patient to treat a disease or pathology comprising administering to said patient a CAR T cell, genetically modified to secrete a therapeutic antibody, toxin, or agent, wherein the therapeutic antibody, toxin, or agent would, by itself, be unable to enter or penetrate the tissue or organ.
  • therapeutic antibody is anti-EGFR (anti- epidermal growth factor receptor) or anti-EGFRvlll.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Toxicology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Hematology (AREA)
  • Biotechnology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2018/027783 2017-04-14 2018-04-16 Chimeric antigen receptor t cells targeting the tumor microenvironment Ceased WO2018191748A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
CA3059444A CA3059444A1 (en) 2017-04-14 2018-04-16 Chimeric antigen receptor t cells targeting the tumor microenvironment
CN201880025361.8A CN110520524A (zh) 2017-04-14 2018-04-16 靶向肿瘤微环境的嵌合抗原受体t细胞
AU2018251206A AU2018251206A1 (en) 2017-04-14 2018-04-16 Chimeric antigen receptor T cells targeting the tumor microenvironment
JP2019555484A JP7505885B2 (ja) 2017-04-14 2018-04-16 腫瘍微小環境を標的にするキメラ抗原受容体t細胞
US16/603,675 US12378297B2 (en) 2017-04-14 2018-04-16 Chimeric antigen receptor T cells targeting the tumor microenvironment
EP18784599.5A EP3609914B1 (en) 2017-04-14 2018-04-16 Chimeric antigen receptor t cells targeting the tumor microenvironment
US16/969,098 US20210038646A1 (en) 2018-02-12 2019-02-12 Chimeric antigen receptors targeting the tumor microenvironment
CN201980024375.2A CN111971053A (zh) 2018-02-12 2019-02-12 靶向肿瘤微环境的嵌合抗原受体
AU2019218989A AU2019218989B2 (en) 2018-02-12 2019-02-12 Chimeric antigen receptors targeting the tumor microenvironment
JP2020542979A JP2021512635A (ja) 2018-02-12 2019-02-12 腫瘍微小環境を標的とするキメラ抗原受容体
CA3090546A CA3090546A1 (en) 2018-02-12 2019-02-12 Chimeric antigen receptors targeting the tumor microenvironment
EP19751389.8A EP3752170A4 (en) 2018-02-12 2019-02-12 CHIMERA ANTIGEN RECEPTOR T-CELLS TARGETED AGAINST THE TUMOR MICRO ENVIRONMENT
PCT/US2019/017727 WO2019157533A1 (en) 2018-02-12 2019-02-12 Chimeric antigen receptors targeting the tumor microenvironment
US18/477,532 US20240075070A1 (en) 2017-04-14 2023-09-28 Chimeric antigen receptor t cells targeting the tumor microenvironment
AU2023278069A AU2023278069B2 (en) 2017-04-14 2023-12-07 Chimeric antigen receptor T cells targeting the tumor microenvironment
JP2024014208A JP2024062986A (ja) 2017-04-14 2024-02-01 腫瘍微小環境を標的にするキメラ抗原受容体t細胞
JP2024193719A JP2025032089A (ja) 2018-02-12 2024-11-05 腫瘍微小環境を標的とするキメラ抗原受容体
AU2025205213A AU2025205213A1 (en) 2017-04-14 2025-07-08 Chimeric antigen receptor T cells targeting the tumor microenvironment

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762485670P 2017-04-14 2017-04-14
US62/485,670 2017-04-14
US201862629593P 2018-02-12 2018-02-12
US62/629,593 2018-02-12

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US16/603,675 A-371-Of-International US12378297B2 (en) 2017-04-14 2018-04-16 Chimeric antigen receptor T cells targeting the tumor microenvironment
US16/969,098 Continuation US20210038646A1 (en) 2018-02-12 2019-02-12 Chimeric antigen receptors targeting the tumor microenvironment
US18/477,532 Continuation US20240075070A1 (en) 2017-04-14 2023-09-28 Chimeric antigen receptor t cells targeting the tumor microenvironment

