WO2018005226A2 - Compositions and methods for modulating il-10 immunostimulatory and anti-inflammatory properties - Google Patents

Compositions and methods for modulating il-10 immunostimulatory and anti-inflammatory properties Download PDF

Info

Publication number
WO2018005226A2
WO2018005226A2 PCT/US2017/038747 US2017038747W WO2018005226A2 WO 2018005226 A2 WO2018005226 A2 WO 2018005226A2 US 2017038747 W US2017038747 W US 2017038747W WO 2018005226 A2 WO2018005226 A2 WO 2018005226A2
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
scil
linker
amino acid
hinge
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/038747
Other languages
English (en)
French (fr)
Other versions
WO2018005226A3 (en
Inventor
Demetri T. Moustakas
Mark N. NAMCHUK
Heather C. LOSEY
Juan C. ALVAREZ
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Alkermes Inc
Original Assignee
Alkermes Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Alkermes Inc filed Critical Alkermes Inc
Priority to NZ748787A priority Critical patent/NZ748787B2/en
Priority to JP2018566552A priority patent/JP7084881B2/ja
Priority to CA3026393A priority patent/CA3026393C/en
Priority to EP17820960.7A priority patent/EP3474884A4/en
Priority to AU2017291321A priority patent/AU2017291321B2/en
Publication of WO2018005226A2 publication Critical patent/WO2018005226A2/en
Publication of WO2018005226A3 publication Critical patent/WO2018005226A3/en
Anticipated expiration legal-status Critical
Priority to AU2020204457A priority patent/AU2020204457A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2066IL-10
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5428IL-10
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • IL-10 is considered a potent anti -inflammatory cytokine that strongly inhibits the production of inflammatory mediators.
  • IL-10 also has immunostimulatory properties on CD4 + , CD8 + T cells, and/or NK cells, resulting in increased IFN- ⁇ production which in turn may lead to related inflammatory responses in humans.
  • IL-10 has been explored for use in the treatment of proliferative disorders, e.g., cancer, tumors, etc.
  • IL-10 induces cytotoxic activity of CD8 T-cells, antibody production of B-cell and suppresses macrophage activity and tumor promoting inflammation.
  • IL-10 appears to increase the infiltration of CD8+ T cells to a tumor, as well as increasing the expression of inflammatory cytokines that play a role in tumor immunity. Treatment with IL- 10 may provide a significant improvement for tumor treatment.
  • IL-10 IL-10
  • Fc fragment crystallizable domain of an antibody
  • Many such fusion proteins are capable of forming homodimers or heterodimers thereby forming antibody-like fusion protein molecules.
  • the invention provides compositions and methods for modulating the
  • the present invention provides scIL-10 polypeptides of Formula 1.
  • the polypeptides of the invention are optionally linked to a fusion partner.
  • FIG. 1 is a diagram of an Fc fusion protein homodimer of two polypeptide chains, wherein in each polypeptide chain comprises as X, scIL-10 which is then fused to the Fc region of an IgGl antibody via an scCLCHl linker.
  • FIG. 2 is a diagram of an Fc fusion protein homodimer of two polypeptide chains, wherein in each polypeptide chain comprises scIL-10 which is then fused to the Fc region of an IgGl antibody via the novel scCHlCL linker.
  • FIG. 3 is an SDS-PAGE showing expression of an Fc fusion protein comprising scIL- 10 fused to the Fc region of an IgGl antibody via the novel scCLCHl linker (left) or via the novel scCHlCL linker (right) under reducing and non-reducing conditions.
  • FIG. 4 is a chromatogram showing the characterization of the IL-10 fused to the Fc region of an IgGl antibody via the novel scCLCHl linker by analytical gel filtration.
  • FIG. 5 is a chromatogram showing the characterization of the IL-10 fused to the Fc region of an IgGl antibody via the novel scCHlCL linker by analytical gel filtration.
  • FIG. 6 is a graph showing stimulation of mouse mast cell line MC/9 by the IL-10 single chain fusion proteins of the invention as compared to the scIL-10 direct Fc fusion protein used as a control.
  • FIG. 7 is a schematic of the effects of amino acid substitutions that disrupt either one or both of the two IL-10R1 interfaces (SEQ ID NOS: 20, 21 and 22).
  • FIG. 8 is a schematic of the effects of amino acid substitutions that disrupt either one or both of the two IL-10R2 interfaces (SEQ ID NOS: 23, 24 and 25).
  • FIG. 9 is a schematic of the effects of amino acid substitutions that simultaneously disrupt one of the IL-10R1 and one of the IL-10R2 interfaces. (SEQ ID NOS: 26-29).
  • polypeptide is meant any sequence of two or more amino acids, regardless of length, post-translation modification, or function.
  • Polypeptide can include natural amino acids and non-natural amino acids.
  • Polypeptides can also be modified in any of a variety of standard chemical ways (e.g., an amino acid can be modified with a protecting group; the carboxy -terminal amino acid can be made into a terminal amide group; the amino-terminal residue can be modified with groups to, e.g., enhance lipophilicity; or the polypeptide can be chemically glycosylated or otherwise modified to increase stability or in vivo half-life).
  • Polypeptide modifications can include the attachment of another structure such as a cyclic compound or other molecule to the polypeptide and can also include polypeptides that contain one or more amino acids in an altered configuration (i.e., R or S; or, L or D).
  • antibody and “immunoglobulin” are used interchangeably and refer to a polypeptide substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, which specifically bind and recognize an antigen.
  • Identified immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable region genes.
  • Light chains are classified as either kappa or lambda.
  • Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD, and IgE, respectively. Terms understood by those in the art of antibody technology are each given the meaning acquired in the art, unless expressly defined differently herein.
  • Antibodies are known to have variable regions, a hinge region, and constant domains.
  • Percent (%) amino acid sequence identity herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in a selected sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
  • the "half-life" of a polypeptide can generally be defined as the time taken for the serum concentration of the polypeptide to be reduced by 50%, in vivo, for example due to degradation of the polypeptide and/or clearance or sequestration of the polypeptide by natural mechanisms.
  • the half-life can be determined in any manner known per se, such as by pharmacokinetic analysis.
  • Suitable techniques will be clear to the person skilled in the art, and may, for example, generally involve the steps of administering a suitable dose of a polypeptide to a rodent or primate; collecting blood samples or other samples from a rodent or primate at regular intervals; determining the level or concentration of the polypeptide in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the polypeptide has been reduced by 50% compared to the initial level upon dosing.
  • the half-life of a fusion polypeptide is increased if presence in a biological matrix (blood, serum, plasma, tissue) persists, in vivo, for a longer period as compared to an appropriate control.
  • Half-life may be increased by 10%, 20%, 30%, 40%, 50% or more as compared to an appropriate control.
