WO2018069500A2 - Anti-lag-3 antibodies and compositions - Google Patents

Anti-lag-3 antibodies and compositions Download PDF

Info

Publication number
WO2018069500A2
WO2018069500A2 PCT/EP2017/076188 EP2017076188W WO2018069500A2 WO 2018069500 A2 WO2018069500 A2 WO 2018069500A2 EP 2017076188 W EP2017076188 W EP 2017076188W WO 2018069500 A2 WO2018069500 A2 WO 2018069500A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
amino acid
lag
nos
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2017/076188
Other languages
English (en)
French (fr)
Other versions
WO2018069500A3 (en
Inventor
Michael Monrad Grandal
Vikram Kjøller BHATIA
Torben Gjetting
Camilla Fröhlich
Gunther Roland GALLER
Michael Kragh
Ivan David Horak
Thomas Bouquin
Mikkel Wandahl Pedersen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Symphogen AS
Original Assignee
Symphogen AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to BR112019006876-7A priority Critical patent/BR112019006876A2/pt
Priority to JP2019520053A priority patent/JP7212821B2/ja
Priority to CA3039140A priority patent/CA3039140A1/en
Priority to NZ752044A priority patent/NZ752044A/en
Priority to TNP/2019/000099A priority patent/TN2019000099A1/en
Priority to EA201990912A priority patent/EA201990912A1/ru
Priority to AU2017342071A priority patent/AU2017342071B2/en
Priority to PE2019000815A priority patent/PE20190911A1/es
Priority to US16/340,855 priority patent/US11390676B2/en
Priority to IL265844A priority patent/IL265844B2/en
Priority to KR1020237032304A priority patent/KR102846713B1/ko
Priority to KR1020197012672A priority patent/KR102583190B1/ko
Priority to EP17791987.5A priority patent/EP3526255A2/en
Priority to PH1/2019/500668A priority patent/PH12019500668B1/en
Priority to CN202311394766.8A priority patent/CN117567622A/zh
Priority to RU2019113790A priority patent/RU2755503C2/ru
Priority to MYPI2019001727A priority patent/MY203971A/en
Priority to CN202311388116.2A priority patent/CN117567621A/zh
Application filed by Symphogen AS filed Critical Symphogen AS
Priority to CN201780074499.2A priority patent/CN110062766B/zh
Priority to UAA201904924A priority patent/UA127050C2/uk
Priority to MX2019004241A priority patent/MX2019004241A/es
Priority to CN202311395764.0A priority patent/CN117567623A/zh
Publication of WO2018069500A2 publication Critical patent/WO2018069500A2/en
Publication of WO2018069500A3 publication Critical patent/WO2018069500A3/en
Priority to ZA2019/01924A priority patent/ZA201901924B/en
Priority to SA519401522A priority patent/SA519401522B1/ar
Anticipated expiration legal-status Critical
Priority to CONC2019/0004003A priority patent/CO2019004003A2/es
Priority to US17/834,497 priority patent/US11834503B2/en
Priority to JP2022195869A priority patent/JP7488323B2/ja
Priority to US18/490,500 priority patent/US20240052032A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • 022675_WO057_SL.txt is 64,693 bytes in size.
  • LAG-3 (lymphocyte-activation gene 3), also known as CD223, is an
  • the mature protein is a 503-amino acid type I transmembrane protein with four extracellular Ig- like domains. It is expressed on various types of cells including activated T cells, T regulatory (Treg) cells, natural killer cells, B cells and plasmacytoid dendritic cells.
  • LAG-3 binds MHC class II molecules, although with a higher affinity and at a distinct site compared to CD4.
  • LAG-3 is a co-inhibitory receptor that is thought to regulate T cell proliferation, activation and homeostasis in a manner similar to CTLA-4 and PD-1 .
  • LAG-3 Upon ligand binding to the extracellular domain, LAG-3 exerts its effect through subsequent signaling via the cytoplasmic domain.
  • the best characterized ligand for LAG-3 is MHC class II (MHCII), but other LAG-3 ligands have been described, including LSECtin.
  • LAG-3 has no classical ITIM or ITSM motifs, but has a conserved KIEELE motif (SEQ ID NO: 73) which is thought to be indispensable for accomplishing its inhibitory effect on T-cell activity.
  • SEQ ID NO: 73 conserved KIEELE motif
  • LAG-3 inhibits T cell expansion by blocking entry of activated T-cells into the growth phase of the cell cycle, resulting in the accumulation of cells in the S- phase.
  • LAG-3 is also thought to play a role in enhancing the suppressive activity of regulatory T-cells and in modulating dendritic cell function.
  • Cancer cells have the ability to upregulate expression of MHCII, which binds LAG-3 on effector T-cells, thus inhibiting their activity and inducing tumor immune escape.
  • the present invention is directed to novel recombinant antibodies targeting LAG- 3, as well as pharmaceutical compositions comprising one or more of these antibodies, and use of the antibodies and pharmaceutical compositions for enhancing immunity in a patient, and for treatment of cancers originating from tissues such as skin, lung, intestine, colon, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head and neck, liver, bladder, breast, stomach, uterus and pancreas.
  • the antibodies of the invention may provide a superior clinical response either alone or in combination with another cancer therapeutic, such as an antibody targeting another immune checkpoint protein.
  • the present invention provides an anti-LAG-3 antibody or an antigen-binding portion thereof, wherein the anti-LAG-3 antibody is any of the antibodies referred to herein as antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 , or a variant thereof, where the variant may, e.g., be of a different isotype or isotype subclass and/or contain certain minimum amino acid changes relative to antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 without losing the antigen-binding specificity of the parent antibody.
  • the anti-LAG-3 antibody competes for binding to human LAG-3 with an antibody whose heavy chain (H) CDR1 -3 and light chain (L) CDR1 -3 are the same as or derived from the H-CDR1 -3 and L-CDR1 -3 of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody binds to the same epitope of human LAG-3 as an antibody whose heavy chain (H) CDR1 -3 and light chain (L) CDR1 -3 are the same as or derived from the H-CDR1 -3 and L-CDR1 -3 of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody comprises an H-CDR3 comprising the H-CDR3 amino acid sequence of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody comprises H-CDR1 -3 comprising the H-CDR1 -3 sequences, respectively, of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody comprises an L-CDR3 comprising the L-CDR3 amino acid sequence of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody comprises L-CDR1 -3 comprising the L-CDR1 -3 sequences, respectively, of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody comprises the H-CDR3 and L-CDR3 amino acid sequences of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody comprises the H-CDR1 -3 and L- CDR1 -3 amino acid sequences of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody competes for binding to human
  • LAG-3 with antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody binds to the same epitope of human
  • LAG-3 as antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody comprises a heavy chain
  • H-CDR complementarity-determining region
  • the anti-LAG-3 antibody comprises H-CDR1 -3 comprising the amino acid sequences, respectively, of SEQ ID NOs: 35-37; 41 -43; 35, 42, and 46; 48- 50; 53-55; 56-58; or 62-64.
  • the anti-LAG-3 antibody has a heavy chain variable domain (VH) that is at least 90% (e.g., at least 92%, at least 95%, at least 98%, or at least 99%) identical in sequence to the VH amino acid sequence of SEQ ID NO: 3, 7, 1 1 , 15, 19, 23 or 27.
  • VH heavy chain variable domain
  • the anti-LAG-3 antibody has a VH that comprises SEQ ID NO: 3, 7, 1 1 , 15, 19, 23 or 27.
  • the anti-LAG-3 antibody has a heavy chain (HC) that comprises the VH amino acid sequence of SEQ ID NO: 3, 7, 1 1 , 15, 19, 23 or 27 and the heavy chain constant region amino acid sequence of SEQ ID NO: 30.
  • HC heavy chain
  • the anti-LAG-3 antibody comprises a light chain
  • L-CDR complementarity-determining region
  • the anti-LAG-3 antibody comprises L-CDR1 -3 comprising the amino acid sequences, respectively, of SEQ ID NOs: 38-40; 44, 45, and 40; 44, 47, and 40; 51 , 47, and 52; 59-61 ; or 65-67.
  • the anti-LAG-3 antibody has a light chain variable domain (VL) that is at least 90% (e.g., at least 92%, at least 95%, at least 98%, or at least 99%) identical in sequence to the VL amino acid sequence of SEQ ID NO: 4, 8, 12, 16, 20, 24 or 28.
  • VL light chain variable domain
  • the anti-LAG-3 antibody has a VL that comprises SEQ ID NO: 4, 8, 12, 16, 20, 24 or 28.
  • the anti-LAG-3 antibody has a light chain (LC) that comprises the VL amino acid sequence of SEQ ID NO: 4, 8, 12, 16, 20, 24 or 28 and the light chain constant region amino acid sequence of SEQ ID NO: 32 or 34.
  • LC light chain
  • the anti-LAG-3 antibody comprises the H-CDR3 and L-CDR3 amino acid sequences of SEQ ID NOs: 37 and 40; 43 and 40; 46 and 40; 50 and 52; 55 and 40; 58 and 61 ; or 64 and 67; respectively.
  • the anti-LAG-3 antibody or antigen-binding portion of the invention comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of:
  • the anti-LAG-3 antibody or antigen-binding portion thereof of the invention :
  • a) has a VH that is at least 90% (e.g, at least 92%, at least 95%, at least 98%, or at least 99%) identical in sequence to the amino acid sequence of SEQ ID NO: 3, and a VL that is at least 90% (e.g, at least 92%, at least 95%, at least 98%, or at least 99%) identical in sequence to the amino acid sequence of SEQ ID NO: 4;
  • b) has a VH that is at least 90% (e.g, at least 92%, at least 95%, at least 98%, or at least 99%) identical in sequence to the amino acid sequence of SEQ ID NO: 7, and a VL that is at least 90% (e.g, at least 92%, at least 95%, at least 98%, or at least 99%) identical in sequence to the amino acid sequence of SEQ ID NO: 8;
  • c) has a VH that is at least 90% (e.g, at least 92%, at least 95%, at least 98%, or at least 99%
  • the anti-LAG-3 antibody or antigen-binding portion of the invention a) has a VH that comprises or consists of the amino acid sequence of SEQ ID NO: 3, and a VL that comprises or consists of the amino acid sequence of SEQ ID NO: 4;
  • b) has a VH that comprises or consists of the amino acid sequence of SEQ ID NO: 7, and a VL that comprises or consists of the amino acid sequence of SEQ ID NO: 8;
  • c) has a VH that comprises or consists of the amino acid sequence of SEQ ID NO: 1 1 , and a VL that comprises or consists of the amino acid sequence of SEQ ID NO: 12;
  • d) has a VH that comprises or consists of the amino acid sequence of SEQ ID NO: 15, and a VL that comprises or consists of the amino acid sequence of SEQ ID NO: 16;
  • e has a VH that comprises or consists of the amino acid sequence of SEQ ID NO: 19, and a VL that comprises or consists of the amino acid sequence of SEQ ID NO: 20;
  • f has a VH that comprises or consists of the amino acid sequence of SEQ ID NO: 23, and a VL that comprises or consists of the amino acid sequence of SEQ ID NO: 24; or
  • g has a VH that comprises or consists of the amino acid sequence of SEQ ID NO: 27, and a VL that comprises or consists of the amino acid sequence of SEQ ID NO: 28.
  • a) has an LC that comprises or consists of the amino acid sequences of SEQ ID NOs: 4 and 34; and an HC that comprises or consists of the amino acid sequences of SEQ ID NOs: 3 and 30;
  • b) has an LC that comprises or consists of the amino acid sequences of SEQ ID NOs: 8 and 34; and an HC that comprises or consists of the amino acid sequences of SEQ ID NOs: 7 and 30;
  • c) has an LC that comprises or consists of the amino acid sequences of SEQ ID NOs: 12 and 34; and an HC that comprises or consists of the amino acid sequences of SEQ ID NOs: 1 1 and 30; d) has an LC that comprises or consists of the amino acid sequences of SEQ ID NOs: 16 and 34; and an HC that comprises or consists of the amino acid sequences of SEQ ID NOs: 15 and 30;
  • e has an LC that comprises or consists of the amino acid sequences of SEQ ID NOs: 20 and 34; and an HC that comprises or consists of the amino acid sequences of SEQ ID NOs: 19 and 30;
  • f has an LC that comprises or consists of the amino acid sequences of SEQ ID NOs: 24 and 34; and an HC that comprises or consists of the amino acid sequences of SEQ ID NOs: 23 and 30; or
  • g has an LC that comprises or consists of the amino acid sequences of SEQ ID NOs: 28 and 32; and an HC that comprises or consists of the amino acid sequences of SEQ ID NOs: 27 and 30.
  • the anti-LAG-3 antibody or antigen-binding portion of the invention has at least one of the following properties:
  • g binds to cynomolgus LAG-3 with a K D of 1 .5 x 10 "7 or less as measured by surface plasmon resonance;
  • h) binds to mouse LAG-3 with a K D of 3.5 x 10 "8 or less as measured by surface plasmon resonance; i) stimulates IL-2 production in Staphylococcal enterotoxin B (SEB) treated human peripheral blood mononuclear cells (PBMCs);
  • SEB Staphylococcal enterotoxin B
  • PBMCs peripheral blood mononuclear cells
  • n does not bind to the same epitope of human LAG-3 as antibody 25F7-Lag3.5.
  • Examples of such an antibody include, without limitation, antibody 15646 (having at least properties b, c, d, e, i, and n), antibody 15532 (having at least properties a, c, d, e, f, g, i, j, k, m, and n), antibody 15723 (having at least properties b, c, d, e, i, and n), antibody 15595 (having at least properties a, c, d, e, i, and n), antibody 15431 (having at least properties a, c, d, e, f, g, i, and n), antibody 15572 (having at least properties b, c, d, e, f, g, i, and n), and antibody 1501 1 (having at least properties a, c, d, e, f, g, h, i, j, k
  • the anti-TIM-3 antibody or antigen-binding portion of the invention has at least 13, 12, 1 1 , 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 of said properties. In some embodiments, the anti-TIM-3 antibody or antigen-binding portion of the invention has at least properties b, c, d, e, i, and n; at least properties a, c, d, e, f, g, i, j, k, m, and n; at least properties a, c, d, e, i, and n; at least properties a, c, d, e, f, g, i, and n; at least properties b, c, d, e, f, g, i, and n; or at least properties a, c, d, e, f, g, h, i, j, k, I, m, and n.
  • the anti-LAG-3 antibody or antigen-binding portion of the invention competes for binding to human LAG-3 with antibody 1501 1 , 15572, and/or 15431 .
  • the anti-LAG-3 antibody or antigen-binding portion of the invention binds to an epitope of human LAG-3 having:
  • the anti-LAG-3 antibody or antigen-binding portion of the invention binds to an epitope having amino acid residues 98-105 of SEQ ID NO: 68.
  • Examples of such an antibody include, without limitation, antibodies 15532, 15431 , 15572, and 1501 1 .
  • the anti-LAG-3 antibody or antigen-binding portion of the invention binds to an epitope having:
  • the antibody of the present invention is of isotype IgG, for example, of isotype IgG subclass Igd or lgG 2 .
  • the antibody comprises at least one mutation in the F c region.
  • the antibody comprises a mutation in one or more of heavy chain amino acid positions 228, 234 and 235, which are numbered according to the IMGT ® numbering scheme.
  • one or both of the amino acid residues at positions 234 and 235 may be mutated from Leu to Ala, and/or the amino acid residue at position 228 may be mutated from Ser to Pro.
  • the present invention provides pharmaceutical compositions comprising at least one (e.g., one) anti-LAG-3 antibody or antigen-binding portion thereof as described herein and a pharmaceutically acceptable excipient, optionally with an additional therapeutic, such as an anti-cancer antibody therapeutic.
  • the present invention further provides isolated nucleic acid molecules comprising a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof, a nucleotide sequence that encodes the light chain or an antigen-binding portion thereof, or both, of an anti-LAG-3 antibody as described herein.
  • the invention also provides vectors comprising such an isolated nucleic acid molecule, wherein said vector may further comprise an expression control sequence.
  • the present invention also provide host cells comprising a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof, a nucleotide sequence that encodes the light chain or an antigen-binding portion thereof, or both, of an anti-LAG-3 antibody as described herein.
  • the present invention also provides a method for producing an antibody or antigen-binding portion thereof as described herein, comprising providing a host cell that comprises a nucleotide sequence that encodes the heavy chain or an antigen-binding portion thereof and a nucleotide sequence that encodes the light chain or an antigen- binding portion thereof of an anti-LAG-3 antibody as described herein, culturing said host cell under conditions suitable for expression of the antibody or portion, and isolating the resulting antibody or portion.
  • the present invention also provides a multi-specific (e.g., bi-specific) binding molecule comprising the antigen-binding portion of an anti-LAG-3 antibody described herein and the antigen-binding portion of another, distinct antibody such as another anti- LAG-3 antibody (e.g., as described herein) or an antibody that targets a different protein, such as another immune checkpoint protein, a cancer antigen, or another cell surface molecule whose activity mediates a disease condition such as cancer.
  • a multi-specific (e.g., bi-specific) binding molecule comprising the antigen-binding portion of an anti-LAG-3 antibody described herein and the antigen-binding portion of another, distinct antibody such as another anti- LAG-3 antibody (e.g., as described herein) or an antibody that targets a different protein, such as another immune checkpoint protein, a cancer antigen, or another cell surface molecule whose activity mediates a disease condition such as cancer.
  • the present invention also provides a method for treating a patient with a LAG-3- related disorder, comprising administering to said patient an anti-LAG-3 antibody or an antigen-binding portion thereof, a pharmaceutical composition, or a bi-specific binding molecule as described herein.
  • a patient refers herein to a human patient.
  • the present invention also provides a method for enhancing immunity in a patient, comprising administering to said patient an anti-LAG-3 antibody or an antigen- binding portion thereof, a pharmaceutical composition, or a bi-specific binding molecule as described herein.
  • the present invention further provides a method for treating cancer in a patient, comprising administering to said patient an anti-LAG-3 antibody or an antigen-binding portion thereof, a pharmaceutical composition, or a bi-specific binding molecule as described herein.
  • the cancer originates in a tissue selected from skin, lung, intestine, colon, ovary, brain, prostate, kidney, soft tissues, hematopoietic system, head and neck, liver, bladder, breast, stomach, uterus and pancreas.
  • the cancer is fibrosarcoma, non-small cell lung cancer, melanoma, glioblastoma, gliosarcoma, or colorectal cancer.
  • any of the above methods may further comprise administration of, e.g., a chemotherapeutic agent, an anti-neoplastic agent, an anti-angiogenic agent, a tyrosine kinase inhibitor, a LAG-3 pathway inhibitor, or radiation therapy.
  • the method further comprises administration of retinoic acid, phenylbutyrate, all-trans- retinoic acid, and/or active form vitamin D.
  • the present invention further provides the use of an antibody composition comprising an anti-LAG-3 antibody or antigen-binding portion as described herein for the manufacture of a medicament for treating a patient with a LAG-3-related disorder, treating cancer in a patient, and/or enhancing immunity in a patient in need thereof.
  • the present invention further provides an anti-LAG-3 antibody or antigen-binding portion as described herein for treating a patient with a LAG-3-related disorder, treating cancer in a patient, and/or enhancing immunity in a patient in need thereof.
  • the present invention further provides an article of manufacture comprising an anti-LAG-3 antibody or antigen-binding portion as described herein, wherein said article of manufacture is suitable for treating a patient with a LAG-3-related disorder, treating cancer in a patient, and/or enhancing immunity in a patient in need thereof.
  • Figures 1 A-1 C show representative flow cytometry dot plots for antibodies generated as described in Example 2.
  • Figure 1 A an antibody clone binding specifically to human LAG-3-transfected cells.
  • Figure 1 B an antibody clone binding non-specifically to
  • Figure 1 C an antibody clone that does not bind to any of the cell
  • Figure 2 shows the level of IL-2 production from SEB-stimulated PBMCs after treatment with anti-LAG-3 monoclonal antibodies.
  • Figure 3 shows the level of IL-2 production from SEB-stimulated PBMCs after treatment with anti-LAG-3 monoclonal antibodies. Each dot represents the level of IL-2 secretion from a single PBMC donor.
  • Figure 4 shows the level of luminescence in a LAG-3-MHC class II blocking assay after treatment with anti-LAG-3 monoclonal antibodies. Data are presented as means ⁇ SEM.
  • Figure 5 shows the levels of LAG-3 in lysates and supernatants from a LAG-3 transfected T cell line after treatment with anti-LAG-3 monoclonal antibodies. Data are presented as means ⁇ SEM. Asterisks indicate a statistically significant difference between 15532 and reference antibody analogues ( * : p ⁇ 0.05, *** : p ⁇ 0.001 , **** :
  • Figure 6 demonstrates the in vivo efficacy of antibody 1501 1 in two syngeneic murine tumor models.
  • Figure 7 demonstrates the in vivo efficacy of antibody 15532 in a semi- humanized xenograft tumor model, where the immune system in NOG mice was reconstituted with human PBMC and the mice engrafted with human melanoma A375 cells.
  • Figure 8 shows an overview of the epitope groups (epitope bins) identified by binding competition analysis of a panel of thirteen anti-LAG-3 antibodies.
  • Antibodies connected by black lines indicate cross blocking activity in both orientations (ligand and analyte).
  • Antibodies connected by dashed lines indicate unidirectional blocking where the antibody is blocked when tested as an analyte only.
  • Antibodies are grouped according to competition patterns with other anti-LAG-3 antibodies.
  • Figure 9 shows a cluster analysis of the epitope diversity of ligand antibodies. Antibodies with branching points at x-axis values above 0 have epitopes that are distinct based on the competition for LAG-3 binding of other antibodies in the panel.
  • the present invention provides new anti-human LAG-3 antibodies that can be used to enhance the immune system in a human patient, such as a cancer patient.
  • LAG-3 refers to human LAG-3.
  • a human LAG-3 polypeptide sequence is available under UniProt Accession No. P18627 (LAG3_HUMAN) (SEQ ID NO: 68).
  • antibody refers to a tetramer comprising two heavy (H) chains (about 50-70 kDa) and two light (L) chains (about 25 kDa) inter-connected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable domain (VH) and a heavy chain constant region (CH).
  • Each light chain is composed of a light chain variable domain (VL) and a light chain constant region (CL).
  • VH and VL domains can be subdivided further into regions of hypervariability, termed “complementarity determining regions” (CDRs), interspersed with regions that are more conserved, termed “framework regions” (FRs).
  • CDRs complementarity determining regions
  • FRs framework regions
  • Each VH and VL is composed of three CDRs (H-CDR herein designates a CDR from the heavy chain; and L-CDR herein designates a CDR from the light chain) and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
  • the assignment of amino acid numbers in the heavy or light chain may be in accordance with IMGT ® definitions (Lefranc et al., Dev Comp Immunol 27(1):55-77 (2003)); or the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, MD (1987 and 1991 )); Chothia & Lesk, J. Mol. Biol. 196:901 -917 (1987); or Chothia et al., Nature 342:878-883 (1989).
  • the term "recombinant antibody” refers to an antibody that is expressed from a cell or cell line comprising the nucleotide sequence(s) that encode the antibody, wherein said nucleotide sequence(s) are not naturally associated with the cell.
  • isolated protein refers to a protein, polypeptide or antibody that by virtue of its origin or source of derivation (1 ) is not associated with naturally associated components that accompany it in its native state, (2) is free of other proteins from the same species, (3) is expressed by a cell from a different species, and/or (4) does not occur in nature.
  • a polypeptide that is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be “isolated” from its naturally associated components.
  • a protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well known in the art.
  • germline refers to the nucleotide and amino acid sequences of antibody genes and gene segments as they are passed from parents to offspring via germ cells. Germline sequences are distinguished from the nucleotide sequences encoding antibodies in mature B cells, which have been altered by
  • An antibody that "utilizes" a particular germline sequence has a nucleotide or amino acid sequence that aligns with that germline nucleotide sequence or with the amino acid sequence that it specifies more closely than with any other germline nucleotide or amino acid sequence.
  • affinity refers to a measure of the attraction between an antigen and an antibody.