Publications (1)

Publication Number Publication Date
WO2018191748A1 true WO2018191748A1 (en) 2018-10-18

Family

ID=63793633

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/027783 Ceased WO2018191748A1 (en) 2017-04-14 2018-04-16 Chimeric antigen receptor t cells targeting the tumor microenvironment

Country Status (7)

Country Link
US (2) US12378297B2 (enExample)
EP (1) EP3609914B1 (enExample)
JP (2) JP7505885B2 (enExample)
CN (1) CN110520524A (enExample)
AU (3) AU2018251206A1 (enExample)
CA (1) CA3059444A1 (enExample)
WO (1) WO2018191748A1 (enExample)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020092455A2 (en) 2018-10-29 2020-05-07 The Broad Institute, Inc. Car t cell transcriptional atlas
EP3747904A1 (en) * 2019-06-03 2020-12-09 Universität Regensburg Cd25-specific chimeric antigen receptors and their uses
US20210046113A1 (en) * 2017-12-28 2021-02-18 Shanghai Cell Therapy Research Institute Dual-activating costimulatory molecule receptor and use thereof
WO2021030149A1 (en) * 2019-08-09 2021-02-18 A2 Biotherapeutics, Inc. Cell-surface receptors responsive to loss of heterozygosity
WO2021098834A1 (zh) * 2019-11-22 2021-05-27 上海一宸医药科技有限公司 Psma抗体及其应用
WO2022109611A1 (en) * 2020-11-20 2022-05-27 Simcere Innovation, Inc. Armed dual car-t compositions and methods for cancer immunotherapy
US20220177524A1 (en) * 2018-07-26 2022-06-09 Nanjing Legend Biotech Co., Ltd. Nef-containing t cells and methods of producing thereof
US11433100B2 (en) 2020-08-20 2022-09-06 A2 Biotherapeutics, Inc. Compositions and methods for treating ceacam positive cancers
US11602543B2 (en) 2020-08-20 2023-03-14 A2 Biotherapeutics, Inc. Compositions and methods for treating mesothelin positive cancers
EP3947689A4 (en) * 2019-03-27 2023-03-29 National Research Council of Canada ANTIGEN BINDING AGENTS SPECIFIC TO BINDING THE RECEPTOR VARIANT III OF THE EPIDERMAL GROWTH FACTOR
WO2023077068A1 (en) * 2021-10-28 2023-05-04 Skunkworx Bio, Inc. Novel binding agents related to glycoprotein-a
JP2023529416A (ja) * 2020-06-09 2023-07-10 ユーシーエル ビジネス リミテッド キメラ抗原受容体細胞
US20230242877A1 (en) * 2020-01-21 2023-08-03 Nanjing Bioheng Biotech Co., Ltd Immune cell comprising chimeric antigen receptor and use thereof
US12005081B2 (en) 2019-04-30 2024-06-11 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof
US12195513B2 (en) 2019-12-11 2025-01-14 A2 Biotherapeutics, Inc. LILRB1-based chimeric antigen receptor
WO2024196794A3 (en) * 2023-03-17 2025-06-05 The Children's Hospital Of Philadelphia Compositions and methods for interneuron mediated delivery of cytotoxic agents to the brain
US12378297B2 (en) 2017-04-14 2025-08-05 The General Hospital Corporation Chimeric antigen receptor T cells targeting the tumor microenvironment
US12473343B2 (en) 2017-01-10 2025-11-18 The General Hospital Corporation Targeted t cells with cytotoxicity toward immunosuppressive cells