  • Half-life can be expressed using parameters such as the ti/2-aipha, ti/2-beta, and
  • an “increase in half-life” refers to an increase in any one of these parameters, any two of these parameters, or all three of these parameters.
  • An “increase in half-life” in particular refers to an increase in the ti/2-beta and'or
  • HL_Lambda_z INCORPORATED BY REFERENCE (RULE 20.6) HL_Lambda_z, either with or without an increase in the ti/2-alpha.
  • Other PK parameters that can be assessed include volume of distribution (VD). clearance (CL), and mean residence time (MRT), and the area under the curve (AUC).
  • VD volume of distribution
  • CL clearance
  • MRT mean residence time
  • AUC area under the curve
  • a "change in pharmacokinetics” refers to changes in any one of these parameters, any two of these parameters, any three of these parameters, or all four of these parameters, in the presence or absence of changes in the half-life parameters listed above.
  • Activity for the purposes herein refers to an action or effect of a component of a fusion protein consistent with, but not necessarily identical to, that of the corresponding native active protein, wherein “biological activity” or “bioactivity” refers to an in vitro or in vivo biological function or effect, including but not limited to receptor binding, antagonist activity, agonist activity , or a cellular or physiologic response.
  • a "dimer complex” comprises two single chains of sc-IL-10, or sc-IL- 10 fused to an appropriate fusion partner such as, for example, the scIL-10-Ll-HINGE-Fc fusion proteins of the invention, wherein the two single chain polypeptides are associated together under appropriate conditions via either non-covalent binding or covalent binding, for example, by a disulfide bridge.
  • heterodimeric protein refers to a protein that is made of two single chain scIL-10-Ll-HINGE-Fc polypeptides forming a dimer complex, wherein said two single chain polypeptides have different amino acid sequences.
  • one single chain peptide of the heterodimer has an scIL-10 based on Formula lwith at least one amino acid substitution and the other single chain peptide of the heterodimer has an scIL-10 sequence based on Formula 1 with no amino acid substitutions.
  • homodimerized complex or “homodimer” as used interchangeably herein, refers to a protein that is made of two identical or substantially identical polypeptides forming the dimer complex, wherein said two single chain polypeptides preferably share 100% identity.
  • a homodimer comprises two substantially identical polypeptides having at least about 95% or at least about 99% identity, wherein any amino acid differences between the two polypeptide chains comprise amino acid substitutions, additions or deletions which do not affect the functional and physical properties of the polypeptide compared to its partner polypeptide of the homodimer such as, for example, conservative amino acid substitutions.
  • a protein is "soluble" when it lacks any transmembrane domain or protein domain that anchors or integrates the polypeptide into the membrane of a cell expressing such polypeptide.
  • Fc domain As used herein, "Fc domain”, “Fc region” or “Fc portion” as those terms may be used interchangeably herein to describe an scIL-10-Ll-HINGE-Fc fusion protein of the invention, encompasses domains derived from the constant region of an immunoglobulin, preferably a human immunoglobulin, including a fragment, analog, variant, mutant or derivative of the constant region. Suitable immunoglobulins include IgGl, IgG2, IgG3, IgG4, and other classes such as IgA, IgD, IgE and IgM.
  • the constant region of an immunoglobulin is defined as a naturally -occurring or synthetically-produced poly peptide homologous to the immunoglobulin C-terminal region, and can include a CHI domain, a hinge, a CH2 domain, a CH3 domain, or a CH4 domain, separately or in combination.
  • treatment or “treating,” or “palliating” or “ameliorating” is used interchangeably herein. These terms refer to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit and/or a prophylactic benefit.
  • therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated.
  • a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the subject, notwithstanding that the subject may still be afflicted with the underlying disorder.
  • compositions may be administered to a subject at risk of developing a particular disease, or to a subject reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease may not have been made.
  • a “therapeutic effect”, as used herein, refers to a physiologic effect, including but not limited to the cure, mitigation, amelioration, or prevention of disease in humans or other animals, or to otherwise enhance physical or mental well-being of humans or animals, caused by a fusion protein of the invention.
  • terapéuticaally effective amount refers to an amount of an active protein, either alone or as a part of a fusion protein composition, that is capable of having any detectable, beneficial effect on any symptom, aspect, measured parameter or characteristics of a disease state or condition when administered in one or repeated doses to a subject. Such effect need not be absolute to be beneficial.
  • terapéuticaally effective dose regimen refers to a schedule for consecutively administered doses of an active protein, either alone or as a part of a fusion protein composition, wherein the doses are given in therapeutically effective amounts to
  • INCORPORATED BY REFERENCE results in sustained beneficial effect on any symptom, aspect, measured parameter or characteristics of a disease state or condition.
  • anti-inflammatory window is defined as the range of scIL-10 concentrations that produce anti-inflammatory effects on PBMCs/macrophages, while not inducing immunostimulatory effects (on CD8 T cells, NK cells, etc... ).
  • two assays are used in the Examples to define the potencies of those two bioactivities:
  • PBMC cytokine release assay yields an IC50 value (usually in the low picomolar range) for the concentration at which anti-inflammatory effects occur as measured by inhibition of release of TNF-alpha (TNFa);
  • MC/9 proliferation assay yields an EC50 value (usually in the high picomolar to nanomolar range) for the concentration at which immunostimulation effects occur.
  • the ratio in Tables 11 and 12 is the ratio of (MC/9 EC50) / (PBMC IC50) values.
  • Human wild-type IL-10 is a non-covalently linked dimer protein comprising two identical monomer subunits.
  • Each identical monomer subunit of human wild type IL-10 has the following amino acid sequence (absent the leader sequence): SPGQGTQSENSCTHFPGNLPNMLPvDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLPvLRRCHRFLPC ENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFI YIEAYMTMKIRN (SEQ ID NO: 1) (UmProtKB- P22301 [chain 19-178] of IL 10, Interleukin-10, Homosapiens).
  • SEQ ID NO: 1 is also referred to herein as an "unsubstituted IL-10 monomer subunit".
  • Amino Acid sequences based on SEQ ID NO: 1 that comprise at least one amino acid substitution are referred to herein as "substituted IL-10 monomer subunits”.
  • polypeptides of Formula 1 are referred to herein as "scIL-10" polypeptides and comprise an amino acid sequence arrangement from N-terminus to C-terminus in accordance with Formula 1 :
  • first monomer subunit, the second monomer subunit or both the first and second monomer subunits may be independently selected from: an unsubstituted IL-10 monomer subunit; or a substituted IL-10 monomer subunit comprising at least one amino acid substitution; and
  • LINKER is any amino acid linker of at least 1-100 amino acids in length.