  • the intrinsic attractiveness of the antibody for the antigen is typically expressed as the binding affinity equilibrium constant (K D ) of a particular antibody-antigen interaction.
  • K D binding affinity equilibrium constant
  • An antibody is said to specifically bind to an antigen when the K D is ⁇ 1 mlvl, preferably ⁇ 100 nM.
  • a K D binding affinity constant can be measured, e.g., by surface plasmon resonance (BIAcoreTM) or Bio-Layer Interferometry, for example using the IBIS MX96 SPR system from IBIS Technologies or the OctetTM system from ForteBio.
  • k 0ff refers to the dissociation rate constant of a particular
  • a k off dissociation rate constant can be measured, e.g., by SPR (surface plasmon resonance), for example using the using the IBIS MX96 system.
  • epitope refers to a portion (determinant) of an antigen that specifically binds to an antibody or a related molecule such as a bi-specific binding molecule.
  • Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and generally have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • An epitope may be "linear” or “conformational.” In a linear epitope, all of the points of interaction between a protein (e.g., an antigen) and an interacting molecule (such as an antibody) occur linearly along the primary amino acid sequence of the protein. In a conformational epitope, the points of interaction occur across amino acid residues on the protein that are separated from one another in the primary amino acid sequence.
  • an antibody to a linear epitope may be generated, e.g., by immunizing an animal with a peptide having the amino acid residues of the linear epitope.
  • An antibody to a conformational epitope may be generated, e.g., by immunizing an animal with a mini-domain containing the relevant amino acid residues of the conformational epitope.
  • An antibody to a particular epitope can also be generated, e.g., by immunizing an animal with the target molecule of interest (e.g., LAG-3) or a relevant portion thereof, then screening for binding to the epitope.
  • test antibody if the test antibody is not able to bind to LAG-3 at the same time, then the test antibody binds to the same epitope, an overlapping epitope, or an epitope that is in close proximity to the epitope bound by the anti-LAG-3 antibody of the invention.
  • This experiment can be performed using, e.g., ELISA, RIA, BIACORETM, SPR, Bio-Layer Interferometry or flow cytometry.
  • competition method described above e.g., determining if the known antibody blocks the test antibody and vice versa.
  • Such cross-competition experiments may be performed, e.g., using an IBIS MX96 SPR instrument or the OctetTM system.
  • An antibody that binds to the same epitope as or competes for binding with an antibody of the invention preferably has MHCII blocking activity, e.g. as determined using the flow cytometric competition assay described in Example 6.
  • An antibody that binds to the same epitope as or competes for binding with an antibody of the invention may reduce binding by at least, e.g., 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80%, or preferably by at least 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%.
  • chimeric antibody refers in its broadest sense to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies, typically an antibody that is partially of human origin and partially of non-human origin, i.e., derived in part from a non-human animal, for example a mouse, rat or other rodent, or an avian such as a chicken. Chimeric antibodies are preferred over non-human antibodies in order to reduce the risk of a human anti-antibody response, e.g., a human anti-mouse antibody response in the case of a murine antibody.
  • An example of a typical chimeric antibody is one in which the variable domain sequences are murine while the constant region sequences are human.
  • the non- human parts may be subjected to further alteration in order to humanize the antibody.
  • the chimeric antibodies described herein may have, e.g., chicken variable domain sequences and human constant region sequences.
  • humanize refers to the fact that where an antibody is wholly or partially of non-human origin (for example, a murine or chicken antibody obtained from
  • mice or chickens respectively, with an antigen of interest, or a chimeric antibody based on such a murine or chicken antibody
  • an antigen of interest or a chimeric antibody based on such a murine or chicken antibody
  • non-human antibodies tend to be more immunogenic in humans than human antibodies.
  • Chimeric antibodies, where the foreign (e.g. rodent or avian) constant regions have been replaced with sequences of human origin, have been shown to be generally less immunogenic than antibodies of fully foreign origin, and the trend in therapeutic antibodies is towards humanized or fully human antibodies. Chimeric antibodies or other antibodies of non-human origin thus can be humanized to reduce the risk of a human anti-antibody response.
  • humanization typically involves modification of the framework regions of the variable domain sequences.
  • Amino acid residues that are part of complementarity determining regions (CDRs) most often will not be altered in connection with humanization, although in certain cases it may be desirable to alter individual CDR amino acid residues, for example to remove a glycosylation site, a deamidation site, an aspartate isomerization site or an undesired cysteine or methionine residue.
  • CDRs complementarity determining regions
  • Removal of an N-glycosylation site may be achieved by mutating either the Asn or the Ser/Thr residue to a different residue, preferably by way of conservative substitution.
  • Deamidation of asparagine and glutamine residues can occur depending on factors such as pH and surface exposure. Asparagine residues are particularly
  • CDR grafting which for, e.g., a murine-derived chimeric antibody involves identification of human germline gene counterparts to the murine variable domain genes and grafting of the murine CDR sequences into this framework.
  • the specificity of an antibody's interaction with a target antigen resides primarily in the amino acid residues located in the six CDRs of the heavy and light chain. The amino acid sequences within CDRs are therefore much more variable between individual antibodies than sequences outside of CDRs.
  • CDR sequences are responsible for most antibody-antigen interactions, it is possible to express recombinant antibodies that mimic the properties of a specific naturally occurring antibody, or more generally any specific antibody with a given amino acid sequence, e.g., by constructing expression vectors that express CDR sequences from the specific antibody grafted into framework sequences from a different antibody. As a result, it is possible to "humanize" a non-human antibody and still substantially maintain the binding specificity and affinity of the original antibody.
  • CDR grafting may be based on the Kabat CDR definitions, although a more recent publication (Magdelaine-Beuzelin et al., Crit Rev. Oncol Hematol.
  • CDR grafting may reduce the binding specificity and affinity, and thus the biological activity, of a CDR-grafted antibody as compared to the parent antibody from which the CDRs are obtained.
  • Back mutations (sometimes referred to as "framework repair") may be introduced at selected positions of the CDR-grafted antibody, typically in the framework regions, in order to reestablish the binding specificity and affinity of the parent antibody. Positions for possible back mutations can be identified using information available in the literature and in antibody databases. Amino acid residues that are candidates for back mutations are typically those that are located at the surface of an antibody molecule, while residues that are buried or that have a low degree of surface exposure will not normally be altered.
  • An alternative humanization technique to CDR grafting and back mutation is resurfacing, in which non-surface exposed residues of non- human origin are retained, while surface residues are altered to human residues.
  • affinity maturation it also may be desirable to alter one or more CDR amino acid residues in order to improve binding affinity to the target epitope.
  • This is known as "affinity maturation” and may optionally be performed in connection with humanization, for example in situations where humanization of an antibody leads to reduced binding specificity or affinity and it is not possible to sufficiently improve the binding specificity or affinity by back mutations alone.
  • affinity maturation methods are known in the art, for example the in vitro scanning saturation mutagenesis method described by Burks et al., Proc Natl Acad Sci USA, 94:412-417 (1997), and the stepwise in vitro affinity maturation method of Wu et al., Proc Natl Acad Sci USA 95:6037-6042 (1998).
  • antibody portion refers to one or more portions or fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., human LAG-3, or a portion thereof). It has been shown that certain fragments of a full-length antibody can perform the antigen- binding function of the antibody.
  • binding fragments encompassed within the term "antigen-binding portion” include (i) a Fab fragment: a monovalent fragment consisting of the V L , V H , CL and CH1 domains; (ii) a F(ab')2 fragment: a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the V H and CH1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment, which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR) capable of specifically binding to an antigen.
  • a Fab fragment a monovalent fragment consisting of the V L , V H , CL and CH1 domains
  • a F(ab')2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
  • single chain Fv single chain Fv
  • antigen-binding molecules comprising a V H and/or a V L .
  • the molecule may also comprise one or more of a CH1 , hinge, CH2, or CH3 region.
  • Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
  • Other forms of single chain antibodies, such as diabodies, are also encompassed.
  • Diabodies are bivalent, bi-specific antibodies in which V H and V L domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen-binding sites.
  • Antibody portions such as Fab and F(ab')2 fragments, can be prepared from whole antibodies using conventional techniques, such as papain or pepsin digestion of whole antibodies. Moreover, antibodies, antibody portions and immunoadhesion molecules can be obtained using standard recombinant DNA techniques, e.g., as described herein.
  • the class (isotype) and subclass of anti-LAG-3 antibodies may be determined by any method known in the art.
  • the class and subclass of an antibody may be determined using antibodies that are specific for a particular class and subclass of antibody. Such antibodies are available commercially.
  • the class and subclass can be determined by ELISA, Western Blot as well as other techniques.
  • the class and subclass may be determined by sequencing all or a portion of the constant regions of the heavy and/or light chains of the antibodies, comparing their amino acid sequences to the known amino acid sequences of various classes and subclasses of immunoglobulins, and determining the class and subclass of the antibodies.
  • the present invention provides antibodies directed against LAG-3, and antigen- binding portions thereof.
  • the antibodies disclosed herein are human antibodies generated from transgenic rats that are able to generate antibodies with human idiotypes.
  • the antibodies are chicken-derived chimeric antibodies comprising chicken CDR sequences and human framework regions, where the framework regions have been subjected to humanization.
  • One advantage of the novel anti-LAG-3 antibodies of the invention is that they are able to enhance activity of T-cells as measured by increased IL-2 production; see, e.g., Example 7. While not wishing to be bound by any particular theory, it is believed that the anti-LAG-3 antibodies of the invention are able to block the interaction of LAG-3 with its putative ligands such as MHCII and LSECtin. The antibodies may accomplish this directly via blocking of the ligand binding region, as demonstrated, e.g., in Example 6, or via induction of LAG-3 internalization, which is contemplated as a possible mechanism of action behind the results presented in Example 9.
  • Another potential advantage of the anti- LAG-3 antibodies of the invention is a low level of secondary effector functions in antibodies having the "LALA" mutations (L234A L235A), which hinder significant antibody binding to human FcgR (Fc gamma receptors) and hence depletion of effector T-cells.
  • the anti-LAG-3 antibody has a heavy chain CDR3 (H-CDR3) that is at least 90% identical in sequence to any one of SEQ ID NOs: 37, 43, 46, 50, 55, 58, and 64, e.g. at least 92% identical, such as at least 95%, 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 37, 43, 46, 50, 55, 58, and 64.
  • H-CDR3 heavy chain CDR3
  • the anti-LAG-3 antibody has a heavy chain variable domain (VH) that is at least 90% identical in sequence to any one of SEQ ID NOs: 3, 7, 1 1 , 15, 19, 23 or 27, e.g. at least 92% identical, such as at least 95%, 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 3, 7, 1 1 , 15, 19, 23 or 27.
  • VH heavy chain variable domain
  • the anti-LAG-3 antibody has a heavy chain variable domain (VH) that is at least 90% identical in sequence to any one of SEQ ID NOs: 3, 7, 1 1 , 15, 19, 23 or 27, e.g. at least 92% identical, such as at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 3, 7, 1 1 , 15, 19, 23 or 27; and a heavy chain constant region that is at least 90% identical in sequence to SEQ ID NO: 30, e.g. at least 92% identical, such as at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 30.
  • VH heavy chain variable domain
  • the anti-LAG-3 antibody has a heavy chain (HC) that comprises the VH amino acid sequence of any one of SEQ ID NOs: 3, 7, 1 1 , 15, 19, 23 or 27 and the heavy chain constant region amino acid sequence of SEQ ID NO: 30.
  • HC heavy chain
  • the anti-LAG-3 antibody has a light chain CDR3 (L-CDR3) that is at least 90% identical in sequence to any one of SEQ ID NOs: 40, 52, 61 , and 67, e.g. at least 92% identical, such as at least 95%, 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 40, 52, 61 , and 67.
  • L-CDR3 light chain CDR3
  • the anti-LAG-3 antibody has a light chain variable domain (VL) that is at least 90% identical in sequence to the VL amino acid sequence of any one of SEQ ID NOs: 4, 8, 12, 16, 20, 24 or 28, e.g. at least 92% identical, such as at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 4, 8, 12, 16, 20, 24 or 28.
  • VL light chain variable domain
  • the anti-LAG-3 antibody has a light chain variable domain (VL) that is at least 90% identical in sequence to the VL amino acid sequence of any one of SEQ ID NOs: 4, 8, 12, 16, 20 or 24, e.g. at least 92% identical, such as at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 4, 8, 12, 16, 20 or 24; and a light chain constant region amino acid sequence that is at least 90% identical in sequence to SEQ ID NO: 34, e.g. at least 92% identical, such as at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 34.
  • VL light chain variable domain
  • the anti-LAG-3 antibody has a light chain variable domain (VL) that is at least 90% identical in sequence to the VL amino acid sequence of SEQ ID NO: 28, e.g. at least 92% identical, such as at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 28; and a light chain constant region amino acid sequence that is at least 90% identical in sequence to SEQ ID NO: 32, e.g. at least 92% identical, such as at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 32.
  • VL light chain variable domain
  • the anti-LAG-3 antibody has a light chain that comprises any one of SEQ ID NOs: 4, 8, 12, 16, 20 or 24, and SEQ ID NO: 34.
  • the anti-LAG-3 antibody has a light chain that comprises SEQ ID NO: 28 and SEQ ID NO: 32.
  • the anti-LAG-3 antibody comprises any one of the above-described heavy chains and any one of the above-described light chains.
  • the anti-LAG-3 antibody or antigen-binding portion of the invention comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of:
  • the anti-LAG-3 antibody or antigen-binding portion of the invention comprises an H-CDR3 and an L-CDR3 that are 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences of:
  • the anti-LAG-3 antibody or antigen-binding portion of the invention comprises a VH and a VL that are 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences of:
  • the anti-LAG-3 antibody or antigen-binding portion of the invention comprises a VH and a VL that have the amino acid sequences of:
  • the anti-LAG-3 antibody comprises:
  • the anti-LAG-3 antibody or antigen-binding portion of the invention comprises the H-CDR1 -3 and L-CDR1 -3 amino acid sequences of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody or antigen-binding portion of the invention comprises a VH and VL that are at least 90% identical in amino acid sequence to the VH and VL, respectively, of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody or antigen-binding portion of the invention comprises a VH and VL that are the VH and VL, respectively, of antibody 15646, 15532, 15723, 15595, 15431 , 15572 or 1501 1 .
  • the anti-LAG-3 antibody of the invention is antibody
  • the invention also provides an anti-LAG-3 antibody or an antigen-binding portion thereof that binds to an epitope of human LAG-3 having:
  • the invention also provides a monoclonal antibody or an antigen-binding portion thereof that binds to an epitope of human LAG-3 having residues 98-105.
  • the antibody or antigen-binding portion binds to an epitope of human LAG-3 having:
  • the invention also provides a monoclonal antibody or an antigen-binding portion thereof that binds to an epitope of human LAG-3 having residues 23-30 and 40-66 of SEQ ID NO: 68.
  • the epitope further has residues 88-105, 123-137, and/or 148-152 of SEQ ID NO: 68.
  • the epitope further has residues 98-105, 1 18-137, and 148-161 of SEQ ID NO: 68.
  • the invention also provides an anti-LAG-3 antibody or an antigen-binding portion thereof that competes or cross-competes for binding with, or binds to the same epitope as, an antibody selected from the group consisting of 15532, 15646, 15723, 15595, 15431 , 15572, and 1501 1 .
  • the anti-LAG-3 antibody or antigen-binding portion thereof of the invention does not bind to the same epitope of human LAG-3 as antibody 25F7- Lag3.5.
  • the anti-LAG-3 antibody or antigen-binding portion thereof of the invention utilizes a human heavy chain germline gene selected from the group consisting of IGHV4-34, IGHV1 -24, IGHV6-1 , IGHV4-39, and IGHV3-23.
  • the heavy chain germline gene is at least 75%, 80%, 82%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the corresponding heavy chain sequence in the anti-LAG3 antibody or antigen-binding portion.
  • the framework region sequences of said heavy chain germline gene are at least 75%, 80%, 82%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the corresponding heavy chain framework region sequences in the anti-LAG3 antibody or antigen-binding portion.
  • the anti-LAG-3 antibody or antigen-binding portion thereof of the invention utilizes a human light chain germline gene selected from the group consisting of IGKV3-1 1 , IGKV1 -12, IGKV1 -5, and IGLV3-19.
  • the light chain germline gene is at least 75%, 80%, 82%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the corresponding light chain sequence in the anti-LAG3 antibody or antigen-binding portion.
  • the framework region sequences of said light chain germline gene are at least 75%, 80%, 82%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the corresponding light chain framework region sequences in the anti-LAG3 antibody or antigen-binding portion.
  • the anti-LAG-3 antibody or antigen-binding portion thereof of the invention utilizes any combination of the above human heavy chain germline genes and human light chain germline genes (e.g., IGHV4-34 and IGKV3-1 1 , IGHV1 -24 and IGKV1 -12, IGHV6-1 and IGKV3-1 1 , IGHV4-39 and IGKV1 -5, or IGHV3-23 and IGLV3- 19).
  • human heavy chain germline genes e.g., IGHV4-34 and IGKV3-1 1 , IGHV1 -24 and IGKV1 -12, IGHV6-1 and IGKV3-1 1 , IGHV4-39 and IGKV1 -5, or IGHV3-23 and IGLV3- 19.
  • the heavy and light chain germline genes are at least 75%, 80%, 82%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the corresponding heavy and light chain sequences, respectively, in the anti-LAG3 antibody or antigen-binding portion.
  • the heavy and light chain germline genes are at least 75%, 80%, 82%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the corresponding heavy and light chain sequences, respectively, in the anti-LAG3 antibody or antigen-binding portion.
  • the framework region sequences of said heavy and light chain germline genes are at least 75%, 80%, 82%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the corresponding heavy and light chain framework region sequences, respectively, in the anti-LAG3 antibody or antigen- binding portion.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may bind to human LAG-3 with an EC50 of, for example, 0.2 nM or less, 0.15 nM or less, 0.1 nM or less, 0.09 nM or less, 0.08 nM or less, 0.07 nM or less, 0.06 nM or less, 0.05 nM or less, or 0.04 nM or less.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may bind to
  • cynomolgus LAG-3 with, for example, an EC50 of 0.4 nM or less, 0.3 nM or less, 0.2 nM or less, 0.1 nM or less, 0.09 nM or less, 0.08 nM or less, 0.07 nM or less, 0.06 nM or less, 0.05 nM or less, 0.04 nM or less, or 0.03 nM or less.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may bind to human LAG-3 with an EC50 of, for example, 0.1 nM or less. In some embodiments, any of the anti-LAG-3 antibodies or antigen-binding portions described herein may bind to cynomolgus LAG-3 with, for example, an EC50 of 0.3 nM or less. In particular embodiments, any of the anti-LAG-3 antibodies or antigen- binding portions described herein may bind to human LAG-3 with, for example, an EC50 of 0.1 nM or less and cynomolgus LAG-3 with, for example, an EC50 of 0.3 nM or less.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may inhibit binding of ligands such as MHC class II (MHCII) or LSECtin to LAG-3.
  • the anti-LAG-3 antibody or antigen-binding portion may reduce the binding of LAG-3 to MHCII by at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% compared to binding in the presence of a negative control antibody.
  • the anti-LAG-3 antibody or antigen-binding protein may reduce the binding of LAG-3 to MHCII by great than 85% compared to the negative control. In one embodiment, the anti-LAG-3 antibody or antigen-binding protein may reduce the binding of LAG-3 to MHCII by between about 35% and 85% compared to the negative control.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may block binding between LAG-3 and MHC class II, e.g., human LAG-3 expressed on Jurkat cells and human MHC class II expressed on Raji cells (for example, at a concentration of 0.1 pg/mL, 0.5 pg/mL, 1 pg/mL, 5 pg/mL, 10 pg/mL, 20 g/mL, 30 pg/mL, 40 pg/mL, or 50 pg/mL).
  • LAG-3 and MHC class II e.g., human LAG-3 expressed on Jurkat cells and human MHC class II expressed on Raji cells (for example, at a concentration of 0.1 pg/mL, 0.5 pg/mL, 1 pg/mL, 5 pg/mL, 10 pg/mL, 20 g/mL, 30 pg/mL, 40 pg/mL, or 50
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may bind to human LAG-3 with a K D of 5.0 x 10 "8 or less, 4.0 x 10 "8 or less, 3.0 x 10 "8 or less, 2.0 x 10 "8 or less, 1 .0 x 10 "8 or less, 9.0 x 10 "9 or less, 8.0 x 10 "9 or less, 7.0 x 10 "9 or less, 6.0 x 10 "9 or less, 5.0 x 10 "9 or less, 4.0 x 10 “9 or less, 3.0 x 10 "9 or less, 2.0 x 10 "9 or less, or 1 .0 x 10 "9 or less, as measured by surface plasmon resonance.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may bind to cynomolgus LAG-3 with a K D of 1 .5 x 10 "7 or less, 1 .0 x 10 "7 or less, 9.0 x 10 "8 or less, 8.0 x 10 "8 or less, 7.0 x 10 "8 or less, 6.0 x 10 "8 or less, 5.0 x 10 "8 or less, 4.0 x 10 "8 or less, 3.0 x 10 "8 or less, 2.0 x 10 "8 or less, or 1 .0 x 10 "8 or less, as measured by surface plasmon resonance.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may bind to mouse LAG-3 with a K D of 5.0 x 10 "8 or less, 4.5 x 10 "8 or less, 4.0 x 10 "8 or less, 3.5 x 10 "8 or less, or 3.0 x 10 "8 or less, as measured by surface plasmon resonance.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may stimulate IL-2 production, e.g., from SEB-stimulated PBMCs.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may reduce cellular and/or soluble levels of LAG-3, e.g., in a human T cell line (such as a human T cell line overexpressing LAG-3).
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may induce tumor growth regression and/or delay tumor growth in vivo.
  • any of the anti-LAG-3 antibodies or antigen-binding portions described herein may bind to a different epitope of human LAG-3 than antibody 25F7-Lag3.5.
  • an anti-LAG-3 antibody of the invention or an antigen-binding portion thereof may activate T-cells, causing enhanced anti-tumor activity.
  • the class of an anti-LAG-3 antibody obtained by the methods described herein may be changed or switched with another class or subclass.
  • a nucleic acid molecule encoding VL or VH is isolated using methods well- known in the art such that it does not include nucleic acid sequences encoding CL or CH, respectively.
  • the nucleic acid molecules encoding VL or VH then are operatively linked to a nucleic acid sequence encoding a CL or CH, respectively, from a different class of immunoglobulin molecule.