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019157533A1 (en) * 2018-02-12 2019-08-15 The General Hospital Corporation Chimeric antigen receptors targeting the tumor microenvironment
WO2020232247A1 (en) 2019-05-14 2020-11-19 Provention Bio, Inc. Methods and compositions for preventing type 1 diabetes
IL298999A (en) 2020-06-11 2023-02-01 Provention Bio Inc Methods and compositions for the prevention of type 1 diabetes
JP2024520444A (ja) 2021-05-24 2024-05-24 プロヴェンション・バイオ・インコーポレイテッド 1型糖尿病を治療するための方法
CN115491358B (zh) * 2021-06-17 2024-09-06 复星凯特生物科技有限公司 一种靶向b7-h3和folr1双打靶点car t的制备及应用
WO2023274386A1 (zh) * 2021-07-01 2023-01-05 宁波茂行生物医药科技有限公司 靶向egfr的通用型car-t细胞及其制备方法
TWI823402B (zh) * 2021-07-21 2023-11-21 長聖國際生技股份有限公司 多特異性單域抗體嵌合抗原受體及t細胞銜接體、核酸、其表達細胞、其用途以及治療癌症之醫藥組合物
WO2024192289A2 (en) * 2023-03-14 2024-09-19 The Wistar Institute Of Anatomy And Biology Tri-specific t-cell engagers and methods of use in cancer therapeutics
CN119708251A (zh) * 2023-09-27 2025-03-28 北京大学 一种利用cd27逆转t和car-t细胞pd1信号的工程化细胞方法
WO2025076471A2 (en) * 2023-10-04 2025-04-10 Ohio State Innovation Foundation Modulating the tumor immune microenvironment via targeting regulatory t cells (tregs) with chimeric antigen receptor (car) t cell therapy
WO2025092689A1 (zh) * 2023-10-30 2025-05-08 苏州沙砾生物科技有限公司 一种表达多特异性抗原结合蛋白的细胞及其应用
WO2025140683A1 (zh) * 2023-12-29 2025-07-03 北京鼎成肽源生物技术有限公司 表达趋化因子10和白介素15的工程化免疫细胞
KR20260016890A (ko) * 2024-07-24 2026-02-04 서울대학교산학협력단 안전하며 효과적인 유전자세포치료 시스템

Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4518584A (en) 1983-04-15 1985-05-21 Cetus Corporation Human recombinant interleukin-2 muteins
US4737462A (en) 1982-10-19 1988-04-12 Cetus Corporation Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β
US5219740A (en) 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
WO2003064383A2 (en) 2002-02-01 2003-08-07 Ariad Gene Therapeutics, Inc. Phosphorus-containing compounds & uses thereof
US20140322183A1 (en) * 2013-03-15 2014-10-30 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
US20140322275A1 (en) * 2013-02-20 2014-10-30 Jennifer Brogdon TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR
US20160200819A1 (en) * 2011-04-08 2016-07-14 The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
US20160272717A1 (en) * 2013-08-01 2016-09-22 Ludwig Institute For Cancer Research Ltd Anti-garp protein and uses thereof
US9567399B1 (en) * 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines
WO2017040324A1 (en) 2015-08-28 2017-03-09 The Trustees Of The University Of Pennsylvania Methods and compositions for cells expressing a chimeric intracellular signaling molecule
WO2017049166A1 (en) * 2015-09-17 2017-03-23 Novartis Ag Car t cell therapies with enhanced efficacy
US20180162939A1 (en) * 2016-06-24 2018-06-14 Icell Gene Therapeutics Llc CHIMERIC ANTIGEN RECEPTORS (CARs), COMPOSITIONS AND METHODS THEREOF