  • LINKER has a length of between at least 2 amino acid and less than 100 amino acids, such as for example between at least 2 amino acids and less than 75 amino acids, more preferably between at least 3 amino acids and less than 50 amino acids, such as for example between at least 4 amino acids and less than 25 amino acids, such as for example between at least 5 ammo acids and less than 20 amino acids and even more preferably between at least 6 ammo acids and less than 15 amino acids. More preferably, the linker has a length of between at least 3 amino acids and less than 10 amino acids. Most preferably, the linker has a length of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids.
  • the linker is a flexible linker.
  • the flexible linker comprises or consists of the amino acids glycine, asparagine and/or serine. More preferably, the flexible linker comprises or consists of the amino acids glycine and serine.
  • first monomer subunit and the second monomer subunit of Formula 1 are both unsubstituted IL-10 monomer subunits and each have the amino acid sequence of SEQ ID NO: 1.
  • These peptides are also referred to herein as "unsubstituted scIl-10".
  • scIL-10 peptides of Formula 1 comprise at least one amino acid substitution in either the first monomer subunit of Formula 1, the second monomer subunit of Formula 1, or in both the first and second monomer subunits of Formula 1.
  • These sell- 10 proteins comprising substituted monomer subunits as compared to human wtscIL-10 of SEQ ID NO: 1 are also referred to herein as "scIL-10 variants”.
  • a preferred scIL-10 peptide of the invention is referred to herein as "unsubstituted scIL-10 (lOaa linker)" and has the following amino acid sequence:
  • scIL-10 (lOaa linker) as represented by SEQ ID NO: 2 comprises two unsubstituted scIL-10 monomer subunits each comprising the amino acid sequence of SEQ ID NO: 1 and as per Formula 1, a LINKER, wherein LINKER is 10 amino acids in length having the sequence: GGSGGGGSGG (SEQ ID NO: 3).
  • LINKER of scIL-10 is not SEQ ID NO: 3.
  • unsubstituted scIL-10 peptides of Formula 1 include peptides wherein LINKER is a 5 amino acid linker also referred to herein as "unsubstituted sc-ILlO (5aa linker)".
  • LINKER is a 5 amino acid linker also referred to herein as "unsubstituted sc-ILlO (5aa linker)".
  • One preferred five, amino acid linker is the sequence: GGSGG (SEQ ID NO: 4).
  • unsubstituted scIL-10 peptides of Formula 1 include peptides wherein LINKER is a three amino acid linker also referred to herein as "unsubstituted sc-ILlO (3aa linker)".
  • LINKER is a three amino acid linker also referred to herein as "unsubstituted sc-ILlO (3aa linker)".
  • One preferred three, amino acid linker is the sequence is the sequence GGG.
  • the present invention is based in part on the discovery that fusion proteins comprising unsubstituted scIL-10 as represented by Formula 1 and scIL-10 comprising at least one amino acid substitution ("scIL-10 variants") also represented by Formula 1, possess a broad antiinflammatory window.
  • scIL-10 variants also represented by Formula 1
  • the present invention is also based in part on the discovery that certain amino acid substitutions of unsubstituted scIL-10 further increase the
  • immunostimulatory ECso The ability to increase the immunostimulatory EC 50 while maintaining a low anti-inflammatory IC50 provides several orders of magnitude increase in the anti -inflammatory window size as compared to, for example, wild-type IL-10 or other fusion proteins comprising IL-10 that are not modified in accordance with the invention.
  • amino acid substitutions at the interface of scIL-10 with the IL-10R1 and/or IL-10 R2 receptor resulted in modulation of IL- 10's immunostimulatory properties, anti-inflammatory properties or both.
  • the invention provides scIL-10 variants wherein at least one amino acid substitution (as compared to human wild type IL-10 of SEQ ID NO: 1) is introduced in the first and/or second monomer subunit of Formula 1.
  • scIL-10 comprises at least one amino acid substitution at the interface of the IL-10R1 interface on only one of the first or second monomer subunits of Formula 1 but not both of the first or second monomer subunits of Formula 1.
  • scIL-10 comprises at least one amino acid substitution at the interface of the IL-10R1 interface of only one of the first or second monomer subunits of Formula 1 and also comprises at least one amino acid substitution at an IL-10R2 interface on only one of the first or second monomer subunits of Formula that is not the same monomer subunit as the amino acid substitution at the IL-1-R1 interface.
  • Preferred amino acid substitutions for scIL-10 variants are based on the numbering of amino acids of SEQ ID NO: 1 and include the following mutations: methionine at position 22 and aspartic acid at position 41.
  • the invention provides scIL-10 variants wherein at least one amino acid is substituted at position 41 in the first or second monomer subunit of Formula 1 and at least one amino acid is substituted at position 22 in the first or second monomer subunit that is not the same subunit that comprises the amino acid substitution at position 41.
  • the invention provides scIL-10 variants wherein at least one amino acid is substituted at the isoleucine at position 87 of only the first monomer subunit or the second monomer subunit of Formula 1 but not at both monomer subunits.
  • Amino acid substitutions of methionine at position 22, aspartic acid at position 41 and isoleucine at position 87 may include substitution with any other amino acid. Either conservative or non-conservative amino acid substitutions can be made at one or more amino acid residues. Both conservative and non-conservative substitutions can be made.
  • aromatic phenylalanine, tyrosine, tryptophan
  • amide asparagine, glutamine
  • sulfur-containing cysteine and methionine.
  • Preferred amino acid substitutions for the first monomer subunit and/or the second monomer subunit in accordance with Formula 1 include the following substitutions: the methionine at position 22 to alanine (M22A); aspartic acid at position 41 to asparagine (D41N); aspartic acid at position 41 to alanine (D41 A); aspartic acid at position 41 to phenylalanine (D41F); isoleucine at position 87 to alanine (I87A).
  • the invention is also based in part on the discovery that the immunostimulatory or anti-inflammatory activities of scIL-10 and scIL-10 variants can be further modulated by fusing scIL-10 or scIL-10 variants to fusion partners including, but not limited to, Fc polypeptides and modified Fc polypeptides such as single chain Fc fusion proteins, mucin linker Fc fusions, Fc polypeptides with truncated hinge regions.
  • Other fusion partners include, but are not limited to: mucin domain polypeptides, albumin fusion proteins, transferrin proteins and other fusion partners not comprising an Fc domain.
  • Single chain Fc fusion proteins of the invention have the following arrangement from -terminus (N-terminus) to carboxy -terminus (C-terminus) as shown in Formula 2:
  • LI is a linker having the following arrangement from amino-terminus to carboxy -terminus:
  • L2 and L4 are independently polypeptide linkers or are independently absent, L3 is a polypeptide linker;
  • CL is a constant region polypeptide from an immunoglobulin light chain
  • CHI a constant region polypeptide from a CHI domain of an immunoglobulin heavy chain
  • HINGE is a hinge sequence of an immunoglobulin or is absent with the proviso that if HINGE is absent, L4 is present;
  • Fc is the carboxy -terminus of an immunoglobulin or any active fragment or derivative thereof.