  • an anti-LAG-3 antibody that was originally IgM may be class switched to IgG. Further, the class switching may be used to convert one IgG subclass to another, e.g., from Igd to lgG 2 .
  • a K light chain constant region can be changed, e.g., to a ⁇ light chain constant region.
  • a preferred method for producing an antibody of the invention with a desired Ig isotype comprises the steps of isolating a nucleic acid molecule encoding the heavy chain of an anti-LAG-3 antibody and a nucleic acid molecule encoding the light chain of an anti-LAG-3 antibody, obtaining the variable domain of the heavy chain, ligating the variable domain of the heavy chain with the constant region of a heavy chain of the desired isotype, expressing the light chain and the ligated heavy chain in a cell, and collecting the anti- LAG-3 antibody with the desired isotype.
  • the anti-LAG-3 antibody of the invention can be an IgG, an IgM, an IgE, an IgA, or an IgD molecule, but is typically of the IgG isotype, e.g. of IgG subclass Igd , lgG 2 a or lgG 2 b, lgG 3 or lgG 4 .
  • the antibody is an Igd .
  • the antibody is an lgG 2 .
  • the Igd antibodies of the present invention that bind to a LAG-3 epitope described herein offer superior activity in
  • LAG-3 functions to achieve the cancer treatment or immunostimulatory effects.
  • the anti-LAG-3 antibody may comprise at least one mutation in the Fc region.
  • Fc mutations A number of different Fc mutations are known, where these mutations provide altered effector function. For example, in many cases it will be desirable to reduce or eliminate effector function, e.g. where ligand/receptor interactions are undesired or in the case of antibody-drug conjugates.
  • the anti-LAG-3 antibody comprises at least one mutation in the Fc region that reduces effector function.
  • Fc region amino acid positions that may be advantageous to mutate in order to reduce effector function include one or more of positions 228, 233, 234 and 235, where amino acid positions are numbered according to the IMGT ® numbering scheme.
  • one or both of the amino acid residues at positions 234 and 235 may be mutated, for example from Leu to Ala (L234A L235A). These mutations reduce effector function of the Fc region of Igd antibodies.
  • the amino acid residue at position 228 may be mutated, for example to Pro.
  • the amino acid residue at position 233 may be mutated, e.g., to Pro
  • the amino acid residue at position 234 may be mutated, e.g., to Val
  • the amino acid residue at position 235 may be mutated, e.g., to Ala.
  • the amino acid positions are numbered according to the IMGT ® numbering scheme.
  • the antibody may comprise the mutation S228P, i.e. having a proline in position 228, where the amino acid position is numbered according to the IMGT ® numbering scheme. This mutation is known to reduce undesired Fab arm exchange.
  • an antibody or antigen-binding portion thereof of the invention may be part of a larger immunoadhesion molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides.
  • immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov et al., Human Antibodies and Hybridomas 6:93-101 (1995)) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov et al., Mol.
  • CDRs from an antibody are incorporated into a molecule either covalently or noncovalently to make it an immunoadhesin that specifically binds to an antigen of interest.
  • the CDR(s) may be incorporated as part of a larger polypeptide chain, may be covalently linked to another polypeptide chain, or may be incorporated noncovalently.
  • a fusion antibody or immunoadhesin may be made that comprises all or a portion of an anti-LAG-3 antibody of the invention linked to another polypeptide.
  • only the variable domains of the anti-LAG-3 antibody are linked to the polypeptide.
  • the VH domain of an anti- LAG-3 antibody is linked to a first polypeptide
  • the VL domain of an anti-LAG-3 antibody is linked to a second polypeptide that associates with the first polypeptide in a manner such that the VH and VL domains can interact with one another to form an antigen-binding site.
  • the VH domain is separated from the VL domain by a linker such that the VH and VL domains can interact with one another (e.g., single-chain antibodies).
  • the VH-linker-VL antibody is then linked to the polypeptide of interest.
  • fusion antibodies can be created in which two (or more) single- chain antibodies are linked to one another. This is useful if one wants to create a divalent or polyvalent antibody on a single polypeptide chain, or if one wants to create a bi-specific antibody.
  • the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly4 -Ser)3 (SEQ ID NO: 74), such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VL and VH domains joined by the flexible linker.
  • a flexible linker e.g., encoding the amino acid sequence (Gly4 -Ser)3 (SEQ ID NO: 74)
  • the single chain antibody may be monovalent, if only a single VH and VL are used; bivalent, if two VH and VL are used; or polyvalent, if more than two VH and VL are used.
  • Bi-specific or polyvalent antibodies may be generated that bind specifically to human LAG-3 and to another molecule, for instance.
  • modified antibodies may be prepared using anti- LAG-3 antibody-encoding nucleic acid molecules.
  • "kappa bodies” III et al., Protein Eng. 10:949-57 (1997)
  • "minibodies” Martin et al., EMBO J. 13:5303-9 (1994)
  • "diabodies” Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993)
  • Janusins (Traunecker et al., EMBO J. 10:3655-3659 (1991 ) and Traunecker et al., Int. J. Cancer (Suppl.) 7:51 -52 (1992)) may be prepared using standard molecular biological techniques following the teachings of the specification.
  • an anti-LAG-3 antibody or antigen-binding portion of the invention can be derivatized or linked to another molecule (e.g., another peptide or protein).
  • the antibodies or portions thereof are derivatized such that LAG-3 binding is not affected adversely by the derivatization or labeling.
  • the antibodies and antibody portions of the invention are intended to include both intact and modified forms of the human anti-LAG-3 antibodies described herein.
  • an antibody or antibody portion of the invention can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bi-specific antibody or a diabody), a detection agent, a
  • a pharmaceutical agent and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • another molecule such as a streptavidin core region or a polyhistidine tag.
  • One type of derivatized antibody is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bi-specific antibodies).
  • Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N- hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate).
  • Such linkers are available, e.g., from Pierce Chemical Company, Rockford, II.
  • An anti-LAG-3 antibody can also be derivatized with a chemical group such as polyethylene glycol (PEG), a methyl or ethyl group, or a carbohydrate group. These groups may be useful to improve the biological characteristics of the antibody, e.g., to increase serum half-life.
  • PEG polyethylene glycol
  • an antibody according to the present invention may also be labeled.
  • the terms "label” or “labeled” refer to incorporation of another molecule in the antibody.
  • the label is a detectable marker, e.g., incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods).
  • the label or marker can be therapeutic, e.g., a drug conjugate or toxin.
  • Various methods of labeling polypeptides and glycoproteins are known in the art and may be used.
  • labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3H, 14C, 15N, 35S, 90Y, 99Tc, 1 1 1 In, 1251, 131 1), fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, ⁇ -galactosidase, luciferase, alkaline phosphatase), chemiluminescent markers, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), magnetic agents, such as gadolinium chelates, toxins such as pertussis toxin, taxol, cytochalasin B, gramicidin D, ethidium bromide, e
  • the antibodies of the invention may be present in a neutral form (including zwitter ionic forms) or as a positively or negatively-charged species.
  • the antibodies may be complexed with a counterion to form a pharmaceutically acceptable salt.
  • pharmaceutically acceptable salt refers to a complex comprising one or more antibodies and one or more counterions, wherein the counterions are derived from pharmaceutically acceptable inorganic and organic acids and bases.
  • the invention provides a bi-specific binding molecule having the binding specificity (e.g., comprising the antigen-binding portions) of an anti-LAG-3 antibody described herein and the binding specificity of another anti-LAG-3 antibody (e.g., another anti-LAG-3 antibody described herein) or an antibody that targets a different protein, such as another immune checkpoint protein, a cancer antigen, or another cell surface molecule whose activity mediates a disease condition such as cancer.
  • a bi-specific binding molecules are known in the art, and examples of different types of bi- specific binding molecules are given elsewhere herein.
  • the present invention also provides nucleic acid molecules and sequences encoding anti-LAG-3 antibodies or antigen-binding portions thereof described herein.
  • different nucleic acid molecules encode the heavy chain and light chain amino acid sequences of the anti-LAG-3 antibody or an antigen-binding portion thereof.
  • the same nucleic acid molecule encodes the heavy chain and light chain amino acid sequences of the anti-LAG-3 antibody or an antigen-binding portion thereof.
  • a reference to a nucleotide sequence encompasses its complement unless otherwise specified. Thus, a reference to a nucleic acid having a particular sequence should be understood to encompass its complementary strand, with its complementary sequence.
  • polynucleotide as referred to herein means a polymeric form of nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide.
  • the term includes single- and double- stranded forms.
  • the invention also provides nucleotide sequences that are at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to one or more nucleotide sequences recited herein, e.g., to a nucleotide sequence selected from the group consisting of SEQ ID NOs: 1 , 2, 5, 6, 9, 10, 13, 14, 17, 18, 21 , 22, 25 and 26, or to a nucleotide sequence encoding an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 4, 7, 8, 1 1 , 12, 15, 16, 19, 20, 23, 24, 27 and 28.
  • sequence identity in the context of nucleic acid sequences refers to the residues in two sequences that are the same when aligned for maximum correspondence.
  • the length of sequence identity comparison may be over a stretch of at least about nine nucleotides, usually at least about 18 nucleotides, more usually at least about 24 nucleotides, typically at least about 28 nucleotides, more typically at least about 32 nucleotides, and preferably at least about 36, 48 or more nucleotides.
  • FASTA which includes, e.g., the programs FASTA2 and FASTA3, provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences (see, e.g., Pearson, Methods Enzymol. 183:63-98 (1990); Pearson, Methods Mol. Biol. 132:185-219 (2000); Pearson, Methods Enzymol. 266:227-258 (1996); and Pearson, J. Mol. Biol. 276:71 -84 (1998); incorporated herein by reference). Unless otherwise specified, default parameters for a particular program or algorithm are used.
  • nucleic acid molecule comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 1 , 2, 5, 6, 9, 10, 13, 14, 17, 18, 21 , 22, 25 and 26.
  • the nucleic acid molecule comprises the nucleotide sequences of SEQ ID NOs: 1 and 2, SEQ ID NOs: 5 and 6, SEQ ID NOs: 9 and 10, SEQ ID NOs: 13 and 14, SEQ ID NOs: 17 and 18, SEQ ID NOs: 21 and 22, or SEQ ID NOs: 25 and 26.
  • the nucleic acid molecules may be isolated.
  • the present invention provides a vector suitable for expressing one of the chains of an antibody or antigen-binding portion thereof as described herein.
  • the term "vector”, as used herein, means a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • the vector is a plasmid, i.e., a circular double stranded piece of DNA into which additional DNA segments may be ligated.
  • the vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • the vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • the vectors e.g., non-episomal mammalian vectors
  • the vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors").
  • the invention provides vectors comprising nucleic acid molecules that encode the heavy chain of an anti-LAG-3 antibody of the invention or an antigen-binding portion thereof, the light chain of an anti-LAG-3 antibody of the invention or an antigen-binding portion thereof, or both the heavy and light chains of an anti-LAG-3 antibody of the invention or an antigen-binding portion thereof.
  • the invention further provides vectors comprising nucleic acid molecules encoding fusion proteins, modified antibodies, antibody fragments, and probes thereof.
  • a nucleic acid molecule encoding the heavy and/or light chain of an anti-LAG-3 antibody or antigen-binding portion thereof of the invention can be isolated from any source that produces such an antibody or portion.
  • the nucleic acid molecules are isolated from B cells that express an anti-LAG-3 antibody isolated from an animal immunized with a human LAG-3 antigen, or from an immortalized cell produced from such a B cell. Methods of isolating nucleic acids encoding an antibody are well- known in the art. mRNA may be isolated and used to produce cDNA for use in
  • a nucleic acid molecule of the invention can be synthesized rather than isolated.
  • a nucleic acid molecule of the invention can comprise a nucleotide sequence encoding a VH domain from an anti-LAG-3 antibody or antigen- binding portion of the invention joined in-frame to a nucleotide sequence encoding a heavy chain constant region from any source.
  • a nucleic acid molecule of the invention can comprise a nucleotide sequence encoding a VL domain from an anti-LAG-3 antibody or antigen-binding portion of the invention joined in-frame to a nucleotide sequence encoding a light chain constant region from any source.
  • nucleic acid molecules encoding the variable domain of the heavy (VH) and/or light (VL) chains may be "converted" to full-length antibody genes.
  • nucleic acid molecules encoding the VH or VL domains are converted to full-length antibody genes by insertion into an expression vector already encoding heavy chain constant (CH) or light chain constant (CL) regions, respectively, such that the VH segment is operatively linked to the CH segment(s) within the vector, and/or the VL segment is operatively linked to the CL segment within the vector.
  • CH heavy chain constant
  • CL light chain constant
  • nucleic acid molecules encoding the VH and/or VL domains are converted into full-length antibody genes by linking, e.g., ligating, a nucleic acid molecule encoding a VH and/or VL domains to a nucleic acid molecule encoding a CH and/or CL region using standard molecular biological techniques. Nucleic acid molecules encoding the full-length heavy and/or light chains may then be expressed from a cell into which they have been introduced and the anti-LAG-3 antibody isolated.
  • the nucleic acid molecules may be used to recombinantly express large quantities of anti-LAG-3 antibodies.
  • the nucleic acid molecules also may be used to produce chimeric antibodies, bi-specific antibodies, single chain antibodies,
  • a nucleic acid molecule of the invention is used as a probe or PCR primer for a specific antibody sequence.
  • the nucleic acid can be used as a probe in diagnostic methods or as a PCR primer to amplify regions of DNA that could be used, inter alia, to isolate additional nucleic acid molecules encoding variable domains of anti-LAG-3 antibodies.
  • the nucleic acid molecules are oligonucleotides.
  • the oligonucleotides are from highly variable domains of the heavy and light chains of the antibody of interest.
  • the oligonucleotides encode all or a part of one or more of the CDRs of the anti-LAG-3 antibodies or antigen-binding portions thereof of the invention as described herein.
  • the nucleic acid molecules and vectors may be used to make mutated anti-LAG-3 antibodies.
  • the antibodies may be mutated in the variable domains of the heavy and/or light chains, e.g., to alter a binding property of the antibody.
  • a mutation may be made in one or more of the CDRs o increase or decrease the K D of the anti-LAG-3 antibody, to increase or decrease k 0ff , or to alter the binding specificity of the antibody.
  • one or more mutations are made at an amino acid residue that is known to be changed compared to the germline in a monoclonal antibody of the invention.
  • the mutations may be made in a CDR or framework region of a variable domain, or in a constant region. In a preferred embodiment, the mutations are made in a variable domain. In some embodiments, one or more mutations are made at an amino acid residue that is known to be changed compared to the germline in a CDR or framework region of a variable domain of an antibody or antigen-binding portion thereof of the invention.
  • the framework region(s) are mutated so that the resulting framework region(s) have the amino acid sequence of the corresponding germline gene.
  • a mutation may be made in a framework region or constant region to increase the half-life of the anti-LAG-3 antibody. See, e.g., PCT Publication WO 00/09560.
  • a mutation in a framework region or constant region also can be made to alter the immunogenicity of the antibody, and/or to provide a site for covalent or non-covalent binding to another molecule.
  • a single antibody may have mutations in any one or more of the CDRs or framework regions of the variable domain or in the constant region.
  • the anti-LAG-3 antibodies of the invention or antigen- binding portions thereof are expressed by inserting DNAs encoding partial or full-length light and heavy chains, obtained as described above, into expression vectors such that the genes are operatively linked to necessary expression control sequences such as transcriptional and translational control sequences.
  • Expression vectors include plasmids, retroviruses, adenoviruses, adeno-associated viruses (AAV), plant viruses such as cauliflower mosaic virus, tobacco mosaic virus, cosmids, YACs, EBV derived episomes, and the like.
  • the antibody coding sequence may be ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the antibody coding sequence.
  • the expression vector and expression control sequences may be chosen to be compatible with the expression host cell used.
  • the antibody light chain coding sequence and the antibody heavy chain coding sequence can be inserted into separate vectors, and may be operatively linked to the same or different expression control sequences (e.g., promoters).
  • both coding sequences are inserted into the same expression vector and may be operatively linked to the same expression control sequences (e.g., a common promoter), to separate identical expression control sequences (e.g., promoters), or to different expression control sequences (e.g., promoters).
  • the antibody coding sequences may be inserted into the expression vector by standard methods (e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present).
  • a convenient vector is one that encodes a functionally complete human CH or CL immunoglobulin sequence, with appropriate restriction sites engineered so that any VH or VL sequence can easily be inserted and expressed, as described above.
  • the HC- and LC-encoding genes in such vectors may contain intron sequences that will result in enhanced overall antibody protein yields by stabilizing the related mRNA.
  • the intron sequences are flanked by splice donor and splice acceptor sites, which determine where RNA splicing will occur. Location of intron sequences can be either in variable or constant regions of the antibody chains, or in both variable and constant regions when multiple introns are used. Polyadenylation and transcription termination may occur at native chromosomal sites downstream of the coding regions.
  • the recombinant expression vector also can encode a signal peptide that facilitates secretion of the antibody chain from a host cell.
  • the antibody chain gene may be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the immunoglobulin chain.
  • the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (i.e., a signal peptide from a non-immunoglobulin protein).
  • the recombinant expression vectors of the invention may carry regulatory sequences that control the expression of the antibody chain genes in a host cell. It will be appreciated by those skilled in the art that the design of the expression vector, including the selection of regulatory sequences, may depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
  • Preferred regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from retroviral LTRs, cytomegalovirus (CMV) (such as the CMV promoter/enhancer), Simian Virus 40 (SV40) (such as the SV40 promoter/enhancer), adenovirus, (e.g., the adenovirus major late promoter (AdMLP)), polyoma and strong mammalian promoters such as native immunoglobulin and actin promoters.
  • CMV cytomegalovirus
  • SV40 Simian Virus 40
  • AdMLP adenovirus major late promoter
  • polyoma e.g., the adenovirus major late promoter (AdMLP)
  • AdMLP adenovirus major late promoter
  • polyoma such as native immunoglobulin and actin promoters.
  • recombinant expression vectors of the invention may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see e.g., US Patents 4,399,216,
  • selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced.
  • selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhfr-host cells with methotrexate selection/amplification), the neo gene (for G418 selection), and the glutamate synthetase gene.
  • DHFR dihydrofolate reductase
  • expression control sequence means polynucleotide sequences that are necessary to effect the expression and processing of coding sequences to which they are ligated.
  • Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion.
  • control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence; in eukaryotes, generally, such control sequences include promoters and transcription termination sequence.
  • control sequences is intended to include, at a minimum, all components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
  • An additional aspect of the invention relates to methods for producing the antibody compositions and antibodies and antigen-binding portions thereof of the invention.
  • One embodiment of this aspect of the invention relates to a method for producing an antibody as defined herein, comprising providing a recombinant host cell capable of expressing the antibody, cultivating said host cell under conditions suitable for expression of the antibody, and isolating the resulting antibody.
  • Antibodies produced by such expression in such recombinant host cells are referred to herein as "recombinant antibodies.”
  • the invention also provides progeny cells of such host cells, and antibodies produced by same.
  • recombinant host cell means a cell into which a recombinant expression vector has been introduced.
  • the invention provides host cells that may comprise, e.g., a vector according to the invention described above.
  • the invention also provides host cells that comprise, e.g., a nucleotide sequence encoding the heavy chain or an antigen-binding portion thereof, a nucleotide sequence encoding the light chain or an antigen-binding portion thereof, or both, of an anti-LAG-3 antibody or antigen-binding portion thereof of the invention.
  • Nucleic acid molecules encoding anti-LAG-3 antibodies and vectors comprising these nucleic acid molecules can be used for transfection of a suitable mammalian, plant, bacterial or yeast host cell. Transformation can be by any known method for introducing polynucleotides into a host cell. Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct
  • nucleic acid molecules may be introduced into mammalian cells by viral vectors.
  • Methods of transforming cells are well known in the art. See, e.g., US Patents 4,399,216, 4,912,040, 4,740,461 , and 4,959,455. Methods of transforming plant cells are well known in the art, including, e.g.,
  • Agrobacterium-mediated transformation biolistic transformation, direct injection, electroporation and viral transformation.
  • Methods of transforming bacterial and yeast cells are also well known in the art.
  • Mammalian cell lines available as hosts for expression are well known in the art and include many immortalized cell lines available from the American Type Culture
  • ATCC Chinese hamster ovary
  • NS0 cells NS0 cells
  • SP2 cells HEK-293T cells
  • 293 Freestyle cells Invitrogen
  • NIH-3T3 cells HeLa cells
  • BHK baby hamster kidney
  • COS African green monkey kidney cells
  • human hepatocellular carcinoma cells e.g., Hep G2
  • A549 cells and a number of other cell lines.
  • Cell lines of particular preference are selected by determining which cell lines have high expression levels.
  • Other cell lines that may be used are insect cell lines, such as Sf9 or Sf21 cells.
  • the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown.
  • Antibodies can be recovered from the culture medium using standard protein purification methods.
  • Plant host cells include, e.g., Nicotiana, Arabidopsis, duckweed, corn, wheat, potato, etc.
  • Bacterial host cells include E. coli and Streptomyces species.