Family Cites Families (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH11507535A (ja) 1995-06-07 1999-07-06 イムクローン システムズ インコーポレイテッド 腫瘍の成長を抑制する抗体および抗体フラグメント類
US7112324B1 (en) 1998-04-21 2006-09-26 Micromet Ag CD 19×CD3 specific polypeptides and uses thereof
US20050136035A1 (en) * 2003-06-03 2005-06-23 Derek Ko Cell specific replication-competent viral vectors comprising a self processing peptide cleavage site
US10155038B2 (en) 2007-02-02 2018-12-18 Yale University Cells prepared by transient transfection and methods of use thereof
EP2331566B1 (en) 2008-08-26 2015-10-07 City of Hope Method and compositions for enhanced anti-tumor effector functioning of t cells
US9349368B1 (en) * 2010-08-05 2016-05-24 Google Inc. Generating an audio notification based on detection of a triggering event
US20130280220A1 (en) 2012-04-20 2013-10-24 Nabil Ahmed Chimeric antigen receptor for bispecific activation and targeting of t lymphocytes
JP2015524255A (ja) 2012-07-13 2015-08-24 ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア 二重特異性抗体を共導入することによってcart細胞の活性を強化する方法
CN113684185A (zh) * 2013-02-26 2021-11-23 纪念斯隆-凯特琳癌症中心 用于免疫疗法的组合物和方法
WO2014138306A1 (en) * 2013-03-05 2014-09-12 Baylor College Of Medicine Engager cells for immunotherapy
CN105283201B (zh) 2013-03-14 2019-08-02 斯克利普斯研究所 靶向剂抗体偶联物及其用途
CA2939711C (en) 2014-02-21 2020-09-29 Cellectis Method for in situ inhibition of regulatory t cells
WO2016016341A1 (en) * 2014-07-29 2016-02-04 Cellectis EGFRvIII SPECIFIC CHIMERIC ANTIGEN RECEPTORS FOR CANCER IMMUNOTHERAPY
BR112017005631A2 (pt) 2014-09-19 2018-06-26 City Of Hope células t com receptor de antígeno coestimulador quimérico direcionadas à il13ra2
CA2964958A1 (en) * 2014-10-31 2016-05-06 The Trustees Of The University Of Pennsylvania Methods and compositions for modified t cells
PL3560953T3 (pl) 2014-12-24 2024-05-13 Autolus Limited Komórka
EP3256492A4 (en) 2015-02-09 2018-07-11 University of Florida Research Foundation, Inc. Bi-specific chimeric antigen receptor and uses thereof
US9708412B2 (en) * 2015-05-21 2017-07-18 Harpoon Therapeutics, Inc. Trispecific binding proteins and methods of use
CN105796597A (zh) 2016-03-11 2016-07-27 江苏三特生物科技有限公司 携带pd-l1和ctla-4抗体基因的car-t细胞在肿瘤免疫上的应用
KR20230148844A (ko) 2016-03-29 2023-10-25 유니버시티 오브 써던 캘리포니아 암을 표적하는 키메라 항원 수용체
EP3436480A4 (en) 2016-03-30 2019-11-27 Musc Foundation for Research Development METHOD FOR THE TREATMENT AND DIAGNOSIS OF CANCER BY TARGETING GLYCOPROTEIN A REPETITION PREDOMINANT (GARP) AND FOR EFFECTIVE IMMUNOTHERAPY ALONE OR IN COMBINATION
US20190307799A1 (en) 2016-09-23 2019-10-10 The Regents Of The University Of Michigan Engineered lymphocytes
US20190338015A1 (en) 2016-10-19 2019-11-07 Cellectis Cell death inducing chimeric antigen receptors
US20200095301A1 (en) 2016-12-14 2020-03-26 The Board Of Trustees Of The Leland Stanford Junior University Il-13 superkine: immune cell targeting constructs and methods of use thereof
EP3568466A4 (en) 2017-01-10 2020-07-15 The General Hospital Corporation TARGETED T CELLS WITH CYTOTOXICITY TO IMMUNOSUPPRESSIVE CELLS
CN110582509A (zh) 2017-01-31 2019-12-17 诺华股份有限公司 使用具有多特异性的嵌合t细胞受体蛋白治疗癌症
US12378297B2 (en) 2017-04-14 2025-08-05 The General Hospital Corporation Chimeric antigen receptor T cells targeting the tumor microenvironment
CN107326014B (zh) 2017-07-31 2019-09-24 时力生物科技(北京)有限公司 一种双特异性嵌合抗原受体修饰的t淋巴细胞及其制备方法和应用
WO2019079034A1 (en) 2017-10-17 2019-04-25 The General Hospital Corporation METHODS AND COMPOSITIONS RELATING TO GENETICALLY MODIFIED REGULATORY T LYMPHOCYTES
WO2019157533A1 (en) 2018-02-12 2019-08-15 The General Hospital Corporation Chimeric antigen receptors targeting the tumor microenvironment
JP2023539871A (ja) 2020-08-26 2023-09-20 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア グリア芽細胞腫を処置するための方法および組成物
WO2023081808A2 (en) * 2021-11-04 2023-05-11 The General Hospital Corporation Anti-mesothelin car t cells secreting teams and methods of use thereof
AU2023254840A1 (en) * 2022-04-15 2024-11-07 The General Hospital Corporation Cd70 binding car-t cells comprising cd33 binding t-cell engaging antibody molecules