  • an scIL-10 of Formula 1 is fused to the N-terminal region of an immunoglobulin Fc region via a novel linker (LI) that is derived from the CL and CHI domains of an immunoglobulin arranged as a single chain (sc) also referred to herein as "scCLCHl linkers" (Formula 3).
  • LI novel linker
  • sc single chain
  • the C-terminus of the CL region may be linked to the N-terminal region of a CHI region via polypeptide linker L3.
  • the N-terminus of the CL region may be fused to the C- terminus of scIL-10 of Formula 1 via an optional polypeptide linker L2.
  • the C-terminus of the CHI domain is linked to the Fc domain via an immunoglobulin hinge region (HINGE) or a polypeptide linker (L4) or both a hinge (HINGE) and a polypeptide linker (L4).
  • the C-terminus of the CHI domain may also be linked to the N-terminus of a CL region via polypeptide linker L3.
  • the N-terminus of the CHI region may be fused to the C- terminus of scIL-10 of Formula 1 via an optional polypeptide linker L2.
  • the C-terminus of the CL region is linked to the Fc region via an immunoglobulin hinge region (HINGE) or a polypeptide linker (L4) or both a hinge (HINGE) and a polypeptide linker (L4).
  • L3 is selected from artificial flexible domains comprising amino acids selected from Gly (G), and/or Ser (S).
  • the linker is comprised of polypeptide of the general formula (Gly-Gly-Gly-Ser (SEQ ID NO: 5))n or (Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 6))n wherein n is an integer from 1 to 10.
  • each linker is a polypeptide comprising from about 1 to about 100 amino acids, preferably about 1-50 amino acids, preferably about 1-25 amino acids, preferably about 1-15 amino acids preferably about 1-10 amino acids, preferably about 4-24 amino acids, preferably about 5-20 amino acids preferably about 5-15 amino acids and preferably about 5-10 amino acids.
  • the linker is (Gly- Gly-Gly-Gly-Ser (SEQ ID NO: 6)) n wherein n is 2 or 4.
  • L2 and L4 are independently selected from artificial flexible domains comprising amino acids selected from, for example, Gly (G), and Ser (S).
  • the linker is comprised of polypeptide of the general formula (Gly-Gly-Gly-Ser (SEQ ID NO: 5))n or (Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 6))n wherein n is an integer from 1 to 10.
  • each linker is a polypeptide comprising from about 1 to about 100 amino acids, preferably about 1-50 amino acids, preferably about 1-25 amino acids, preferably about 1-15 amino acids preferably about 1-10 amino acids, preferably about 4-24 amino acids, preferably about 5-20 amino acids preferably about 5-15 amino acids and preferably about 5-10 amino acids.
  • the linker is (Gly-Gly-Gly-Gly-Ser(SEQ ID NO: 6))n wherein n is 2 or 4.
  • L2, L3 and L4 may further comprise amino acids such as, for example, Lys (K), Thr (T), Glu (E), and Asp (D).
  • the CL region of the novel scCLCHl linker (LI) may be substantially identical to the corresponding CL region of native immunoglobulins belonging to any of the immunoglobulin classes, i.e., IgA, IgD, IgE, IgG, or IgM or any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4.
  • the CL region (LI) may have amino acid sequence that is at least 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the
  • CL region of native immunoglobulins belonging to any of the immunoglobulin classes, i.e., IgA, IgD, IgE, IgG, or IgM or any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4.
  • modifications include, but are not limited to, amino acid insertions, deletions, substitutions and rearrangements.
  • the amino acid sequence of the CL region in accordance with the invention is at least 80%, more preferably at least 85%, more preferably at least 90%, and more preferably at least 95% identical to the corresponding CL region of native immunoglobulins belonging to any of the immunoglobulin classes, i.e., IgA, IgD, IgE, IgG, or IgM or any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4.
  • the CHI region of the novel scCLCHl linker (LI) may be substantially identical to the corresponding CHI region of native immunoglobulins belonging to any of the immunoglobulin classes, i.e., IgA, IgD, IgE, IgG, or IgM or any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4.
  • the CHI region of LI may have amino acid sequence that is at least 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the corresponding CHI region of native immunoglobulins belonging to any of the immunoglobulin classes, i.e., IgA, IgD, IgE, IgG, or IgM or any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4.
  • the CHI region of the LI linker is a modified derivative or variant of a native CHI immunoglobulin region such modifications include, but are not limited to, amino acid insertions, deletions, substitutions and rearrangements.
  • the amino acid sequence of the CHI region is at least 80%, more preferably at least 85%, more preferably at least 90%, and more preferably at least 95% identical to the corresponding CHI region of native immunoglobulins belonging to any of the
  • immunoglobulin classes i.e., IgA, IgD, IgE, IgG, or IgM or any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4.
  • the CHI region and CL regions of LI do not need to be identical to or a variant of, the corresponding regions of the same immunoglobulin class.
  • the CL region may be derived from the corresponding region of IgE and the CHI region may be derived from the corresponding region of IgG.
  • CL and CHI of the scCLCHl linker are derived from the corresponding
  • An exemplary CL region corresponding to the CL region of a human IgGl includes:
  • An exemplary CHI region corresponding to the CHI region of hlgGl includes: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV (SEQ ID NO: 8).
  • the single chain Fc fusion proteins disclosed herein comprise an Fc region that includes at least a portion of the carboxy -terminus of an immunoglobulin heavy chain.
  • the Fc portion may comprise: a CH2 domain, a CH3 domain, a CH4 domain, a CH2-CH3 domain, a CH2-CH4 domain, a CH2-CH3-CH4 domain, a hinge-CH2 domain, a hinge-CH2-CH3 domain, a hinge-CH2-CH4 domain, or a hinge-CH2-CH3-CH4 domain.
  • Fc domain may be derived from antibodies belonging any of the immunoglobulin classes, i.e., IgA, IgD, IgE, IgG, or IgM or any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4.
  • the Fc region is derived from IgGl preferably human IgGl.
  • the Fc domain may be a naturally occurring Fc sequence belonging any of the immunoglobulin classes, i.e., IgA, IgD, IgE, IgG, or IgM or any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4, including natural allelic or splice variants.
  • the Fc domain may be a hy brid domain comprising a portion of an Fc domain from two or more different Ig isotypes, for example, an IgG2/IgG4 hybrid Fc domain.
  • the Fc domain is derived from a human immunoglobulin molecule.