  • Yeast host cells include Schizosaccharomyces pombe, Saccharomyces cerevisiae and Pichia pastoris.
  • GS system glutamine synthetase gene expression system
  • EP Patents 0 216 846, 0 256 055, 0 323 997 and 0 338 841 EP Patents 0 216 846, 0 256 055, 0 323 997 and 0 338 841 .
  • Another aspect of the invention is a pharmaceutical composition
  • a pharmaceutical composition comprising as an active ingredient (or as the sole active ingredient) an anti-LAG-3 antibody or antigen- binding portion thereof, bi-specific binding molecule, or antibody composition of the invention.
  • the pharmaceutical composition may comprise any anti-LAG-3 antibody or antigen-binding portion thereof, bi-specific binding molecule, or antibody composition as described herein.
  • the pharmaceutical compositions are intended for amelioration, prevention, and/or treatment of a LAG-3-related disorder and/or cancer.
  • a LAG-3-related or -mediated disorder refers to a disorder, disease or condition that improves, or slows down in its progression, by modulation of LAG-3 activity.
  • the compositions are intended for activation of the immune system. In certain embodiments, the compositions are intended for amelioration, prevention, and/or treatment of cancer originating in tissues such as skin, lung, intestine, colon, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head and neck, liver, bladder, breast, stomach, uterus and pancreas. In certain embodiments, the cancer is
  • the cancer is glioblastoma, gliosarcoma, or colorectal cancer.
  • the pharmaceutical compositions of the invention are intended for treatment of psoriasis.
  • the antibodies, antigen-binding portions, and bi-specific binding molecules of the invention are suitable to be administered as a formulation in association with one or more pharmaceutically acceptable excipient(s), e.g., as described below.
  • compositions of the invention will comprise one or more anti- LAG-3 antibodies, binding portions, or bi-specific binding molecules of the invention, e.g., one or two anti-LAG-3 antibodies, binding portions, or bi-specific binding molecules.
  • the composition comprises a single anti-LAG-3 antibody of the invention or binding portion thereof.
  • the pharmaceutical composition may comprise at least one anti-LAG-3 antibody or antigen-binding portion thereof, e.g., one anti-LAG-3 antibody or portion, and one or more additional antibodies that target one or more relevant cell surface receptors, e.g., one or more cancer-relevant receptors.
  • excipient is used herein to describe any ingredient other than the compound(s) of the invention.
  • excipient(s) will to a large extent depend on factors such as the particular mode of administration, the effect of the excipient on solubility and stability, and the nature of the dosage form.
  • pharmaceutically acceptable excipient includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • Some examples of pharmaceutically acceptable excipients are water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof.
  • isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
  • additional examples of pharmaceutically acceptable substances are wetting agents or minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or
  • compositions of the present invention and methods for their preparation will be readily apparent to those skilled in the art. Such compositions and methods for their preparation may be found, for example, in Remington's Pharmaceutical Sciences, 19th Edition (Mack Publishing Company, 1995). Pharmaceutical compositions are preferably manufactured under GMP (good manufacturing practices) conditions.
  • a pharmaceutical composition of the invention may be prepared, packaged, or sold in bulk, as a single unit dose, or as a plurality of single unit doses.
  • a "unit dose" is a discrete amount of the pharmaceutical composition comprising a
  • the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject or a convenient fraction of such a dosage such as, for example, one-half or one- third of such a dosage.
  • any method for administering peptides, proteins or antibodies accepted in the art may suitably be employed for the antibodies and antigen-binding portions of the invention.
  • parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue, thus generally resulting in the direct administration into the blood stream, into muscle, or into an internal organ.
  • Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like.
  • parenteral administration is contemplated to include, but is not limited to, subcutaneous, intraperitoneal, intramuscular, intrasternal, intravenous, intraarterial, intrathecal, intraventricular, intraurethral, intracranial, intratumoral, and intrasynovial injection or infusions; and kidney dialytic infusion techniques. Regional perfusion is also contemplated. Particular embodiments include the intravenous and the subcutaneous routes.
  • administration typically comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline.
  • a pharmaceutically acceptable carrier such as sterile water or sterile isotonic saline.
  • Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration.
  • injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampoules or in multi-dose containers containing a preservative.
  • Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and the like.
  • Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents.
  • the active ingredient is provided in dry (i.e., powder or granular) form for reconstitution with a suitable vehicle (e.g., sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition.
  • a suitable vehicle e.g., sterile pyrogen-free water
  • Parenteral formulations also include aqueous solutions which may contain excipients such as salts, carbohydrates and buffering agents (preferably to a pH of from 3 to 9), but, for some applications, they may be more suitably formulated as a sterile non-aqueous solution or as a dried form to be used in conjunction with a suitable vehicle such as sterile, pyrogen-free water.
  • parenteral administration forms include solutions or suspensions in sterile aqueous solutions, for example, aqueous propylene glycol or dextrose solutions. Such dosage forms can be suitably buffered, if desired.
  • Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, or in a liposomal preparation.
  • Formulations for parenteral administration may be formulated to be immediate and/or modified release. Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release.
  • sterile injectable solutions can be prepared by incorporating the anti-LAG-3 antibody, antigen-binding portion thereof, bi-specific binding molecule, or antibody composition in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin, and/or by using modified-release coatings (e.g., slow- release coatings).
  • the antibodies of the invention can also be administered intranasally or by inhalation, typically in the form of a dry powder (either alone, as a mixture, or as a mixed component particle, for example, mixed with a suitable pharmaceutically acceptable excipient) from a dry powder inhaler, as an aerosol spray from a pressurised container, pump, spray, atomiser (preferably an atomiser using electrohydrodynamics to produce a fine mist), or nebuliser, with or without the use of a suitable propellant, or as nasal drops.
  • a dry powder either alone, as a mixture, or as a mixed component particle, for example, mixed with a suitable pharmaceutically acceptable excipient
  • atomiser preferably an atomiser using electrohydrodynamics to produce a fine mist
  • nebuliser preferably an atomiser using electrohydrodynamics to produce a fine mist
  • the pressurised container, pump, spray, atomizer, or nebuliser generally contains a solution or suspension of an antibody of the invention comprising, for example, a suitable agent for dispersing, solubilising, or extending release of the active, a propellant(s) as solvent.
  • the drug product Prior to use in a dry powder or suspension formulation, the drug product is generally micronised to a size suitable for delivery by inhalation (typically less than 5 microns). This may be achieved by any appropriate comminuting method, such as spiral jet milling, fluid bed jet milling, supercritical fluid processing to form nanoparticles, high pressure homogenisation, or spray drying.
  • comminuting method such as spiral jet milling, fluid bed jet milling, supercritical fluid processing to form nanoparticles, high pressure homogenisation, or spray drying.
  • Capsules, blisters and cartridges for use in an inhaler or insufflator may be formulated to contain a powder mix of the compound of the invention, a suitable powder base and a performance modifier.
  • a suitable solution formulation for use in an atomiser using electrohydrodynamics to produce a fine mist may contain a suitable dose of the antibody of the invention per actuation and the actuation volume may for example vary from 1 ⁇ _ to 100 ⁇ _.
  • Formulations for inhaled/intranasal administration may be formulated to be immediate and/or modified release.
  • Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release.
  • the dosage unit is determined by means of a valve which delivers a metered amount.
  • Units in accordance with the invention are typically arranged to administer a metered dose or "puff' of an antibody of the invention.
  • the overall daily dose will typically be administered in a single dose or, more usually, as divided doses throughout the day.
  • the antibodies and antibody portions of the invention may also be formulated for an oral route administration. Oral administration may involve swallowing, so that the compound enters the gastrointestinal tract, and/or buccal, lingual, or sublingual
  • Formulations suitable for oral administration include solid, semi-solid and liquid systems such as tablets; soft or hard capsules containing multi- or nano-particulates, liquids, or powders; lozenges (including liquid-filled); chews; gels; fast dispersing dosage forms; films; ovules; sprays; and buccal/mucoadhesive patches.
  • Liquid formulations include suspensions, solutions, syrups and elixirs. Such formulations may be employed as fillers in soft or hard capsules (made, for example, from gelatin or hydroxypropylmethylcellulose) and typically comprise a carrier, for example, water, ethanol, polyethylene glycol, propylene glycol, methylcellulose, or a suitable oil, and one or more emulsifying agents and/or suspending agents. Liquid formulations may also be prepared by the reconstitution of a solid, for example, from a sachet.
  • the anti-LAG-3 antibodies and antigen-binding portions thereof, anti-LAG-3 compositions, and bi-specific binding molecules of the invention are used to enhance or activate the immune system in a human in need thereof.
  • the patient is immune-suppressed.
  • a physician can boost the anti-cancer activity of a patient's own immune system by administering an anti-LAG-3 antibody of the present invention, alone or in combination with other therapeutic agents (sequentially or concurrently).
  • the LAG-3 antibody modulates the activity of LAG-3 in immune cells, resulting in enhancement of anti-cancer immunity.
  • the antibody or antigen-binding portion thereof, composition, or bi-specific binding molecule is for use in the treatment of cancer, e.g., cancers that originate in tissues such as skin, lung, intestine, colon, ovary, brain, prostate, kidney, soft tissues, the hematopoietic system, head and neck, liver, bladder, breast, stomach, uterus and pancreas and any cancers or other conditions which rely on LAG-3 activity and/or in which the patient expresses or overexpresses a LAG-3 ligand (e.g., MHCII, LSECtin, or both).
  • a LAG-3 ligand e.g., MHCII, LSECtin, or both.
  • cancers treated by the anti-LAG-3 antibodies, antigen- binding portions, bi-specific binding molecules, and/or antibody compositions of the invention may include, e.g., melanoma (e.g., advanced or metastatic melanoma), non- small cell lung cancer, head and neck squamous cell cancer, renal cell carcinoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, glioblastoma, glioma, squamous cell lung cancer, small-cell lung cancer, hepatocellular carcinoma, bladder cancer, upper urinary tract cancer, esophageal cancer, gastroesophageal junction cancer, gastric cancer, liver cancer, colon cancer, colorectal carcinoma, multiple myeloma, sarcomas, acute myeloid leukemia, chronic myeloid leukemia, myelodysplastic syndrome, nasopharyngeal cancer, chronic lymphocytic leukemia
  • melanoma
  • lymphoma lymphoma, ovarian cancer, gastrointestinal cancer, primary peritoneal cancer, fallopian tube cancer, urothelial cancer, HTLV-associated T-cell leukemia/lymphoma, prostate cancer, genitourinary cancer, meningioma, adrenocortical cancer, gliosarcoma,
  • fibrosarcoma kidney cancer, breast cancer, pancreatic cancer, endometrial cancer, skin basal cell cancer, cancer of the appendix, biliary tract cancer, salivary gland cancer, advanced Merkel cell cancer, diffuse large B cell lymphoma, follicular lymphoma, mesothelioma, or solid tumors.
  • the cancer may be, e.g., at an early, intermediate, late, or metastatic stage.
  • cancers treated by the anti-LAG-3 antibodies, antigen- binding portions, compositions, and/or bi-specific binding molecules of the invention may include, e.g., hematologic malignancies, glioblastoma (e.g., recurrent glioblastoma), gliosarcoma, non-small cell lung cancer (e.g., advanced non-small cell lung cancer), colorectal cancer, and solid tumors.
  • glioblastoma e.g., recurrent glioblastoma
  • gliosarcoma e.g., non-small cell lung cancer (e.g., advanced non-small cell lung cancer), colorectal cancer, and solid tumors.
  • the anti-LAG-3 antibodies and antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the invention may be used to treat an immune-mediated disorder such as psoriasis, systemic lupus erythematosis, MLS (sclerosis), Crohn's disease, diabetes mellitus, and/or colitis ulcerotis.
  • an immune-mediated disorder such as psoriasis, systemic lupus erythematosis, MLS (sclerosis), Crohn's disease, diabetes mellitus, and/or colitis ulcerotis.
  • the anti-LAG-3 antibodies and antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the invention may be used to treat viral and/or parasitic infections, e.g., where the pathogens inhibit the host immune response.
  • the pathogen may be, e.g., HIV, hepatitis (A, B, or C), human papilloma virus (HPV), lymphocytic choriomeningitis virus (LCMV), adenovirus, flavivirus, echovirus, rhinovirus, coxsackie virus, cornovirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, human T- cell lymphotrophic virus (HTLV), dengue virus, molluscum virus, poliovirus, rabies virus, John Cunningham (JC) virus, arboviral encephalitis virus, simian immunodeficiency virus (SIV), influenza, herpes, Giardia, malaria, Leishmania, Staphylococcus aureus, or
  • HPV human papilloma virus
  • LCMV lymphocytic choriomeningitis virus
  • adenovirus
  • the anti-LAG-3 antibodies and antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the invention may be used to treat a patient who is, or is at risk of being, immunocompromised (e.g., due to chemotherapeutic or radiation therapy).
  • the anti-LAG-3 antibodies and antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the invention may be used for ex vivo activation and expansion of antigen-specific T cells.
  • Treatment refers to a method of alleviating or abrogating a biological disorder and/or at least one of its attendant symptoms.
  • to "alleviate” a disease, disorder or condition means reducing the severity and/or occurrence frequency of the symptoms of the disease, disorder, or condition.
  • references herein to “treatment” include references to curative, palliative and prophylactic treatment.
  • Therapeutically effective amount refers to the amount of the therapeutic agent being administered that will relieve to some extent one or more of the symptoms of the disorder being treated.
  • a therapeutically effective amount of an anti-cancer therapeutic may, for example, result in tumor shrinkage, increased survival, elimination of cancer cells, decreased disease progression, reversal of metastasis, or other clinical endpoints desired by healthcare professionals.
  • anti-LAG-3 antibodies or antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the invention may be administered alone or in combination with one or more other drugs or antibodies (or as any combination thereof).
  • the pharmaceutical compositions, methods and uses of the invention thus also encompass embodiments of combinations (co-administration) with other active agents, as detailed below.
  • co-administration As used herein, the terms “co-administration”, “co-administered” and “in combination with,” referring to the anti-LAG-3 antibodies and antigen-binding portions thereof, antibody compositions, and bi-specific binding molecules of the invention with one or more other therapeutic agents, is intended to mean, and does refer to and include the following:
  • therapeutic agent(s) to a patient in need of treatment, when such components are formulated together into a single dosage form which releases said components at substantially the same time to said patient,
  • the anti-LAG-3 antibodies and antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the invention may be administered without additional therapeutic treatments, i.e., as a stand-alone therapy (monotherapy).
  • treatment with the anti-LAG-3 antibodies and antigen-binding portions thereof, antibody compositions, or bi-specific binding molecules of the invention may include at least one additional therapeutic treatment (combination therapy), e.g., another immunostimulatory agent, an anti-cancer agent, an anti-viral agent, or a vaccine (e.g., a tumor vaccine).
  • additional therapeutic treatment e.g., another immunostimulatory agent, an anti-cancer agent, an anti-viral agent, or a vaccine (e.g., a tumor vaccine).
  • the antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule may be co-administered or formulated with another medication/drug for the treatment of cancer.
  • the additional therapeutic treatment may comprise, e.g., a chemotherapeutic, anti-neoplastic, or anti-angiogenic agent, a different anti-cancer antibody, and/or radiation therapy.
  • Such compounds may, for example, be selected from the group consisting of retinoic acid, trans- retinoic acids, cis-retinoic acids, phenylbutyrate, nerve growth factor, dimethyl sulfoxide, active form vitamin D3, peroxisome proliferator-activated receptor gamma, 12-O- tetradecanoylphorbol 13-acetate, hexamethylene-bis-acetamide, transforming growth factor-beta, butyric acid, cyclic AMP, and vesnarinone.
  • the compound is selected from the group consisting of retinoic acid, phenylbutyrate, all-trans- retinoic acid and active form vitamin D.
  • compositions comprising an anti-LAG-3 antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule of the invention and at least one other agent (e.g., a chemotherapeutic, anti-neoplastic, or anti-angiogenic agent) may be used as a combination treatment for simultaneous, separate or successive administration in cancer therapy.
  • at least one other agent e.g., a chemotherapeutic, anti-neoplastic, or anti-angiogenic agent
  • the other agent may by any agent suitable for treatment of the particular cancer in question, for example, an agent selected from the group consisting of alkylating agents, e.g., platinum derivatives such as cisplatin, carboplatin and/or oxaliplatin; plant alkoids, e.g., paclitaxel, docetaxel and/or irinotecan; antitumor antibiotics, e.g., doxorubicin (adriamycin), daunorubicin, epirubicin, idarubicin
  • alkylating agents e.g., platinum derivatives such as cisplatin, carboplatin and/or oxaliplatin
  • plant alkoids e.g., paclitaxel, docetaxel and/or irinotecan
  • antitumor antibiotics e.g., doxorubicin (adriamycin), daunorubicin, epirubicin, idarubi
  • mitoxantrone dactinomycin, bleomycin, actinomycin, luteomycin, and/or mitomycin
  • topoisomerase inhibitors such as topotecan; and/or antimetabolites, e.g., fluorouracil and/or other fluoropyrimidines.
  • the other agent is dacarbazine or gemcitabine.
  • An anti-LAG-3 antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule of the invention may also be used in combination with other anti-cancer therapies such as vaccines, cytokines, enzyme inhibitors, immunostimulatory compounds, and T cell therapies.
  • a vaccine in the case of a vaccine, it may, e.g., be a protein, peptide or DNA vaccine containing one or more antigens which are relevant for the cancer being treated, or a vaccine comprising dendritic cells along with an antigen.
  • Suitable cytokines include, for example, IL-2, IFN-gamma and GM-CSF.
  • An example of a type of enzyme inhibitor that has anti-cancer activity is an indoleamine-2,3-dioxygenase (IDO) inhibitor, for example 1 -methyl-D-tryptophan (1 -D-MT).
  • IDO indoleamine-2,3-dioxygenase
  • Adoptive T cell therapy refers to various immunotherapy techniques that involve expanding or engineering patients' own T cells to recognize and attack their tumors.
  • an anti-LAG-3 antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule of the invention may be used in adjunctive therapy in connection with tyrosine kinase inhibitors.
  • tyrosine kinase inhibitors synthetic, mainly quinazoline-derived, low molecular weight molecules that interact with the intracellular tyrosine kinase domain of receptors and inhibit ligand-induced receptor phosphorylation by competing for the intracellular Mg-ATP binding site.
  • the antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule may be used in combination with another medication/drug that mediates immune system activation, including, but not limited to, an agent that modulates the expression or activity of A2AR, BTLA, B7-H3, B7-H4, CTLA-4, CD27, CD28, CD40, CD47, CD55, CD73, CD122, CD137, CD160, CGEN-15049, CHK1 , CHK2, CTLA-3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), GAL9, GITR, HVEM, LY108, LAIR1 , ICOS, IDO, KIR, LAIR1 , PD-1/PD-L1/PD-L2, OX40, TIGIT, TIM-3, TGFR- beta, VISTA, LILRB2, CMTM6 and/or 2B4.
  • another medication/drug that mediates immune system activation, including, but not limited to, an agent that
  • the agent is an antibody or an antigen-binding fragment thereof that binds to one of the above molecules. It is also contemplated that an anti-LAG-3 antibody or antigen-binding portion thereof, antibody composition, or bi-specific binding molecule of the invention may be used in combination with a cytokine (e.g., IL-1 , IL-2, IL-12, IL-15 or IL-21 ), an EGFR inhibitor, a VEGF inhibitor, etc.
  • a cytokine e.g., IL-1 , IL-2, IL-12, IL-15 or IL-21
  • an EGFR inhibitor e.g., a VEGF inhibitor, etc.
  • the antibodies and antigen-binding portions, antibody compositions, or bi-specific binding molecules of the invention may be administered in combination with another inhibitor of the LAG-3 pathway, which may target LAG-3 or one or more of its ligands.
  • inhibitors include other anti-LAG-3 antibodies, anti-MHCII antibodies, anti-Galectin-3 antibodies, and anti-LSECtin antibodies.
  • an anti-LAG-3 antibody or antigen-binding portion thereof, bi-specific antibody, or antibody composition of the invention may be administered in combination with BMS-986016, GSK2831781 , REGN3767, BAP050 or BAP050-chi, or LAG525.
  • the antibodies and antigen-binding portions thereof, antibody compositions, and bi-specific binding molecules of the invention may be used in a method of treatment as described herein, may be for use in a treatment as described herein, and/or may be for use in the manufacture of a medicament for a treatment as described herein.
  • the invention also provides kits and articles of manufacture comprising the antibodies and antigen-binding portions thereof, antibody compositions, and bi-specific binding molecules described herein.
  • the antibodies or antigen-binding portions thereof, antibody compositions, or bi- specific binding molecules of the invention will be administered in an effective amount for treatment of the condition in question, i.e., at dosages and for periods of time necessary to achieve a desired result.
  • a therapeutically effective amount may vary according to factors such as the particular condition being treated, the age, sex and weight of the patient, and whether the antibodies are being administered as a stand-alone treatment or in
  • Dosage regimens may be adjusted to provide the optimum desired response. For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the patients/subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of the invention are generally dictated by and directly dependent on (a) the unique characteristics of the chemotherapeutic agent and the particular therapeutic or prophylactic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
  • the dose and dosing regimen are adjusted in accordance with methods well- known in the therapeutic arts. That is, the maximum tolerable dose can be readily established, and the effective amount providing a detectable therapeutic benefit to a patient may also be determined, as can the temporal requirements for administering each agent to provide a detectable therapeutic benefit to the patient. Accordingly, while certain dose and administration regimens are exemplified herein, these examples in no way limit the dose and administration regimen that may be provided to a patient in practicing the present invention.
  • dosage values may vary with the type and severity of the condition to be alleviated, and may include single or multiple doses. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person