Patent Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4737462A (en) 1982-10-19 1988-04-12 Cetus Corporation Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β
US4518584A (en) 1983-04-15 1985-05-21 Cetus Corporation Human recombinant interleukin-2 muteins
US5219740A (en) 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
WO2003064383A2 (en) 2002-02-01 2003-08-07 Ariad Gene Therapeutics, Inc. Phosphorus-containing compounds & uses thereof
US20160200819A1 (en) * 2011-04-08 2016-07-14 The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
US20140322275A1 (en) * 2013-02-20 2014-10-30 Jennifer Brogdon TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR
US20140322183A1 (en) * 2013-03-15 2014-10-30 The Trustees Of The University Of Pennsylvania Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
US20160272717A1 (en) * 2013-08-01 2016-09-22 Ludwig Institute For Cancer Research Ltd Anti-garp protein and uses thereof
WO2017040324A1 (en) 2015-08-28 2017-03-09 The Trustees Of The University Of Pennsylvania Methods and compositions for cells expressing a chimeric intracellular signaling molecule
WO2017049166A1 (en) * 2015-09-17 2017-03-23 Novartis Ag Car t cell therapies with enhanced efficacy
US9567399B1 (en) * 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines
US20180162939A1 (en) * 2016-06-24 2018-06-14 Icell Gene Therapeutics Llc CHIMERIC ANTIGEN RECEPTORS (CARs), COMPOSITIONS AND METHODS THEREOF

Non-Patent Citations (31)