  • the Fc domain may be a humanized or deimmunized (removal of T cell epitopes which can activate helper T cells) version of an Fc domain from a non-human animal, including but not limited to mouse, rat, rabbit, and monkey.
  • the Fc domain may be a variant Fc sequence, e.g., an Fc sequence that has been modified (e.g., by ammo acid substitution, deletion and/or insertion) relative to a parent Fc sequence (e.g., an unmodified Fc polypeptide that is subsequently modified to generate a variant), to provide desirable structural features and/or biological activity.
  • a variant Fc sequence e.g., an Fc sequence that has been modified (e.g., by ammo acid substitution, deletion and/or insertion) relative to a parent Fc sequence (e.g., an unmodified Fc polypeptide that is subsequently modified to generate a variant), to provide desirable structural features and/or biological activity.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • CDC complement mediated cytotoxicity
  • c has increased or decreased affinity for Clq
  • d has increased or decreased affinity for a Fc receptor relative to the parent Fc.
  • Such Fc region variants will generally comprise at least one amino acid modification in the Fc region. Combining amino acid modifications is thought to be particularly desirable.
  • the variant Fc region may include two, three, four, five, etc. substitutions therein, e.g. of the specific Fc region positions identified herein.
  • the hinge region of the Fc fusion proteins of the invention may be derived from antibodies belonging to any of the immunoglobulin classes, i.e., IgA, IgD, IgE, IgG, or IgM.
  • the hinge region may be derived from any of the IgG antibody subclasses, i.e., IgGl, IgG2, IgG3, and IgG4.
  • the hinge region may naturally contain a cysteine residue or may be engineered to contain one or more cysteine residues.
  • the hinge region may have an amino acid sequence that is at least 50%,
  • INCORPORATED BY REFERENCE preferably at least 85%, more preferably at least 90%, and more preferably at least 95% identical to the corresponding hinge region of human IgGl.
  • the CHI region is indicated by underlining with a dotted line, and the CH2 and CH3 regions are indicated by bold lettering.
  • the C-terminal lysine of an IgG sequence may be removed or replaced with a non-lysine amino acid, such as alanine, to further increase the serum half-life of the Fc fusion protein.
  • the hinge sequence may include substitutions that confer desirable pharmacokinetic, biophysical, and/or biological properties.
  • An exemplary hinge region of the invention comprises an amino acid sequence that is at least 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the following: EPKSSDKTHTCPPCP (SEQ ID NO: 51).
  • the Fc domain and the hinge region may be derived from one antibody class or subclass.
  • the hinge region and the Fc domain may be derived from IgGl .
  • the Fc domain and hinge region may correspond to different antibody classes or subclasses.
  • the Fc domain may correspond to the Fc region of IgG2 or IgG4 and the hinge region may correspond to IgGl.
  • all immunoglobulin domains of the Fc fusion proteins of the invention are derived from IgGl, preferably human IgGl.
  • the combined hinge region and Fc region of the fusion proteins of the invention comprise an amino acid sequence that is at least 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to:
  • the combined hinge region and Fc region of the fusion proteins of the invention comprise an amino acid sequence that is at least 50%, 60%,
  • a hinge sequence and/or Fc region of the single chain fusion proteins of the invention comprising a free cysteine residue in order to permit the formation of a disulfide bond between the hinge and or Fc regions thereby forming dimers of the Fc fusion proteins of the invention. It may be desirable to alter the hinge and/or Fc region sequences to remove free cysteine residues, e.g., by mutating one or more cysteine residues in a linker to another residue, such as a serine, alanine or glycine.
  • the hinge region of the single chain fusion proteins of the invention may comprise one or more free cysteine residues capable of forming one or more disulfide bonds with a second single chain fusion protein of the invention thereby forming a dimer complex.
  • the (scIL-lO)-Ll-HINGE-Fc fusion proteins of the invention are dimer complexes comprising two monomeric single chain (scIL-lO)-Ll-HINGE-Fc fusion proteins of the invention linked via a disulfide bond to the hinge region or in the Fc region of the other monomer.
  • the dimer complexes may be homodimeric (e.g. both monomeric fusion proteins are identical) or heterodimeric (e.g. scIL-10 may be different for each monomeric fusion protein).
  • the dimer complexes are homodimers thereby forming a homodimeric complex that provides an antibody configuration that resembles that of a native antibody.
  • the homodimeric fusion proteins of the inv ention increase half-life due to the presence of a dimerized Fc region which more closely resembles the native antibody structure as compared to traditional Fc fusion proteins. This is particularly true when the fusion protein has the configuration of Formula 3.
  • a more native Fc domain antibody configuration is believed to enable better binding to the FcRn receptor and therefore increase the circulating half-life of the of the scIL-10-Ll- HINGE-Fc dimer complex.
  • Another improved property associated with scIL-10-Ll-HINGE-Fc dimer complexes is that bioactivity is increased versus a traditional Fc fusion proteins based on the use of the scCLCHl linker which imparts flexibility to relieve steric hindrance caused by the dimerization through the Fc in the hinge region.
  • the invention provides (scIL-lO)-Ll-HINGE-Fc fusion wherein scIL-10 of Formula 1 is unsubstituted scIL-10 (lOaa linker).
  • the invention provides (scIL- 10)-Ll-HINGE-Fc fusion wherein the scIL-10 of Formula 1 is an sc-IL-10 variant comprising at least one amino acid substitution in the first monomer subunit or the second monomer subunit as per Formula 1 selected from the methionine at position 22, the aspartic acid at position 41, and the isoleucine at position 87 or any combination thereof.
  • a preferred scILlO-Ll-HINGE-Fc fusion protein of the invention comprises an amino acid sequence that is 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 12 wherein scIL-10 is unsubstituted scIL-10 (lOaa linker).
  • Preferred scIL-10-Ll-HINGE-Fc fusion proteins of the invention comprise an ammo acid sequence that is 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NOs: 20-21 and 37-44 all as shown in Table 4.
  • Preferred scIL-10-Ll-HINGE-Fc fusion proteins of the invention comprise an amino acid sequence that is 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NOs: 17-19 as shown in Table 4 wherein scIL-10 is an scIL-10 variant.
  • the invention also provides nucleic acids encoding any of the various fusion proteins disclosed herein. Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells. See for example: Mayfield et al., Proc. Natl. Acad. Sci. USA,
  • DNA encoding the polypeptide is operably linked to suitable transcriptional or translational regulatory elements derived from
  • INCORPORATED BY REFERENCE (RULE 20.6) mammalian, viral, or insect genes.
  • Such regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation.
  • the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants is additionally incorporated.