  • the dosage regimen with the compositions of this invention may be based on a variety of factors, including the type of disease, the age, weight, sex, medical condition of the patient, the severity of the condition, the route of administration, and the particular antibody employed.
  • the dosage regimen can vary widely, but can be determined routinely using standard methods. For example, doses may be adjusted based on pharmacokinetic or pharmacodynamic parameters, which may include clinical effects such as toxic effects and/or laboratory values.
  • the present invention encompasses intra-patient dose-escalation as determined by the skilled artisan. Determining appropriate dosages and regimens are well-known in the relevant art and would be understood to be encompassed by the skilled artisan once provided the teachings disclosed herein.
  • a suitable dose of an antibody, antigen-binding portion, antibody composition, or bi-specific binding molecule of the invention will be in the range of 0.1 -100 mg/kg, such as about 0.5-50 mg/kg, e.g., about 1 -20 mg/kg.
  • the antibody, antigen-binding portion, antibody composition, or bi-specific binding molecule may for example be administered in a dosage of at least 0.25 mg/kg, e.g., at least 0.5 mg/kg, such as at least 1 mg/kg, e.g., at least 1 .5 mg/kg, such as at least 2 mg/kg, e.g., at least 3 mg/kg, such as at least 4 mg/kg, e.g., at least 5 mg/kg; and e.g., up to at most 50 mg/kg, such as up to at the most 30 mg/kg, e.g., up to at the most 20 mg/kg, such as up to at the most 15 mg/kg.
  • Administration will normally be repeated at suitable intervals, e.g., once every week, once every two weeks, once every three weeks, or once every four weeks, and for as long as deemed appropriate by the responsible doctor, who may optionally increase or decrease the dosage as necessary.
  • An effective amount for tumor therapy may be measured by its ability to stabilize disease progression and/or ameliorate symptoms in a patient, and preferably to reverse disease progression, e.g., by reducing tumor size.
  • the ability of an antibody, antigen- binding portion, antibody composition, or bi-specific binding molecule of the invention to inhibit cancer may be evaluated by in vitro assays, e.g., as described in the examples, as well as in suitable animal models that are predictive of the efficacy in human tumors.
  • Suitable dosage regimens will be selected in order to provide an optimum therapeutic response in each particular situation, for example, administered as a single bolus or as a continuous infusion, and with possible adjustment of the dosage as indicated by the exigencies of each case.
  • the antibodies of the present invention also are useful in diagnostic processes (e.g., in vitro, ex vivo).
  • the antibodies can be used to detect and/or measure the level of LAG-3 in a sample from a patient (e.g., a tissue sample, or a body fluid sample such as an inflammatory exudate, blood, serum, bowel fluid, saliva, or urine).
  • a sample from a patient e.g., a tissue sample, or a body fluid sample such as an inflammatory exudate, blood, serum, bowel fluid, saliva, or urine.
  • Suitable detection and measurement methods include immunological methods such as flow cytometry, enzyme-linked immunosorbent assays (ELISA), chemiluminescence assays, radioimmunoassay, and immunohistology.
  • kits e.g., diagnostic kits comprising the antibodies described herein.
  • Example 1 Generation and screening of anti-LAG-3 antibody repertoires
  • Two anti-LAG-3 antibody repertoires were generated by immunization with LAG-3 extracellular domain (ECD) or LAG-3 ECD Fc fusion protein.
  • ECD LAG-3 extracellular domain
  • One antibody library was prepared from single-cell sorted B cells from immunized OmniRat® rats using SymplexTM antibody discovery technology (Osborn et al., J Immunol. 190(4): 1481 -90 (2013); Meijer et al., J Mol Biol. 358(3): 764-72 (2006)).
  • the expression constructs from this antibody repertoire encoded fully human immunoglobulins in IgGi format carrying two mutations (L234A L235A) known to reduce effector function of the Fc region of Igd antibodies (Hezareh et al., J Virol. 75(24):12161 -8 (2001 )).
  • a second antibody repertoire was constructed using single-cell sorted B cells originating from the lymphoid organs of immunized wild-type chickens (Gall
  • CHO-S cells were transfected in 384-well format to express GPI-anchored human LAG-3 using the FreestyleTM MAX reagent (Invitrogen, Cat. No. 16447-100), and cells transfected with an irrelevant, GPI-anchored control protein were used as a negative control.
  • control cells were labeled using carboxyfluorescein succinimidyl ester (CFSE) and mixed with non-labeled LAG-3-transfected cells at a ratio of 1 to 1 , and a density of 1x10 6 cells per mL.
  • CFSE carboxyfluorescein succinimidyl ester
  • LAG-3-specific primary hits were identified as antibody clones binding to both human and cynomolgus LAG-3-transfected cells (CSFE negative), but not to control cells (CFSE positive), and plate numbers and plate coordinates were collected for hit picking and subsequent sequence analysis.
  • the heavy and light chain variable region DNA and protein sequences of six functional OmniRat®-derived anti-LAG-3 antibodies (15646, 15532, 15723, 15595, 15431 , and 15572) and one functional chicken-derived anti-LAG-3 antibody (1501 1 ; see Example 2) are provided in the sequence list section below.
  • An overview of the SEQ ID numbers of the variable and constant region DNA and protein sequences is provided in Tables 8 and 9. SEQ ID numbers for the CDRs are found in Table 9.
  • the CDR sequences herein were determined according to the IMGT ® definitions for CDR1 and CDR2.
  • the definitions herein include one extra amino acid residue upstream of the IMGT-CDR3 (Cys) and one extra amino acid residue downstream (Trp for H-CDR3, Phe for L-CDR3).
  • Germline gene usage of the six OmniRat®-derived antibodies is shown in Table 10.
  • the antibody VH and VL genes were then aligned against chicken immunoglobulin germline genes to identify somatic mutations in the framework regions that may play a role in antibody function and/or structure. Finally, certain amino acid positions, so-called “Vernier residues” (Nishibori et al., Mol Immunol. 43(6):634-42 (2006)), that are known to play an important role in antibody structure, stability and function, were considered for generating alternative humanized antibody variants including either human or chicken residues from the corresponding germlines.
  • FIG. 1A-C Representative flow cytometry dot plots for antibody clones generated as described in this example are shown in Figures 1A-C: (A) an antibody clone binding specifically to human LAG-3-transfected cells, (B) an antibody clone binding non- specifically to CHO-S cells, and (C) an antibody clone that does not bind to any of the cell populations used in the screening.
  • Example 4 Screening of a panel of LAG -3 specific mAbs in the SEB+PBMC assay
  • SEB Staphylococcal enterotoxin B treated peripheral blood mononuclear cells
  • cytokines including IL-2.
  • Human PBMCs isolated from buffy coats from healthy donors were seeded in 384 well plates and left untreated or treated with 10 ng/mL SEB and 10 g/mL of the antibodies. After 48 hours in a humidified incubator at 37°C, supernatants were removed and analyzed for IL-2 levels using an IL-2 ELISA kit (Life Technologies). [0229] The increase in IL-2 secretion after treatment with the anti-LAG-3 mAb repertoires or the 25F7-Lag3.5 analogue is seen in Figure 2.
  • Example 5 Antibody binding to cell-expressed human or cynomolgus LAG-3
  • CHO-S cells were transiently transfected to express human or cynomolgus LAG-3 using the FreestyleTM MAX reagent (Invitrogen, Cat. No. 16447-100).
  • Antibodies were titrated in 3- fold dilutions down from 10 to 0.05 pg/mL in staining buffer (PBS; 2% FBS; NaN 3 ) and mixed and incubated with either the human or cynomolgus LAG-3-transfected cells. After two washes in staining buffer, cell-bound antibody was revealed by addition of goat anti- human IgG (H+L) AF647 secondary antibody (Molecular Probes, Cat. No. A21445).
  • Samples were obtained using high throughput flow cytometry (iQue® Screener, Intellicyt) and data was analyzed using ForeCyt® software by plotting antibody concentration vs. mean fluorescence intensity (MFI) for AF647. EC50 values were calculated using the "dose response graph" feature in ForeCyt®.
  • Example 6 Flow cytometric analysis of anti-LAG-3 antibodies for MHCII blocking activity
  • This example illustrates how the anti-LAG-3 antibodies were tested for major histocompatibility complex II (MHCII) blocking activity by performing a flow cytometric competition assay using surface-MHCII-positive A375 cells and fluorochrome-labeled soluble LAG-3.
  • MHCII major histocompatibility complex II
  • MHCII blocking activity was investigated in a cell-based assay using the human melanoma cell line A375 (ATCC® CRL-1619TM).
  • R-PE-labeled human LAG-3-Fc chimera protein can specifically bind to surface-expressed MHCII on A375, allowing quantification of this interaction by flow cytometry.
  • Commercially available recombinant human LAG-3- Fc chimera protein (R&D Systems, USA) was conjugated to R-PE using the Lightning- Link® R-Phycoerythrin Conjugation Kit (Innova Biosciences, UK).
  • A375 cells were harvested using enzyme-free Cell Dissociation Buffer (GibcoTM), washed, and re- suspended in cold staining buffer (PBS, 2% FBS, NaN 3 ).
  • Anti-LAG-3 antibodies to be tested were plated in 96-well format and adjusted to 20 g/mL in 50 ⁇ staining buffer. 1 ⁇ L of LAG-3-Fc-PE (corresponding to approx. 0.17 g LAG-3-Fc) was added per well, mixed, and plates were incubated at 4°C for 30 mins to allow LAG-3-antibody complex formation.
  • Staphylococcal enterotoxin B (SEB) treated peripheral blood mononuclear cells (PBMCs) was evaluated.
  • SEB Staphylococcal enterotoxin B treated peripheral blood mononuclear cells
  • This example describes the efficacy of the seven anti-LAG-3 mAbs in several PBMC donors.
  • the efficacy of four anti-LAG-3 mAbs from other sequence clusters is decribed. Sequence cluster numbers are shown in brackets after the antibody numbers and are further decribed in Example 13.
  • the anti-LAG-3 antibodies were tested at 10 or 12.5 g/ml in a SEB+PBMC assay as decribed in Example 4.
  • Example 8 Effect of anti-LAG-3 monoclonal antibodies in cell-based LAG-3-MHC class II blocking assay
  • Luminescence is a measure of luciferase expression, which is controlled by TCR signaling and inhibited by LAG-3 signaling. Thus, less LAG-3 signaling, e.g., by blocking the LAG-3- MHCII interaction, will lead to increased luminescence.
  • 15532, 1501 1 , 25F7-Lag3.5 analogue or BAP050 analogue decreased cellular as well as soluble LAG-3 levels.
  • 15532 decreased cellular LAG-3 levels to a lower level than 25F7- Lag3.5 analogue with statistical significance, and decreased soluble LAG-3 levels to a lower level than 25F7-Lag3.5 analogue and BAP050 analogue with statistical significance.
  • 15431 did not lower either cellular or soluble LAG-3 levels.
  • Example 10 In vivo efficacy of antibody 15011 in two syngeneic murine tumor models
  • mice were randomized into two groups of ten animals and treatment initiated. The mice were treated three times weekly with a total of six treatments by intraperitoneal injection of vehicle buffer or the monoclonal antibody 1501 1 followed by an observation period. The antibody treatments were dosed at 10 mg/kg. Two-way ANOVA with
  • Example 11 In vivo efficacy of antibody 15532 in NOG mice reconstituted with human PBMC and engrafted with human melanoma A375 cells
  • This example demonstrates the in vivo efficacy of antibody 15532 in a semi- humanized xenograft tumor model, where the immune system in NOG mice was reconstituted with human PBMC and the mice engrafted with human melanoma A375 cells.
  • NOG mice were subcutaneously injected with 2-4.5 x 10 6 A375 melanoma cell and received 9 or 12 x 10 6 PBMCs intraperitoneally on study day 2.
  • PBMCs from one donor were used in each experiment. Treatment was initiated at the day of PBMC inoculation and the mice were treated three times weekly with a total of six or nine treatments by intraperitoneal injection of vehicle buffer, or the monoclonal antibody 15532 (10 mg/kg), followed by an observation period. Tumors were measured three times weekly by caliper in two dimensions and tumor volume in mm 3 was calculated according to the formula: (width) 2 x length x 0.5. Two-way ANOVA with Bonferroni's multiple
  • Figure 7 shows results from two experiments using two different human PBMC donors that responded to anti-LAG-3 treatment. Treatment with 15532 resulted in significant tumor growth delay compared to the vehicle treated group [P ⁇ 0.05 (donor 1 ) and P ⁇ 0.001 (donor 2)].
  • Example 12 Measurement of anti-LAG-3 monoclonal antibody affinities towards human, cynomolgus and mouse LAG-3
  • This example demonstrates the binding of anti-LAG-3 antibodies towards human, cynomolgus and mouse LAG-3 extracellular domains as measured by Surface Plasmon Resonance (SPR).
  • the protein sequence of human LAG-3 is available under UniProt Accession No. P18627 (SEQ ID NO: 68).
  • the protein sequence of cynomolgus LAG-3 is available under NCBI Accession No. XP_00557001 1 .1 (SEQ ID NO: 69).
  • the protein sequence of mouse LAG-3 is available under UniProt Accession No. Q61790 (SEQ ID NO: 72).
  • the kinetic binding analysis was performed by Surface Plasmon Resonance (SPR), using a Continuous Flow Microspotter (CFM, Wasatch Microfluidics, Salt Lake City, US) combined with an IBIS MX96 SPR instrument (IBIS Technologies, The Netherlands).
  • SPR Surface Plasmon Resonance
  • CFM Continuous Flow Microspotter
  • IBIS MX96 SPR instrument IBIS Technologies, The Netherlands
  • Anti-LAG-3 Fab antibodies were generated by digesting Igd antibodies with GingisKHAN enzyme, using a kit provided by Genovis (Sweden).
  • cynomolgus LAG-3 were synthesized and each cloned into a vector containing a CMV promoter and a human Igd Fc sequence (AA P101-K330), resulting in fusion of Igd Fc C-terminally to the cloned LAG-3 ECD.
  • the LAG-3 Fc fusion constructs were generated by standard PCR and engineering techniques and protein was expressed transiently in 2 mL culture using an ExpiCHOTM expression system.
  • the human LAG-3 Fc fusion constructs were harvested after 9 days and supernatants were tested for binding affinity to LAG-3 Fab antibodies by SPR.
  • Antigens were purified using standard procedures and captured onto an G-a-hu-lgG Fc SensEye® (Ssens BV, The Netherlands) for 15 minutes using a Continuous Flow Microspotter (CFM, Wasatch Microfluidics, Salt Lake City, US). After spotting, the SensEye® was positioned in the IBIS MX96 biosensor and remaining capture sites blocked. Kinetic analysis was performed by applying a so called kinetic titration series (Karlsson R. 2006), where monomeric Fab fragments of the antibodies of the invention were injected in increasing concentrations from 1 nM to 1000 nM without application of surface regeneration steps after each Fab injection.
  • Fab association was performed for 15 minutes and antigen dissociation was performed for 15 minutes.
  • the recorded binding responses were fitted to a simple Langmuir 1 :1 binding model with Scrubber 2 software for calculation of the on-rate (kon or ka), off-rate (koff or kd) and affinity (K D ) constants.
  • antibodies 15532, 15431 , 15572, 1501 1 and reference antibody analogue 25F7-Lag3.5 bind human and cynomolgus LAG-3 with different affinities.
  • 1501 1 is the only antibody with mouse LAG-3 cross-reactivity.
  • Table 3 The detailed binding kinetics are tabulated in Table 3 below. Table 3. Binding kinetics of anti-LAG-3 Fab fragments to human, cynomolgus and mouse LAG-3 ECD as measured by SPR.
  • Example 13 Epitope binning of anti-LAG-3 antibodies
  • This example illustrates how the anti-LAG-3 antibodies were grouped into epitope bins based on paired competition patterns in a sandwich assay. Antibodies belonging to different epitope bins recognize different epitopes on the LAG-3 ECD.
  • Antibodies were captured onto the anti-Fc sensor surface by spotting for 15 minutes using a Continuous Flow Microspotter. After spotting, the SensEye® was positioned in the IBIS MX96 biosensor and residual anti-Fc sites blocked by injection of 30 g/mL non-specific human IgGi . Captured antibodies were conjugated to the surface using a Fixlt kit (Ssens BV, The Netherlands). After sensor preparation, the immobilized antibodies (ligands) were used to capture monovalent LAG-3 antigen (50 nM, Aero Biosystems, China) in solution when injected over the sensor.
  • the panel of LAG-3 antibodies diluted to 15 g/mL in PBS- T buffer, were injected as analytes one by one over the sensor and tested for binding to captured LAG-3 in a sandwich assay to establish antibody competition patterns.
  • the sensor surface was regenerated with 100 mM H 3 PO 4 buffer, pH 3.0.
  • MAb 15613 (33) was only tested as an analyte and was shown to be blocked by 15723 (39), 15532 (17) and 15646 (15) but not 25F7- Lag3.5. Consequently, although 15532 (17) bound an epitope overlapping with 25F7- Lag3.5, the epitope of 15532 (17) is different from that of 25F7-Lag3.5 due to differences in competition with 15584 (84) and 15613 (33), and these antibodies were consequently assigned to different sub bins. Likewise, other mAbs in epitope bin 2 were assigned to sub bins based on competition patterns with other antibodies in bin 2 ( Figure 8).
  • MAb 15572 (91 ) was only found to cross compete with mAb 15584 (54) and was assigned to a separate bin 3.
  • mAb 15431 (83) was assigned to a separate bin 4, because this antibody only cross competed with mAb 15723 (39).
  • two separate epitope bins containing antibodies with nonfunctional activity were identified.
  • Epitope bin 5 contained cross blocking antibodies 15445 (70) and 15491 (84) and epitope bin 6 contained mAb 15429 (72) that did not cross block any of the antibodies from the panel.
  • Bin 5 antibodies also blocked antibodies 25F7-Lag3.5, 15532 (17) and 15723 (39) from bin 2, when these were tested as analytes (Figure 8).
  • FIG. 9 A summary of the competition patterns for ligand antibodies is shown in Figure 9, where the epitope relatedness of mAbs is shown based on clustering using Euclidean disance. From the cluster diagram it can be observed that antibodies with branching points at x-axis values above zero have different epitopes compared to other antibodies in the tested LAG-3 panel. MAbs 15595 (52), 15613 (33) and 15431 (38) were not included in the cluster analysis, because they did not work as ligands.
  • Antibody epitopes can generally be characterized as linear epitopes (also termed continuous epitopes) or conformational epitopes (also termed discontinuous epitopes). While linear epitopes are defined based on a single continuous amino acid sequence, conformational epitopes may consist of many smaller discontinuous linear sequences or single contact residues. A collection of contact residues that cluster at the intermolecular protein interface between the antibody and the antigen is also termed a hot spot (Moreira et al., Proteins 68(4):803-12 (2007)). It is now widely acknowledged that most B-cell epitopes are discontinuous in nature (Sivalingam and Shepherd, Mol Immunol.
  • this example illustrates how the binding epitopes of the anti-LAG-3 antibodies 15532, 15431 , 15572, and 1501 1 can be divided into linear epitopes and hotspots that are distinct from the epitope recognized by the reference antibody 25F7-Lag3.5 analogue.
  • Human LAG-3 receptor (CD223) is a 525 amino acid (AA) transmembrane protein that comprises an extracellular domain (ECD) of 427 amino acids (residues 23 - 450) followed by a transmembrane domain (residues 451 - 471 ) and a cytoplasmic domain (residues 472 - 525).
  • LAG-3 ECD contains 4 immunoglobulin domains (D1 -D4) where the first domain, an IgV-type domain, is involved in ligand binding (MHCII binding) and the remaining three domains are lgC2 type domains.
  • Domain 1 contains an additional unique stretch of 30 amino acids (extra loop) that is not found in other IgV-domains and that has been shown to be essential for ligand binding.
  • Amino acids (AA) 99, 1 10, 125, 131 and 137 have also been identified as important for ligand binding (Y77, R88, R103, D109, R1 15 in the mature protein) (Huard et al, supra; Andrews et al., supra). There is no published structure for LAG-3. However, sequence and evolutionary homology between LAG-3 and CD4 have been identified, thus allowing access to structural information on LAG-3 based on homology modeling of CD4 (Huard et al., supra; Andrews et al., supra).
  • LAG-3 cDNA coding for domains 1 and 2 of the human LAG-3 extracellular domain was gene synthesized and cloned into a vector containing CMV promoter and human Igd Fc sequence (AA P101-K330), resulting in expression of a LAG domain 1 -2 Fc fusion protein.
  • the mutated human LAG-3 Fc fusion constructs were generated by standard PCR and engineering techniques and protein was expressed transiently in 2 ml culture using an ExpiCHOTM expression system.
  • the human LAG-3 Fc fusion constructs were harvested, purified and tested for binding affinity to anti-LAG-3 mAbs by Surface Plasmon Resonance (SPR).
  • SPR Surface Plasmon Resonance
  • the binding affinities of Fab fragments of anti-LAG-3 antibodies 15532, 15431 , 15572, 1501 1 and the reference antibody 25F7-Lag3.5 analogue were evaluated with respect to altered binding to LAG-3 mutant constructs.
  • the binding affinities of Fab fragments binding to the mutated LAG-3 constructs were expressed as the ratio between KD mutant / KD wildtype (normalized binding affinity).
  • Tables 5 and 6 below show the normalized binding affinities to all tested chimeric proteins and for the alanine scanning experiments, respectively.
  • a cut-off of at least 5-fold affinity reduction was employed as a criterion for detecting significantly reduced binding affinity to mutated LAG-3 constructs. In some instances, no binding could be detected to specific antibodies. These constructs are listed as not binding (N.B.).
  • the AA region 98-105 proved to be a unique shared epitope between 15532, 15431 , 15572 and 1501 1 .
  • the 25F7-Lag3.5 analogue did not bind this epitope.
  • the antibody 15431 also had a linear epitope in segments AA 123-131 , 128-137 and 148-154. Interestingly, positions 125, 131 and 137 have previously been shown to be important for ligand binding (Huard et al, supra).
  • Antibody 1501 1 contained a linear epitope defined by a chimeric construct with mutations in the range from AA 98-105, and alanine scanning further extended the unique epitope to include contact residues at positions G107, L109, R1 10 and S1 1 1 .
  • R1 10 has been shown to be important for ligand binding (Huard et al, supra).
  • the amino acid sequence is well conserved in this region (AA 98-1 13) between human, cynomolgus, mouse and rat orthologues, explaining the cross-reactivity of this antibody to mouse and cynomolgus monkey LAG-3 (Example 12).
  • a summary of the collected epitope mapping findings is shown in Table 7 below.
  • the assigned epitope bins match well the epitope mapping that revealed that each antibody showed unique differentiated epitopes (Table 7).
  • the epitope data including chimeric construct #28 also corroborated well with the binding affinity analysis (Example 12) in which 15532 showed significant binding to cynomolgus LAG-3 and 25F7-Lag3.5 did not - reflecting different properties of the antibodies due to differentiated contact residues.
  • Table 5 Summary of binding affinity analysis for Fab fragments of anti-LAG-3 antibodies binding mutated LAG-3 ECD constructs with inserted rat, dog or cynomolgus sequence segments. Normalized binding expressed as K D mutant / K D wild type.
  • Table 6 Summary of binding affinity analysis for Fab fragments of anti-LAG-3 antibodies binding point mutation scanned human LAG-3. Normalized binding expressed as K D mutant / K D wild type.
  • CDRs Connplennentanty deternnining regions
  • SEQ ID NO: 2 (15646 VL DNA sequence)
  • SEQ ID NO: 4 (15646 VL protein sequence)
  • SEQ ID NO: 7 (15532 VH protein sequence)
  • SEQ ID NO: 1 1 (15723 VH protein sequence)
  • SEQ ID NO: 12 (15723 VL protein sequence)
  • SEQ ID NO: 15 (15595 VH protein sequence) QVQLVQSGAEVKKPGASVKVSCKVSGYSLTEIS HWVRQAPGKGLEW GGFDPEDGETIYAQRF QGRVI TEDTSTDTAY ELSSLRSEDTAVYYCATGGWGPNWFDPWGQGTLVTVSS
  • SEQ ID NO: 18 (15431 VL DNA sequence)
  • SEQ ID NO: 20 (15431 VL protein sequence)
  • SEQ ID NO: 23 (15572 VH protein sequence) QLQLQESGPGLVKPSETLSLTCTVSGDSISSSSYYWGWIRQPPGKGLEWIGSIFYSGNTYYNPS LKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAREDDFLTDYYGAFDIWGQGT VTVSS
  • SEQ ID NO: 24 (15572 VL protein sequence)
  • SEQ ID NO: 25 (1501 1 VH DNA sequence)
  • SEQ ID NO: 26 (1501 1 VL DNA sequence)
  • SEQ ID NO: 27 (1501 1 VH protein sequence)
  • SEQ ID NO: 28 (1501 1 VL protein sequence)
  • SEQ ID NO: 29 (IgHC constant region DNA sequence)
  • SEQ ID NO: 30 (IgHC constant region protein sequence)
  • SEQ ID NO: 31 (IgLC constant region DNA sequence)
  • SEQ ID NO: 32 (IgLC constant region protein sequence)
  • SEQ ID NO: 33 IgKC constant region DNA sequence
  • SEQ ID NO: 34 IgKC constant region protein sequence
  • SEQ ID NO: 62 (1501 1 H-CDR1 )
  • SEQ ID NO: 65 (1501 1 L-CDR1 )
  • SEQ ID NO: 70 (rat LAG-3)
  • SEQ ID NO: 72 (mouse LAG-3)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Dermatology (AREA)
  • Mycology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/EP2017/076188 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions Ceased WO2018069500A2 (en)