* Cited by examiner, † Cited by third party
Title
"Abeloff's Clinical Oncology", 2013, ELSEVIER, article "Therapeutic Targeting of Cancer Cells: Era of Molecularly Targeted Agents and Cancer Pharmacology"
"Current Protocols in Immunology (CPI", 2003, JOHN WILEY AND SONS, INC.
"Current Protocols in Protein Science (CPPS", 2005, JOHN WILEY AND SONS, INC.
"Harrison's Principles of Internal Medicine", article "Principles of Cancer Therapy"
"Molecular Biology and Biotechnology: a Comprehensive Desk Reference", 1995, VCH PUBLISHERS, INC.
"The Encyclopedia of Molecular Cell Biology and Molecular Medicine", 1999, BLACKWELL SCIENCE LTD.
"The Merck Manual of Diagnosis and Therapy", 2011, MERCK SHARP & DOHME CORP.
A. L. LEHNINGER: "Biochemistry", 1975, WORTH PUBLISHERS, pages: 73 - 75
BAUER ET AL., GENE, vol. 37, 1985, pages 73
BHATNAGAR ET AL., INTEGR. BIOL. (CAMB)., vol. 5, no. 1, 2013, pages 231 - 238
BYRD ET AL., J. CLIN. ONCOL., vol. 32, 2014, pages 3039 - 3047
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CRAIK, BIOTECHNIQUES, 12 January 1985 (1985-01-12)
DE WILDT ET AL., EUR. J. IMMUNOL., vol. 26, no. 3, 1996, pages 629 - 639
EDWARD CHUVINCENT T. DEVITA JR.: "Physicians' Cancer Chemotherapy Drug Manual", 2014, JONES & BARTLETT LEARNING
HOYOS ET AL., HAEMATOLOGICA, vol. 97, 2012, pages 1622
HU ET AL., PHARMACOLOGICAL REVIEWS, vol. 52, 2000, pages 493 - 512
IZUMOTO ET AL., J. NEUROSURG., vol. 108, 2008, pages 963 - 971
KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH
KEU ET AL., SCI. TRANSL. MED., vol. 18, no. 373, 2017, pages 9
KURTHBANNERT: "Retroviruses: Molecular Biology, Genomics and Pathogenesis", 2010, CALSTER ACADEMIC PRESS
MAHER ET AL., CANCER RES, vol. 69, 2009, pages 4559 - 4562
MAUS ET AL., BLOOD, vol. 123, 2014, pages 2624 - 2635
OROURKE, DM ET AL.: "A single dose of peripherally infused EGFRvlll-directed CAR T cells mediates antigen loss and induces adaptive resistance in patients with recurrent glioblastoma", SCIENCE TRANSLATION MEDICINE, vol. 9, no. 399, 19 July 2019 (2019-07-19), pages 1 - 30, XP055613431 *
REARDON ET AL., NEURO-ONCOLOGY, vol. 16, 2014, pages 1441 - 1458
ROSENBERG ET AL., NEW ENG. J. MED., vol. 319, 1988, pages 1676
See also references of EP3609914A4
SMITH ET AL.: "Genetic Engineering: Principles and Methods", 1981, PLENUM PRESS
TAMADA ET AL., CLIN. CANCER RES., vol. 18, 2012, pages 6436 - 6445
WALDER ET AL., GENE, vol. 42, 1986, pages 133
WERNER LUTTMANN: "Immunology", 2006, ELSEVIER