  • the fusion proteins described herein may be produced recombinantly not only directly, but also as a fusion polypeptide with a heterologous polypeptide, which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • a heterologous polypeptide which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • the heterologous signal sequence selected preferably is one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell.
  • An exemplar N-terminal leader sequence for production of polypeptides in a mammalian system is MYRMQLL S CI AL SL AL VTNS (SEQ ID NO: 48), which is removed by the host cell following expression.
  • the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, or heat-stable enterotoxin II leaders.
  • the native signal sequence may be substituted by, e.g., the yeast invertase leader, a factor leader (including Saccharomyces and Kluyveromyces alpha-factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal described in U.S. Pat. No. 5,631,144.
  • yeast invertase leader a factor leader (including Saccharomyces and Kluyveromyces alpha-factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal described in U.S. Pat. No. 5,631,144.
  • mammalian signal sequences as well as viral secretory leaders for example, the herpes simplex gD signal, are available.
  • the DNA for such precursor regions may be ligated in reading frame to DNA encoding the protein.
  • Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells.
  • this sequence is one that enables the v ector to replicate independently of the host chromosomal DNA, and includes origins of replication or autonomously replicating sequences.
  • origins of replication or autonomously replicating sequences are well known for a variety of bacteria, yeast, and viruses.
  • the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2 micron plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells.
  • the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria
  • the 2 micron plasmid origin is suitable for yeast
  • various viral origins SV40, polyoma, adenovirus, VSV or BPV
  • INCORPORATED BY REFERENCE (RULE 20.6) origin of replication component is not needed for mammalian expression vectors (the SV40 origin may typically be used only because it contains the early promoter).
  • Selection genes may contain a selection gene, also termed a selectable marker.
  • Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase for Bacilli.
  • Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the nucleic acid encoding the protein disclosed herein, e.g., a fibronectin-based scaffold protein.
  • Promoters suitable for use with prokaryotic hosts include the phoA promoter, beta-lactamase and lactose promoter systems, alkaline phosphatase, a tryptophan (trp) promoter system, and hybrid promoters such as the tan promoter.
  • trp tryptophan
  • Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably linked to the DNA encoding the protein disclosed herein.
  • Promoter sequences are known for eukaryotes. Virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT (SEQ ID NO: 49) region where N may be any nucleotide. At the 3' end of most eukaryotic genes is an
  • AATAAA SEQ ID NO: 50 sequence that may be the signal for addition of the poly A tail to the 3' end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
  • suitable promoting sequences for use with yeast hosts include the promoters for 3-phosphogly cerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphogly cerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
  • 3-phosphogly cerate kinase or other glycolytic enzymes such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphogly cerate mutase, pyruvate
  • Transcription from vectors in mammalian host cells can be controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.
  • viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV
  • the enhancer may be spliced into the vector at a position 5 Or 3' to the peptide-encoding sequence, but is preferably located at a site 5' from the promoter.
  • Expression vectors used in eukaryotic host cells will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of mRNA encoding the protein disclosed herein.
  • One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO 94/11026 and the expression vector disclosed therein.
  • the recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein.
  • protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, (Elsevier, New York (1985)), the relevant disclosure of which is hereby incorporated by reference.
  • the expression construct is introduced into the host cell using a method appropriate to the host cell, as will be apparent to one of skill in the art.
  • a variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
  • Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells.
  • Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may
  • INCORPORATED BY REFERENCE (RULE 20.6) also be used for production of polypeptides.
  • Various mammalian or insect cell culture systems can also be employed to express recombinant proteins.
  • Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow et al.
  • suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, CI 27, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines.
  • Purified polypeptides are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of many of the polypeptides disclosed herein would make expression in E. coli as the preferred method for expression. The protein is then purified from culture media or cell extracts.
  • the invention provides host cells containing vectors encoding the fusion proteins described herein, as well as methods for producing the fusion proteins described herein.
  • Host cells may be transformed with the herein-described expression or cloning vectors for protein production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • Host cells useful for high-throughput protein production (HTPP) and mid-scale production include the HMS 174-bacterial strain.
  • the host cells used to produce the proteins disclosed herein may be cultured in a variety of media.
  • any of these media may ⁇ be supplemented as necessar with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as Gentamycin drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
  • the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • fusion proteins provided herein can also be produced using cell-translation systems.
  • the nucleic acids encoding the fusion protein must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA
  • INCORPORATED BY REFERENCE (RULE 20.6) in the particular cell-free system being utilized (eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell-free translation system).
  • eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell-free translation system.
  • the fusion proteins disclosed herein can also be produced by chemical synthesis (e.g.. by the methods described in Solid Phase Peptide Synthesis, 2nd Edition. The Pierce Chemical Co., Rockford, 111. (1984)). Modifications to the fusion proteins can also be produced by chemical synthesis.
  • the fusion proteins disclosed herein can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry.
  • Non-limiting examples include extraction, recrystallization, salting out (e.g., with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange
  • polypeptides may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
  • the purified fusion protein is preferably at least 85% pure, or preferably at least 95% pure, and most preferably at least 98% pure. Regardless of the exact numerical value of the purity, the fusion protein is sufficiently pure for use as a pharmaceutical product.
  • scIL-10 proteins of the invention include but are not limited to proteins comprising an Fc region of all other types.
  • scIL-10 proteins may be fused directly to the hinge region of a native immunoglobulin containing an Fc region, for example IgGl.
  • SEQ ID NO: 13 is an example of unsubstituted scIL-10 (5aa linker) fused to the hinge region of an IgGl molecule.
  • the IgGl molecule may be modified, by, for example, by shortening the hinge region of IgGl.
  • SEQ ID NO: 14 is an example of scIL-10 (5aa linker) fused to the hinge region of IgGl wherein in the hinge region of the native IgGl has been shortened by 4 amino acids.
  • SEQ ID NO: 15 is an example of scIL-10 fused to the hinge region of IgGl wherein in the hinge region of the native IgGl has been shortened by 7 amino acids.
  • SEQ ID NO: 16 is an example of scIL-10 fused to the hinge region of IgGl wherein in the hinge region of the native IgGl has been shortened by 10 amino acids.
  • a preferred fusion partner comprises an Fc region further comprising a mucin-domain polypeptide linker as is described in WO2013/184938 incorporated herein by reference.
  • a "mucin-domain polypeptide linker” is defined herein as any protein comprising a "mucin domain” capable of being linked to one or more fusion polypeptide partners.
  • a mucin domain is rich in potential glycosylation sites, and has a high content of serine and/or threonine and proline, which can represent greater than 40% of the amino acids within the mucin domain.
  • a mucin domain is heavily glycosylated with predominantly O-linked glycans.
  • a mucin-domain polypeptide has at least about 60%, at least 70%. at least 80%, or at least 90% of its mass due to the glycans.