Priority Applications (28)

Application Number Priority Date Filing Date Title
MYPI2019001727A MY203971A (en) 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions
CA3039140A CA3039140A1 (en) 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions
NZ752044A NZ752044A (en) 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions
TNP/2019/000099A TN2019000099A1 (en) 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions
EA201990912A EA201990912A1 (ru) 2016-10-13 2017-10-13 Анти-lag-3 антитела и их композиции
AU2017342071A AU2017342071B2 (en) 2016-10-13 2017-10-13 Anti-LAG-3 antibodies and compositions
PE2019000815A PE20190911A1 (es) 2016-10-13 2017-10-13 Composiciones y anticuerpos anti-lag-3
US16/340,855 US11390676B2 (en) 2016-10-13 2017-10-13 Anti-LAG-3 antibodies and compositions
IL265844A IL265844B2 (en) 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions
KR1020237032304A KR102846713B1 (ko) 2016-10-13 2017-10-13 항-lag-3 항체 및 조성물
KR1020197012672A KR102583190B1 (ko) 2016-10-13 2017-10-13 항-lag-3 항체 및 조성물
EP17791987.5A EP3526255A2 (en) 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions
PH1/2019/500668A PH12019500668B1 (en) 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions
CN202311394766.8A CN117567622A (zh) 2016-10-13 2017-10-13 抗lag-3抗体及组合物
RU2019113790A RU2755503C2 (ru) 2016-10-13 2017-10-13 Анти-lag-3 антитела и их композиции
BR112019006876-7A BR112019006876A2 (pt) 2016-10-13 2017-10-13 anticorpos e composições anti-lag-3
JP2019520053A JP7212821B2 (ja) 2016-10-13 2017-10-13 抗lag-3抗体および組成物
CN202311388116.2A CN117567621A (zh) 2016-10-13 2017-10-13 抗lag-3抗体及组合物
CN201780074499.2A CN110062766B (zh) 2016-10-13 2017-10-13 抗lag-3抗体及组合物
UAA201904924A UA127050C2 (uk) 2016-10-13 2017-10-13 Ahtи-lag-3 антитіло i композиція, що містить його
MX2019004241A MX2019004241A (es) 2016-10-13 2017-10-13 Composiciones y anticuerpos anti-gen 3 de activacion de linfocitos (lag-3).
CN202311395764.0A CN117567623A (zh) 2016-10-13 2017-10-13 抗lag-3抗体及组合物
ZA2019/01924A ZA201901924B (en) 2016-10-13 2019-03-28 Anti¿lag¿3 antibodies and compositions
SA519401522A SA519401522B1 (ar) 2016-10-13 2019-04-10 Lag-3 أجـسـام مـضـادة لـ وتـركـيـبـات
CONC2019/0004003A CO2019004003A2 (es) 2016-10-13 2019-04-23 Composiciones y anticuerpos anti-lag-3
US17/834,497 US11834503B2 (en) 2016-10-13 2022-06-07 Anti-lag-3 antibodies and compositions
JP2022195869A JP7488323B2 (ja) 2016-10-13 2022-12-07 抗lag-3抗体および組成物
US18/490,500 US20240052032A1 (en) 2016-10-13 2023-10-19 Anti-lag-3 antibodies and compositions