Cited By (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12473343B2 (en) 2017-01-10 2025-11-18 The General Hospital Corporation Targeted t cells with cytotoxicity toward immunosuppressive cells
US12378297B2 (en) 2017-04-14 2025-08-05 The General Hospital Corporation Chimeric antigen receptor T cells targeting the tumor microenvironment
US20210046113A1 (en) * 2017-12-28 2021-02-18 Shanghai Cell Therapy Research Institute Dual-activating costimulatory molecule receptor and use thereof
US20220177524A1 (en) * 2018-07-26 2022-06-09 Nanjing Legend Biotech Co., Ltd. Nef-containing t cells and methods of producing thereof
WO2020092455A2 (en) 2018-10-29 2020-05-07 The Broad Institute, Inc. Car t cell transcriptional atlas
US12576133B2 (en) 2019-03-27 2026-03-17 National Research Council Of Canada Antigen-binding agents that specifically bind epidermal growth factor receptor variant III
EP3947689A4 (en) * 2019-03-27 2023-03-29 National Research Council of Canada ANTIGEN BINDING AGENTS SPECIFIC TO BINDING THE RECEPTOR VARIANT III OF THE EPIDERMAL GROWTH FACTOR
US12005081B2 (en) 2019-04-30 2024-06-11 Senti Biosciences, Inc. Chimeric receptors and methods of use thereof
WO2020245209A1 (en) * 2019-06-03 2020-12-10 Universität Regensburg Cd25-specific chimeric antigen receptors and their uses
EP3747904A1 (en) * 2019-06-03 2020-12-09 Universität Regensburg Cd25-specific chimeric antigen receptors and their uses
CN114585645A (zh) * 2019-08-09 2022-06-03 A2生物治疗公司 对杂合性丧失作出响应的细胞表面受体
WO2021030149A1 (en) * 2019-08-09 2021-02-18 A2 Biotherapeutics, Inc. Cell-surface receptors responsive to loss of heterozygosity
CN114585645B (zh) * 2019-08-09 2025-06-06 A2生物治疗公司 对杂合性丧失作出响应的细胞表面受体
WO2021098834A1 (zh) * 2019-11-22 2021-05-27 上海一宸医药科技有限公司 Psma抗体及其应用
US12195513B2 (en) 2019-12-11 2025-01-14 A2 Biotherapeutics, Inc. LILRB1-based chimeric antigen receptor
US20230242877A1 (en) * 2020-01-21 2023-08-03 Nanjing Bioheng Biotech Co., Ltd Immune cell comprising chimeric antigen receptor and use thereof
JP2023529416A (ja) * 2020-06-09 2023-07-10 ユーシーエル ビジネス リミテッド キメラ抗原受容体細胞
US11602543B2 (en) 2020-08-20 2023-03-14 A2 Biotherapeutics, Inc. Compositions and methods for treating mesothelin positive cancers
US12435124B2 (en) 2020-08-20 2025-10-07 A2 Biotherapeutics, Inc. Compositions and methods for treating CEACAM positive cancers
US11433100B2 (en) 2020-08-20 2022-09-06 A2 Biotherapeutics, Inc. Compositions and methods for treating ceacam positive cancers
US11617767B2 (en) 2020-11-20 2023-04-04 Simcere Innovation, Inc. Armed dual CAR-T compositions and methods for cancer immunotherapy
WO2022109611A1 (en) * 2020-11-20 2022-05-27 Simcere Innovation, Inc. Armed dual car-t compositions and methods for cancer immunotherapy
WO2023077068A1 (en) * 2021-10-28 2023-05-04 Skunkworx Bio, Inc. Novel binding agents related to glycoprotein-a
WO2024196794A3 (en) * 2023-03-17 2025-06-05 The Children's Hospital Of Philadelphia Compositions and methods for interneuron mediated delivery of cytotoxic agents to the brain

Also Published As

Publication number Publication date
CA3059444A1 (en) 2018-10-18
JP7505885B2 (ja) 2024-06-25
AU2023278069B2 (en) 2025-04-10
AU2025205213A1 (en) 2025-08-07
US20240075070A1 (en) 2024-03-07
AU2018251206A1 (en) 2019-10-31
EP3609914A4 (en) 2021-04-14
US20200113940A1 (en) 2020-04-16
CN110520524A (zh) 2019-11-29
AU2023278069A1 (en) 2024-01-04
US12378297B2 (en) 2025-08-05
EP3609914B1 (en) 2026-02-18
EP3609914A1 (en) 2020-02-19
JP2024062986A (ja) 2024-05-10
JP2020516276A (ja) 2020-06-11

Similar Documents

Publication Publication Date Title
AU2023278069B2 (en) Chimeric antigen receptor T cells targeting the tumor microenvironment
US20230250150A1 (en) Chimeric antigen receptors based on alternative signal 1 domains
AU2019218989B2 (en) Chimeric antigen receptors targeting the tumor microenvironment
AU2018279085B2 (en) T cells expressing a chimeric antigen receptor
US20230167190A1 (en) Chimeric antigen receptors targeting cd37
AU2018208614A1 (en) Modified T cells and methods of their use
US20190328787A1 (en) T cells expressing a chimeric antigen receptor
US20250000978A1 (en) Anti-mesothelin car t cells secreting teams and methods of use thereof
US20250186496A1 (en) Methods and compositions for controlling t cell activation
WO2023133488A1 (en) Methods of cell ablation

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18784599

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3059444

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019555484

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018251206

Country of ref document: AU

Date of ref document: 20180416

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018784599

Country of ref document: EP

Effective date: 20191114

WWG Wipo information: grant in national office

Ref document number: 16603675

Country of ref document: US

WWG Wipo information: grant in national office

Ref document number: 2018784599

Country of ref document: EP