  • Mucin domains may comprise tandem amino acid repeat units (also referred to herein as TR) that may vary in length from about 8 amino acids to 150 ammo acids per each tandem repeat unit. The number of tandem repeat units may vary between 1 and 25 in a mucin-domain polypeptide of the invention.
  • Mucin-domain polypeptide linkers of the invention include, but are not limited to, all or a portion of a mucin protein.
  • a "portion thereof is meant that the mucin polypeptide linker comprises at least one mucin domain of a mucin protein.
  • Mucin proteins include any protein encoded for by a MUC gene (e.g., MUC1, MUC2, MUC3A, MUC3B, MUC4, MUC5AC, MUC5B, MUC6, MUC7, MUC 8, MUC9, MUCH, MUC 12, MUC 13, MUC 15, MUC 16, MUC 17, MUC 19, MUC20, MUC21).
  • the mucin domain of a mucin protein is typically flanked on either side by non-repeating amino acid regions.
  • a mucin-domain polypeptide may comprise all or a portion of a mucin protein (e.g. MUC20).
  • a mucin- domain polypeptide may comprise all or a portion of a mucin protein of a soluble mucin protein.
  • the mucin-domain polypeptide comprises the extracellular portion of a mucin protein.
  • an scIL-10 protein of Formula 1 is covalently linked to a molecule comprising an Fc region via a mucin-domain polypeptide linker.
  • SEQ ID NO: 52 is an example of unsubstituted scIL-10 fused to mucin linker which is in turn fused to the hinge of a native IgGl Fc region.
  • a preferred fusion partner is a mucin domain polypeptide (not including an Fc region) as is described in WO 2013/184939.
  • a preferred fusion partner comprises serum albumin or a domain of serum albumin.
  • Fusion partners comprise human transferrin.
  • the invention provides scIL-10 (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) that are useful as diagnostic or therapeutic agents.
  • the invention provides proteins useful in the treatment of disorders.
  • the invention also provides a method for achieving a beneficial effect in a subject comprising the step of administering to the subject a therapeutically or prophylactically- effective amount of scIL-10 (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) of the invention.
  • the effective amount can produce a beneficial effect in helping to treat a disease or disorder.
  • the method for achieving a beneficial effect can include administering a therapeutically effectiv e amount of a fusion protein composition to treat a subject for diseases and disease categories wherein a therapeutic protein or peptide does not exist.
  • scIL-10 is not linked to any fusion partner.
  • scIL-10 is covalently linked to an appropriate fusion partner such as scIL-
  • the invention provides dimer complexes of scIL-10 fused to an appropriate fusion partner.
  • scIL-10 (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) are used to treat patients who suffer from, for example, autoimmune disorders, fibrotic diseases, inflammatory diseases, ischemic diseases, neurodegenerative diseases, neuropathic diseases, pain disorders, auditory disorders, psychiatric disorders, cancer and trauma and injury.
  • autoimmune disorders include, but are not limited to: acute
  • ADAM disseminated encephalomyelitis
  • Addison's disease agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroiditis, autoimmune urticaria, axonal & neuronal neuropathies, Balo disease, Behcet's disease, cardiomyopathy, Castleman
  • CIDP demyelinating polyneuropathy
  • CRMO chronic recurrent multifocal ostomyelitis
  • GPA granulomatosis with Polyangiitis
  • IPP thrombocytopenic purpura
  • IgA nephropathy IgG4-related sclerosing disease
  • immunoregulatory lipoproteins inclusion body myositis, interstitial cystitis, juvenile arthritis, juvenile diabetes (Type 1 diabetes), juvenile myositis, Kawasaki disease, Lambert-Eaton syndrome, leukocytoclastic vasculitis, lichen planus, lichen sclerosus, ligneous conjunctivitis, linear IgA disease (LAD), Lupus (systemic lupus erythematosus), Lyme disease, chronic, Meniere's disease, microscopic polyangiitis, mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, multiple sclerosis (MS), myasthenia gravis, myositis, narcolepsy, neuromyelitis optica (Devic's), neutropenia, ocular cicatricial pemphigoid, optic neu
  • encephalomyelitis pernicious anemia, POEMS syndrome, polyarteritis nodosa, polymyalgia rheumatica, polymyositis, postmyocardial infarction syndrome, postpericardiotomy syndrome, primary biliary cirrhosis, primary sclerosing cholangitis, progesterone dermatitis, psoriasis, psoriatic arthritis, pure red cell aplasia, pyoderma gangrenosum, Raynauds phenomenon, reactive Arthritis, reflex sympathetic dystrophy, Reiter's syndrome, relapsing polychondritis, restless legs syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis (RA), rheumatoid arthritis, sarcoidosis, Schmidt syndrome, scleritis, scleroderma, Sjogren's syndrome, sperm & testicular autoimm
  • fibrotic diseases which may be treated by the scIL-10 and scIL-10 variant peptides (including fusions of each to an appropriate fusion partner) of the invention include, but are not limited to: adhesive capsulitis, arthrofibrosis, atrial fibrosis, chronic kidney disease, cirrhosis of the liver, cystic fibrosis (CF), Dupuytren's contracture, endomyocardial fibrosis, glial scar, idiopathic pulmonary fibrosis, keloid, macular degeneration, mediastinal fibrosis, myelofibrosis, NAFLD/NASH, nephrogenic systemic fibrosis, Peyronie's disease, progressive massive fibrosis (lungs), proliferative
  • vitreoretinopathy pulmonary fibrosis, retroperitoneal fibrosis, scar tissue formation resulting from strokes, scleroderma, systemic sclerosis, tissue adhesion.