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662407678P 2016-10-13 2016-10-13
US62/407,678 2016-10-13

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US16/340,855 A-371-Of-International US11390676B2 (en) 2016-10-13 2017-10-13 Anti-LAG-3 antibodies and compositions
US17/834,497 Continuation US11834503B2 (en) 2016-10-13 2022-06-07 Anti-lag-3 antibodies and compositions
US17/834,497 Division US11834503B2 (en) 2016-10-13 2022-06-07 Anti-lag-3 antibodies and compositions

Publications (2)

Publication Number Publication Date
WO2018069500A2 true WO2018069500A2 (en) 2018-04-19
WO2018069500A3 WO2018069500A3 (en) 2019-01-03

Family

ID=60201531

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/076188 Ceased WO2018069500A2 (en) 2016-10-13 2017-10-13 Anti-lag-3 antibodies and compositions

Country Status (26)

Country Link
US (3) US11390676B2 (https=)
EP (1) EP3526255A2 (https=)
JP (2) JP7212821B2 (https=)
KR (2) KR102846713B1 (https=)
CN (4) CN110062766B (https=)
AU (1) AU2017342071B2 (https=)
BR (1) BR112019006876A2 (https=)
CA (1) CA3039140A1 (https=)
CL (1) CL2019000979A1 (https=)
CO (1) CO2019004003A2 (https=)
EA (1) EA201990912A1 (https=)
IL (1) IL265844B2 (https=)
MA (1) MA46525A (https=)
MX (1) MX2019004241A (https=)
MY (1) MY203971A (https=)
NZ (2) NZ752044A (https=)
PE (1) PE20190911A1 (https=)
PH (1) PH12019500668B1 (https=)
RU (1) RU2755503C2 (https=)
SA (1) SA519401522B1 (https=)
SG (1) SG10201912940WA (https=)
TN (1) TN2019000099A1 (https=)
TW (1) TWI784976B (https=)
UA (1) UA127050C2 (https=)
WO (1) WO2018069500A2 (https=)
ZA (1) ZA201901924B (https=)

Cited By (62)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018222722A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising an anti-lag-3 antibody or an anti-lag-3 antibody and an anti-pd-1 or anti-pd-l1 antibody
WO2018222711A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
WO2018222718A1 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
WO2020023707A1 (en) 2018-07-26 2020-01-30 Bristol-Myers Squibb Company Lag-3 combination therapy for the treatment of cancer
WO2020081928A1 (en) 2018-10-19 2020-04-23 Bristol-Myers Squibb Company Combination therapy for melanoma
WO2020232019A1 (en) 2019-05-13 2020-11-19 Regeneron Pharmaceuticals, Inc. Combination of pd-1 inhibitors and lag-3 inhibitors for enhanced efficacy in treating cancer
US10844119B2 (en) 2016-10-11 2020-11-24 Agenus Inc. Anti-LAG-3 antibodies and methods of use thereof
WO2020243570A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Cell localization signature and combination therapy
WO2020243568A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Methods of identifying a subject suitable for an immuno-oncology (i-o) therapy
WO2020243563A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Multi-tumor gene signatures for suitability to immuno-oncology therapy
CN112166125A (zh) * 2018-06-19 2021-01-01 信达生物制药(苏州)有限公司 全人源的抗lag-3抗体及其应用
IT201900011676A1 (it) * 2019-07-12 2021-01-12 St Superiore Di Sanita Anticorpo ricombinante umano contro il recettore di membrana LAG3, suoi usi medici e diagnostici.
WO2021025177A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021055994A1 (en) 2019-09-22 2021-03-25 Bristol-Myers Squibb Company Quantitative spatial profiling for lag-3 antagonist therapy
WO2021092380A1 (en) 2019-11-08 2021-05-14 Bristol-Myers Squibb Company Lag-3 antagonist therapy for melanoma
WO2021092220A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092221A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021158938A1 (en) 2020-02-06 2021-08-12 Bristol-Myers Squibb Company Il-10 and uses thereof
JP2021522347A (ja) * 2018-05-03 2021-08-30 シャンハイ エピムアブ バイオセラピューティクス カンパニー リミテッド Pd−1およびlag−3に対する高親和性抗体ならびにそれらから作製された二重特異性結合タンパク質
WO2022008519A1 (en) 2020-07-07 2022-01-13 BioNTech SE Therapeutic rna for hpv-positive cancer
WO2022047412A1 (en) 2020-08-31 2022-03-03 Bristol-Myers Squibb Company Cell localization signature and immunotherapy
WO2022047189A1 (en) 2020-08-28 2022-03-03 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hepatocellular carcinoma
JP2022523929A (ja) * 2019-02-28 2022-04-27 三生国健薬業(上海)股▲ふん▼有限公司 ヒトlag-3に結合する抗体、その製造方法および用途
WO2022087402A1 (en) 2020-10-23 2022-04-28 Bristol-Myers Squibb Company Lag-3 antagonist therapy for lung cancer
WO2022120179A1 (en) 2020-12-03 2022-06-09 Bristol-Myers Squibb Company Multi-tumor gene signatures and uses thereof
WO2022136257A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022136266A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022146947A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
WO2022146948A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Subcutaneous administration of pd1/pd-l1 antibodies
US20220227887A1 (en) * 2019-06-11 2022-07-21 Ono Pharmaceutical Co., Ltd. Immunosuppressant
WO2022165214A1 (en) 2021-01-29 2022-08-04 Board Of Regents, The University Of Texas System Methods of treating cancer with kinase inhibitors
WO2022212400A1 (en) 2021-03-29 2022-10-06 Juno Therapeutics, Inc. Methods for dosing and treatment with a combination of a checkpoint inhibitor therapy and a car t cell therapy
WO2022240741A1 (en) 2021-05-12 2022-11-17 Dana-Farber Cancer Institute, Inc. Lag3 and gal3 inhibitory agents, xbp1, cs1, and cd138 peptides, and methods of use thereof
WO2023285552A1 (en) 2021-07-13 2023-01-19 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
WO2023061930A1 (en) 2021-10-11 2023-04-20 BioNTech SE Therapeutic rna for lung cancer
WO2023077090A1 (en) 2021-10-29 2023-05-04 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hematological cancer
WO2023147371A1 (en) 2022-01-26 2023-08-03 Bristol-Myers Squibb Company Combination therapy for hepatocellular carcinoma
WO2023164638A1 (en) 2022-02-25 2023-08-31 Bristol-Myers Squibb Company Combination therapy for colorectal carcinoma
WO2023168404A1 (en) 2022-03-04 2023-09-07 Bristol-Myers Squibb Company Methods of treating a tumor
WO2023170606A1 (en) 2022-03-08 2023-09-14 Alentis Therapeutics Ag Use of anti-claudin-1 antibodies to increase t cell availability
WO2023178329A1 (en) 2022-03-18 2023-09-21 Bristol-Myers Squibb Company Methods of isolating polypeptides
WO2023235847A1 (en) 2022-06-02 2023-12-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
EP4319755A1 (en) 2021-04-08 2024-02-14 Board of Regents, The University of Texas System Compounds and methods for theranostic targeting of parp activity
US11939380B2 (en) 2017-04-05 2024-03-26 Les Laboratoires Servier Combination therapies targeting PD-1, TIM-3, and LAG-3
WO2024116140A1 (en) 2022-12-01 2024-06-06 Medimmune Limited Combination therapy for treatment of cancer comprising anti-pd-l1 and anti-cd73 antibodies
WO2024126457A1 (en) 2022-12-14 2024-06-20 Astellas Pharma Europe Bv Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and immune checkpoint inhibitors
WO2024137776A1 (en) 2022-12-21 2024-06-27 Bristol-Myers Squibb Company Combination therapy for lung cancer
WO2024163477A1 (en) 2023-01-31 2024-08-08 University Of Rochester Immune checkpoint blockade therapy for treating staphylococcus aureus infections
WO2024192033A1 (en) 2023-03-13 2024-09-19 Regeneron Pharmaceuticals, Inc. Combination of pd-1 inhibitors and lag-3 inhibitors for enhanced efficacy in treating melanoma
WO2024196952A1 (en) 2023-03-20 2024-09-26 Bristol-Myers Squibb Company Tumor subtype assessment for cancer therapy
WO2025038763A1 (en) 2023-08-15 2025-02-20 Bristol-Myers Squibb Company Ceramic hydroxyapatite chromatography flow through method
WO2025106736A2 (en) 2023-11-15 2025-05-22 Regeneron Pharmaceuticals, Inc. Combination of pd-1 inhibitors and lag-3 inhibitors for enhanced efficacy in treating lung cancer
WO2025121445A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025120866A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025120867A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent
WO2025184208A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibodies and uses thereof
WO2025184211A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibody drug conjugates
WO2025245489A1 (en) 2024-05-24 2025-11-27 Bristol-Myers Squibb Company Treatment of tumors in subjects having fgl-1 positive samples
WO2026035866A1 (en) 2024-08-07 2026-02-12 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with a lag-3 inhibitor and a pd-1 inhibitor
WO2026033885A1 (en) 2024-08-08 2026-02-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PH12019500668B1 (en) * 2016-10-13 2023-12-06 Chia Tai Tianqing Pharmaceutical Group Co Ltd Anti-lag-3 antibodies and compositions
WO2019165982A1 (en) 2018-02-28 2019-09-06 WuXi Biologics Ireland Limited Monoclonal antibody against human lag-3, method for preparing same, and use thereof
CN115057931B (zh) * 2018-02-28 2025-08-22 广州誉衡生物科技有限公司 抗人lag-3抗体及其用途
UA130408C2 (uk) * 2019-09-06 2026-02-11 Ле Лаборатуар Сервьє Антитіла до cd73
KR20220164548A (ko) * 2020-04-03 2022-12-13 소렌토 쎄라퓨틱스, 인코포레이티드 Lag3에 결합하는 조작된 항체
CN114605544B (zh) * 2020-06-05 2023-08-01 北京天广实生物技术股份有限公司 Lag3抗体及其用途
AU2022314734A1 (en) 2021-07-19 2024-02-08 Regeneron Pharmaceuticals, Inc. Il12 receptor agonists and methods of use thereof
KR20240046251A (ko) 2021-08-16 2024-04-08 리제너론 파아마슈티컬스, 인크. 신규 il27 수용체 효능제 및 그의 사용 방법
KR20250024872A (ko) 2022-05-11 2025-02-19 리제너론 파마슈티칼스 인코포레이티드 다중특이적 결합 분자 전구단백질 및 이의 용도
CA3257348A1 (en) 2022-05-27 2023-11-30 Regeneron Pharmaceuticals, Inc. INTERLEUKIN-2 PROPROTEINS AND THEIR USES
CA3258187A1 (en) 2022-06-04 2023-12-07 Regeneron Pharmaceuticals, Inc. INTERLEUKIN-2 PROPROTEINS AND THEIR USES
US20240067691A1 (en) 2022-08-18 2024-02-29 Regeneron Pharmaceuticals, Inc. Interferon receptor agonists and uses thereof
CN120051483A (zh) 2022-08-18 2025-05-27 再生元制药公司 干扰素前蛋白及其用途
IL322055A (en) 2023-01-13 2025-09-01 Regeneron Pharma IL12 receptor agonists and methods of using them
JP2026507123A (ja) 2023-02-28 2026-02-27 リジェネロン・ファーマシューティカルズ・インコーポレイテッド T細胞活性化剤およびその使用方法
CN121889167A (zh) * 2023-09-13 2026-04-17 正大天晴药业集团股份有限公司 包含抗pd-1抗体和第二抗体的药物组合物
CN117159703B (zh) * 2023-11-02 2024-04-02 正大天晴(广州)医药有限公司 含抗lag-3抗体的药物组合物及其用途
WO2025106469A1 (en) 2023-11-14 2025-05-22 Regeneron Pharmaceuticals, Inc. Engineered heavy chain variable domains and uses thereof
WO2025122614A1 (en) 2023-12-05 2025-06-12 Regeneron Pharmaceuticals, Inc. Il18 receptor agonists and methods of use thereof
WO2025199243A1 (en) 2024-03-20 2025-09-25 Regeneron Pharmaceuticals, Inc. Trivalent multispecific binding molecules and methods of use thereof
WO2025255480A1 (en) 2024-06-07 2025-12-11 Regeneron Pharmaceuticals, Inc. Tetravalent multispecific binding molecules and methods of use thereof

Citations (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4510245A (en) 1982-11-18 1985-04-09 Chiron Corporation Adenovirus promoter system
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
EP0216846A1 (en) 1985-04-01 1987-04-08 Celltech Ltd Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same.
EP0256055A1 (en) 1986-01-23 1988-02-24 Celltech Ltd RECOMBINANT DNA SEQUENCES, THESE VECTORS, AND METHODS OF USE THEREOF.
US4740461A (en) 1983-12-27 1988-04-26 Genetics Institute, Inc. Vectors and methods for transformation of eucaryotic cells
EP0323997A1 (en) 1987-07-23 1989-07-19 Celltech Limited Recombinant dna expression vectors
EP0338841A1 (en) 1988-04-18 1989-10-25 Celltech Limited Recombinant DNA methods, vectors and host cells
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
US4959455A (en) 1986-07-14 1990-09-25 Genetics Institute, Inc. Primate hematopoietic growth factors IL-3 and pharmaceutical compositions
US4968615A (en) 1985-12-18 1990-11-06 Ciba-Geigy Corporation Deoxyribonucleic acid segment from a virus
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6517529B1 (en) 1999-11-24 2003-02-11 Radius International Limited Partnership Hemodialysis catheter
US20140093511A1 (en) 2012-07-02 2014-04-03 Bristol-Myers Squibb Company Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof
WO2015138920A1 (en) 2014-03-14 2015-09-17 Novartis Ag Antibody molecules to lag-3 and uses thereof

Family Cites Families (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2189657C (fr) * 1994-05-06 2002-03-12 Florence Faure Fractions polypeptidiques solubles de la proteine lag-3; procede de production; composition therapeutique; anticorps anti-idiotype
JP2003531588A (ja) 2000-04-11 2003-10-28 ジェネンテック・インコーポレーテッド 多価抗体とその用途
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
EP1987839A1 (en) * 2007-04-30 2008-11-05 I.N.S.E.R.M. Institut National de la Sante et de la Recherche Medicale Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease
US9244059B2 (en) * 2007-04-30 2016-01-26 Immutep Parc Club Orsay Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease
AR072999A1 (es) 2008-08-11 2010-10-06 Medarex Inc Anticuerpos humanos que se unen al gen 3 de activacion linfocitaria (lag-3) y los usos de estos
EP2566512A1 (en) * 2010-05-04 2013-03-13 Merrimack Pharmaceuticals, Inc. Antibodies against epidermal growth factor receptor (egfr) and uses thereof
JO3532B1 (ar) * 2013-03-13 2020-07-05 Regeneron Pharma الأجسام المضادة لمضاد انترلوكين-33 واستعمالاتها
US10344088B2 (en) 2013-03-15 2019-07-09 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins
JP6595458B2 (ja) 2013-09-20 2019-10-23 ブリストル−マイヤーズ スクイブ カンパニー 腫瘍を処置するための抗lag−3抗体と抗pd−1抗体との組合せ
WO2015048312A1 (en) 2013-09-26 2015-04-02 Costim Pharmaceuticals Inc. Methods for treating hematologic cancers
JO3663B1 (ar) 2014-08-19 2020-08-27 Merck Sharp & Dohme الأجسام المضادة لمضاد lag3 وأجزاء ربط الأنتيجين
MA41463A (fr) 2015-02-03 2017-12-12 Anaptysbio Inc Anticorps dirigés contre le gène d'activation 3 des lymphocytes (lag-3)
TWI773646B (zh) 2015-06-08 2022-08-11 美商宏觀基因股份有限公司 結合lag-3的分子和其使用方法
RS61510B1 (sr) 2016-05-18 2021-03-31 Boehringer Ingelheim Int Anti pd-1 i anti-lag3 antitela za lečenje kancera
PH12019500668B1 (en) * 2016-10-13 2023-12-06 Chia Tai Tianqing Pharmaceutical Group Co Ltd Anti-lag-3 antibodies and compositions
UA129904C2 (uk) 2017-04-05 2025-09-10 Ле Лаборатуар Сервьє Комбінація антитіла до tim-3 й антитіла до pd-1 для лікування раку

Patent Citations (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4510245A (en) 1982-11-18 1985-04-09 Chiron Corporation Adenovirus promoter system
US4740461A (en) 1983-12-27 1988-04-26 Genetics Institute, Inc. Vectors and methods for transformation of eucaryotic cells
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
EP0216846A1 (en) 1985-04-01 1987-04-08 Celltech Ltd Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same.
US4968615A (en) 1985-12-18 1990-11-06 Ciba-Geigy Corporation Deoxyribonucleic acid segment from a virus
EP0256055A1 (en) 1986-01-23 1988-02-24 Celltech Ltd RECOMBINANT DNA SEQUENCES, THESE VECTORS, AND METHODS OF USE THEREOF.
US4959455A (en) 1986-07-14 1990-09-25 Genetics Institute, Inc. Primate hematopoietic growth factors IL-3 and pharmaceutical compositions
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
EP0323997A1 (en) 1987-07-23 1989-07-19 Celltech Limited Recombinant dna expression vectors
EP0338841A1 (en) 1988-04-18 1989-10-25 Celltech Limited Recombinant DNA methods, vectors and host cells
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6517529B1 (en) 1999-11-24 2003-02-11 Radius International Limited Partnership Hemodialysis catheter
US20140093511A1 (en) 2012-07-02 2014-04-03 Bristol-Myers Squibb Company Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof
WO2015138920A1 (en) 2014-03-14 2015-09-17 Novartis Ag Antibody molecules to lag-3 and uses thereof

Non-Patent Citations (35)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences, 19th Edition", 1995, MACK PUBLISHING COMPANY
ALMAGRO; FRANSSON, FRONT BIOSCI., vol. 13, 2008, pages 1619 - 1633
ANDREWS ET AL., IMMUNOL REV., vol. 276, no. 1, 2017, pages 80 - 96
ANGAL ET AL., MOL. IMMUNOL., vol. 30, 1993, pages 105 - 108
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BURKS ET AL., PROC NATL ACAD SCI USA, vol. 94, 1997, pages 412 - 417
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
HEZAREH ET AL., J VIROL., vol. 75, no. 24, 2001, pages 12161 - 8
HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HUARD ET AL., PROC NATL ACAD SCI USA, vol. 94, 1997, pages 5744 - 5749
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
III ET AL., PROTEIN ENG., vol. 10, 1997, pages 949 - 57
JONES ET AL., NATURE, vol. 321, no. 6069, 1986, pages 522 - 5
KABAT: "Sequences of Proteins of Immunological Interest", 1987, NATIONAL INSTITUTES OF HEALTH, BETHESDA
KIPRIYANOV ET AL., HUMAN ANTIBODIES AND HYBRIDOMAS, vol. 6, 1995, pages 93 - 101
KIPRIYANOV ET AL., MOL. IMMUNOL., vol. 31, 1994, pages 1047 - 1058
KRINGELUM ET AL., MOL IMMUNOL., vol. 53, no. 1-2, 2013, pages 24 - 34
LEFRANC ET AL., DEV COMP IMMUNOL, vol. 27, no. 1, 2003, pages 55 - 77
LEFRANC ET AL., DEV. COMP IMMUNOL., vol. 27, 2003, pages 55 - 77
MAGDELAINE-BEUZELIN ET AL., CRIT REV.ONCOL HEMATOL., vol. 64, 2007, pages 210 - 225
MARTIN ET AL., EMBO J., vol. 13, 1994, pages 5303 - 9
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
MEIJER ET AL., J MOL BIOL., vol. 358, no. 3, 2006, pages 764 - 72
MOREIRA ET AL., PROTEINS, vol. 68, no. 4, 2007, pages 803 - 12
NISHIBORI ET AL., MOL IMMUNOL., vol. 43, no. 6, 2006, pages 634 - 42
OSBORN ET AL., J IMMUNOL., vol. 190, no. 4, 2013, pages 1481 - 90
PEARSON, J. MOL. BIOL., vol. 276, 1998, pages 71 - 84
PEARSON, METHODS ENZYMOL., vol. 183, 1990, pages 63 - 98
PEARSON, METHODS ENZYMOL., vol. 266, 1996, pages 227 - 258
PEARSON, METHODS MOL. BIOL., vol. 132, 2000, pages 185 - 219
SIVALINGAM; SHEPHERD, MOL IMMUNOL., vol. 51, no. 3-4, 2012, pages 304 - 92012
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 - 3659
TRAUNECKER ET AL., INT. J. CANCER, vol. 7, 1992, pages 51 - 52
WU ET AL., PROC NATL ACAD SCI USA, vol. 95, 1998, pages 6037 - 6042

Cited By (81)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11993651B2 (en) 2016-10-11 2024-05-28 Agenus Inc. Anti-lag-3 antibodies and methods of use thereof
US12187795B2 (en) 2016-10-11 2025-01-07 Agenus Inc. Anti-LAG-3 antibodies and methods of use thereof
US10882908B2 (en) 2016-10-11 2021-01-05 Agenus Inc. Anti-LAG-3 antibodies and methods of use thereof
US10844119B2 (en) 2016-10-11 2020-11-24 Agenus Inc. Anti-LAG-3 antibodies and methods of use thereof
US11939380B2 (en) 2017-04-05 2024-03-26 Les Laboratoires Servier Combination therapies targeting PD-1, TIM-3, and LAG-3
WO2018222722A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising an anti-lag-3 antibody or an anti-lag-3 antibody and an anti-pd-1 or anti-pd-l1 antibody
US11723975B2 (en) 2017-05-30 2023-08-15 Bristol-Myers Squibb Company Compositions comprising an anti-LAG-3 antibody or an anti-LAG-3 antibody and an anti-PD-1 or anti-PD-L1 antibody
US12049503B2 (en) 2017-05-30 2024-07-30 Bristol-Myers Squibb Company Treatment of LAG-3 positive tumors
US11807686B2 (en) 2017-05-30 2023-11-07 Bristol-Myers Squibb Company Treatment of LAG-3 positive tumors
WO2018222718A1 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
EP4306542A2 (en) 2017-05-30 2024-01-17 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
WO2018222711A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
EP4245375A2 (en) 2017-05-30 2023-09-20 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
JP2021522347A (ja) * 2018-05-03 2021-08-30 シャンハイ エピムアブ バイオセラピューティクス カンパニー リミテッド Pd−1およびlag−3に対する高親和性抗体ならびにそれらから作製された二重特異性結合タンパク質
US12060425B2 (en) 2018-05-03 2024-08-13 Shanghai Epimab Biotherapeutics Co., Ltd. High affinity antibodies to PD-1 and LAG-3 and bispecific binding proteins made therefrom
CN112166125A (zh) * 2018-06-19 2021-01-01 信达生物制药(苏州)有限公司 全人源的抗lag-3抗体及其应用
EP4667493A2 (en) 2018-07-26 2025-12-24 Bristol-Myers Squibb Company Lag-3 combination therapy for the treatment of cancer
WO2020023707A1 (en) 2018-07-26 2020-01-30 Bristol-Myers Squibb Company Lag-3 combination therapy for the treatment of cancer
EP4663244A2 (en) 2018-10-19 2025-12-17 Bristol-Myers Squibb Company Combination therapy for melanoma
WO2020081928A1 (en) 2018-10-19 2020-04-23 Bristol-Myers Squibb Company Combination therapy for melanoma
EP4445958A2 (en) 2018-10-19 2024-10-16 Bristol-Myers Squibb Company Combination therapy for melanoma
JP2022523929A (ja) * 2019-02-28 2022-04-27 三生国健薬業(上海)股▲ふん▼有限公司 ヒトlag-3に結合する抗体、その製造方法および用途
WO2020232019A1 (en) 2019-05-13 2020-11-19 Regeneron Pharmaceuticals, Inc. Combination of pd-1 inhibitors and lag-3 inhibitors for enhanced efficacy in treating cancer
WO2020243563A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Multi-tumor gene signatures for suitability to immuno-oncology therapy
WO2020243570A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Cell localization signature and combination therapy
WO2020243568A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Methods of identifying a subject suitable for an immuno-oncology (i-o) therapy
US20220227887A1 (en) * 2019-06-11 2022-07-21 Ono Pharmaceutical Co., Ltd. Immunosuppressant
IT201900011676A1 (it) * 2019-07-12 2021-01-12 St Superiore Di Sanita Anticorpo ricombinante umano contro il recettore di membrana LAG3, suoi usi medici e diagnostici.
WO2021025177A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021024020A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021055994A1 (en) 2019-09-22 2021-03-25 Bristol-Myers Squibb Company Quantitative spatial profiling for lag-3 antagonist therapy
WO2021092221A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092220A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092380A1 (en) 2019-11-08 2021-05-14 Bristol-Myers Squibb Company Lag-3 antagonist therapy for melanoma
WO2021158938A1 (en) 2020-02-06 2021-08-12 Bristol-Myers Squibb Company Il-10 and uses thereof
WO2022008519A1 (en) 2020-07-07 2022-01-13 BioNTech SE Therapeutic rna for hpv-positive cancer
WO2022047189A1 (en) 2020-08-28 2022-03-03 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hepatocellular carcinoma
WO2022047412A1 (en) 2020-08-31 2022-03-03 Bristol-Myers Squibb Company Cell localization signature and immunotherapy
US12565528B2 (en) 2020-10-23 2026-03-03 Bristol-Myers Squibb Company LAG-3 antagonist therapy for lung cancer
WO2022087402A1 (en) 2020-10-23 2022-04-28 Bristol-Myers Squibb Company Lag-3 antagonist therapy for lung cancer
WO2022120179A1 (en) 2020-12-03 2022-06-09 Bristol-Myers Squibb Company Multi-tumor gene signatures and uses thereof
WO2022135667A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022136257A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022136255A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022136266A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
US12582713B2 (en) 2020-12-28 2026-03-24 Bristol-Myers Squibb Company Methods of treating tumors
WO2022146948A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Subcutaneous administration of pd1/pd-l1 antibodies
WO2022146947A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
EP4566674A2 (en) 2020-12-28 2025-06-11 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
WO2022165214A1 (en) 2021-01-29 2022-08-04 Board Of Regents, The University Of Texas System Methods of treating cancer with kinase inhibitors
WO2022212400A1 (en) 2021-03-29 2022-10-06 Juno Therapeutics, Inc. Methods for dosing and treatment with a combination of a checkpoint inhibitor therapy and a car t cell therapy
EP4319755A1 (en) 2021-04-08 2024-02-14 Board of Regents, The University of Texas System Compounds and methods for theranostic targeting of parp activity
WO2022240741A1 (en) 2021-05-12 2022-11-17 Dana-Farber Cancer Institute, Inc. Lag3 and gal3 inhibitory agents, xbp1, cs1, and cd138 peptides, and methods of use thereof
WO2023285552A1 (en) 2021-07-13 2023-01-19 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
WO2023061930A1 (en) 2021-10-11 2023-04-20 BioNTech SE Therapeutic rna for lung cancer
WO2023077090A1 (en) 2021-10-29 2023-05-04 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hematological cancer
WO2023147371A1 (en) 2022-01-26 2023-08-03 Bristol-Myers Squibb Company Combination therapy for hepatocellular carcinoma
WO2023164638A1 (en) 2022-02-25 2023-08-31 Bristol-Myers Squibb Company Combination therapy for colorectal carcinoma
WO2023168404A1 (en) 2022-03-04 2023-09-07 Bristol-Myers Squibb Company Methods of treating a tumor
WO2023170606A1 (en) 2022-03-08 2023-09-14 Alentis Therapeutics Ag Use of anti-claudin-1 antibodies to increase t cell availability
WO2023178329A1 (en) 2022-03-18 2023-09-21 Bristol-Myers Squibb Company Methods of isolating polypeptides
WO2023235847A1 (en) 2022-06-02 2023-12-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
WO2024116140A1 (en) 2022-12-01 2024-06-06 Medimmune Limited Combination therapy for treatment of cancer comprising anti-pd-l1 and anti-cd73 antibodies
WO2024126457A1 (en) 2022-12-14 2024-06-20 Astellas Pharma Europe Bv Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and immune checkpoint inhibitors
WO2024137776A1 (en) 2022-12-21 2024-06-27 Bristol-Myers Squibb Company Combination therapy for lung cancer
WO2024163477A1 (en) 2023-01-31 2024-08-08 University Of Rochester Immune checkpoint blockade therapy for treating staphylococcus aureus infections
WO2024192033A1 (en) 2023-03-13 2024-09-19 Regeneron Pharmaceuticals, Inc. Combination of pd-1 inhibitors and lag-3 inhibitors for enhanced efficacy in treating melanoma
WO2024196952A1 (en) 2023-03-20 2024-09-26 Bristol-Myers Squibb Company Tumor subtype assessment for cancer therapy
WO2025038763A1 (en) 2023-08-15 2025-02-20 Bristol-Myers Squibb Company Ceramic hydroxyapatite chromatography flow through method
WO2025106736A2 (en) 2023-11-15 2025-05-22 Regeneron Pharmaceuticals, Inc. Combination of pd-1 inhibitors and lag-3 inhibitors for enhanced efficacy in treating lung cancer
WO2025121445A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025121444A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2025120867A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2025120866A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent
WO2025184208A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibodies and uses thereof
WO2025184211A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibody drug conjugates
WO2025245489A1 (en) 2024-05-24 2025-11-27 Bristol-Myers Squibb Company Treatment of tumors in subjects having fgl-1 positive samples
WO2026035866A1 (en) 2024-08-07 2026-02-12 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with a lag-3 inhibitor and a pd-1 inhibitor
WO2026033885A1 (en) 2024-08-08 2026-02-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2

Also Published As

Publication number Publication date
US20220056126A1 (en) 2022-02-24
TN2019000099A1 (en) 2020-07-15
US20220363757A1 (en) 2022-11-17
EA201990912A1 (ru) 2019-10-31
IL265844A (en) 2019-06-30
RU2019113790A3 (https=) 2021-02-01
BR112019006876A2 (pt) 2019-06-25
PH12019500668B1 (en) 2023-12-06
CL2019000979A1 (es) 2019-06-21
CN117567622A (zh) 2024-02-20
CN110062766A (zh) 2019-07-26
IL265844B2 (en) 2024-03-01
TW201827462A (zh) 2018-08-01
US11834503B2 (en) 2023-12-05
CN110062766B (zh) 2023-12-15
KR102583190B1 (ko) 2023-09-26
UA127050C2 (uk) 2023-03-29
IL265844B1 (en) 2023-11-01
MA46525A (fr) 2019-08-21
US20240052032A1 (en) 2024-02-15
SA519401522B1 (ar) 2023-11-12
JP2020500006A (ja) 2020-01-09
PE20190911A1 (es) 2019-06-26
WO2018069500A3 (en) 2019-01-03
CN117567623A (zh) 2024-02-20
KR20230136711A (ko) 2023-09-26
AU2017342071A1 (en) 2019-04-18
SG10201912940WA (en) 2020-02-27
EP3526255A2 (en) 2019-08-21
JP7212821B2 (ja) 2023-01-26
RU2019113790A (ru) 2020-11-13
KR20190059958A (ko) 2019-05-31
ZA201901924B (en) 2024-05-30
JP2023027199A (ja) 2023-03-01
NZ793343A (en) 2026-01-30
US11390676B2 (en) 2022-07-19
RU2755503C2 (ru) 2021-09-16
TWI784976B (zh) 2022-12-01
MY203971A (en) 2024-07-26
CO2019004003A2 (es) 2019-04-30
CA3039140A1 (en) 2018-04-19
NZ752044A (en) 2026-01-30
CN117567621A (zh) 2024-02-20
AU2017342071B2 (en) 2024-11-14
KR102846713B1 (ko) 2025-08-13
JP7488323B2 (ja) 2024-05-21
PH12019500668A1 (en) 2019-07-24
MX2019004241A (es) 2019-08-05

Similar Documents

Publication Publication Date Title
US11834503B2 (en) Anti-lag-3 antibodies and compositions
EP3541841B1 (en) Anti-pd-1 antibodies and compositions
AU2016333517B2 (en) Anti-PD-1 antibodies and compositions
US20190276531A1 (en) Anti-tim-3 antibodies and compositions
US12030942B2 (en) Anti-PD-1 antibodies and compositions
CA3000564C (en) Anti-pd-1 antibodies and compositions
HK40085294A (en) Anti-pd-1 antibodies and compositions
EA046220B1 (ru) Анти-lag-3 антитела и их композиции
HK1256846A1 (en) Anti-pd-1 antibodies and compositions
HK1256846B (en) Anti-pd-1 antibodies and compositions

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17791987

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3039140

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019520053

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019006876

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2017342071

Country of ref document: AU

Date of ref document: 20171013

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2019/0004003

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 20197012672

Country of ref document: KR

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: NC2019/0004003

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2017791987

Country of ref document: EP

Effective date: 20190513

ENP Entry into the national phase

Ref document number: 112019006876

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190404