  • inflammatory diseases include, but are not limited to: allergic enteritis, alpha- 1 -antitrypsin deficiency, ankylosing spondylitis, asthma, Barrett's esophagus, Behcet's disease, chronic fatigue syndrome (CFS / CFIDS / ME), chronic Lyme disease (borreliosis), cocaine-associated vasculitis, Crohn's disease, deficiency of the Interleukin-1 Receptor
  • Antagonist DIRA
  • depression diabetes
  • Familial Mediterranean Fever FMF
  • fibromyalgia FM
  • gastroesophageal reflux disease GFD
  • glomerulonephritis graft versus host disease
  • granulomatous angiitis Hashimoto's thyroiditis
  • hypertension hyperthyroidism
  • IBD inflammatory bowel disease
  • myopathies polymyositis, inclusion body myositis, dermatomyositis), interstitial cystitis (IC), irritable bowel syndrome (IBS), ischemic colitis, kidney stones, Lofgren's syndrome, Lupus erythematosis, methamphetamine-associated vasculitis, migraine headache, Morgellon's, multiple chemical sensitivity (MCS), multiple sclerosis (MS), neonatal onset multisystem inflammatory disease (NOMID), optic neuritis, osteoarthritis, pemphigus vulgaris, polymyalgia rheumatica, prostatitis, psoriasis, psoriatic arthritis, radiation colitis, Raynaud's syndrome/phenomenon, reactive arthritis (Reiter syndrome), reflex sympathetic dystrophy (RSD), restless leg syndrome, rheumatoid arthritis (RA), sarcoidosis, sc
  • ischemic diseases include, but are not limited to: acute coronary syndrome, angina pectoris, angor animi, copeptin, coronary artery disease, coronary ischemia, hibernating myocardium, ischemic stroke, management of acute coronary syndrome, meldonium, myocardial infarction, myocardial infarction complications,
  • neurodegenerative diseases include, but are not limited to: ataxia telangiectasia, autosomal dominant cerebellar ataxia, Baggio-Yoshinari syndrome, Batten disease, estrogen and neurodegenerative diseases, hereditary motor and sensory neuropathy with proximal dominance, Infantile Refsum disease, JU Q and IPOD, locomotor ataxia, Ly me disease, Machado-Joseph disease, mental retardation and microcephaly with pontine and cerebellar hypoplasia, multiple system atrophy, neuroacanthocytosis, neuronal ceroid lipofuscinosis, Niemann-Pick disease, pontocerebellar hypoplasia, protein aggregation, pyruvate dehydrogenase deficiency, radiation myelopathy, Refsum disease, retinitis pigmentosa, Sandhoff disease, Shy-Drager syndrome, spinal muscular atrophy,
  • spinocerebellar ataxia subacute combined degeneration of spinal cord, subacute sclerosing panencephalitis, Tabes dorsalis, Tay-Sachs disease, toxic encephalopathy, toxic
  • neuropathic diseases include, but are not limited to: Bell's Palsy, campylobacter-associated motor axonopathies, Charcot-Marie-Tooth, chronic inflammatory demyelinating polyneuropathy, diabetic amyotrophy avulsion, diabetic neuropathies, Guillain Barre Syndrome and vasculitis.
  • pain disorders include, but are not limited to: Amplified musculoskeletal pain syndromes, Anterior cutaneous nerve entrapment syndrome, central pain syndrome, chronic functional abdominal pain, chronic pain, chronic prostatitis/chronic pelvic pain syndrome, chronic wound pain, degenerative disc disease, dentomandibular sensorimotor dysfunction, failed back syndrome, fibromyalgia, interstitial cystitis, irritable bowel syndrome (IBS), myofascial pain syndrome, pelvic pain, post-vasectomy pain syndrome, reflex neurovascular dystrophy, sickle-cell disease, theramine, and vulvodynia.
  • IBS irritable bowel syndrome
  • auditory disorders include, but are not limited to: conductive hearing loss, sensorineural hearing loss (SNHL), mixed hearing loss.
  • SNHL sensorineural hearing loss
  • psychiatric disorders include, but are not limited to: major depressive disorder, treatment-refractory depression, treatment-resistant depression.
  • trauma and injury examples include, but are not limited to: including central nervous system (CNS) injuries, traumatic brain injury, spinal cord injur ⁇ ', crush injuries, shock, tendon damage, wounds to the cornea, wounds to the eye, skin wounds.
  • CNS central nervous system
  • an scIL-10 proteins (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) of the invention may be used to treat patients who suffer from, for example, autoimmune disorders including autoimmune lymphoproliferative syndrome (ALPS), autoimmune thyroiditis, Crohn's disease, Grave's disease, Hashimoto's thyroiditis , Kawasaki disease, Lupus (systemic lupus erythematosus), multiple sclerosis
  • ALPS autoimmune lymphoproliferative syndrome
  • autoimmune thyroiditis Crohn's disease
  • Grave's disease Hashimoto's thyroiditis
  • Kawasaki disease Kawasaki disease
  • Lupus systemic lupus erythematosus
  • multiple sclerosis multiple sclerosis
  • MS myasthenia gravis, psoriasis, rheumatoid arthritis, Sjogren's syndrome, type 1 diabetes, ulcerative colitis
  • fibrotic diseases including Chronic Kidney Disease, cirrhosis of the liver, macular degeneration, NAFLD/NASH, proliferative vitreoretinopathy, pulmonary fibrosis, scar tissue formation resulting from strokes, tissue adhesion
  • inflammatory diseases including allergic enteritis, alpha- 1 -antitrypsin deficiency, asthma, Behcet's disease, cocaine- associated vasculitis, glomerulonephritis, Graft Versus Host Disease, granulomatous angiitis, inflammatory bowel disease, inflammatory myopathies (polymyositis, inclusion body myositis, dermatomyositis).
  • ischemic colitis methamphetamine-associated vasculitis, optic neuritis, pemphigus vulgaris, radiation colitis, sarcoidosis, Septic Shock, temporal arteritis, vasculitis; ischemic diseases including myocardial infarction, post-anoxic encephalopathy, stroke; neurodegenerative diseases including neuronal ceroid lipofuscinosis, radiation myelopathy, retinitis pigmentosa, spinal muscular atrophy; neuropathic diseases including campylobacter-associated motor axonopathies, Charcot-Marie-Tooth, chronic inflammatory demyelinating polyneuropathy, diabetic amyotrophy avulsion, diabetic neuropathies, Guillain Barre Syndrome; auditory disorders including Conductive hearing loss, Sensorineural hearing loss (SNHL), Mixed hearing loss; psychiatric disorders including major depressive disorder, treatment-refractory depression, treatment-resistant depression; trauma and injury including central nervous system (CNS) injuries, traumatic brain injury, spinal
  • scIL-10 proteins in accordance with the invention may be used to treat patients who suffer from, for example, autoimmune disorders including autoimmune lymphoproliferative syndrome (ALPS), autoimmune thyroiditis, Crohn's disease, Grave's disease, Hashimoto's thyroiditis , Kawasaki disease, Lupus (systemic lupus erythematosus), multiple sclerosis (MS), myasthenia gravis, psoriasis, rheumatoid arthritis, Sjogren's syndrome, type 1 diabetes, ulcerative colitis; fibrotic diseases including Chronic Kidney Disease, cirrhosis of the liver, macular degeneration, NAFLD/NASH, proliferative vitreoretinopathy, pulmonary fibrosis, scar tissue formation resulting from strokes, tissue adhesion; inflammatory diseases including allergic enteritis, alpha- 1 -antitrypsin de
  • ischemic diseases including myocardial infarction, post-anoxic encephalopathy, stroke; neurodegenerative diseases including neuronal ceroid lipofuscinosis, radiation myelopathy, retinitis pigmentosa, spinal muscular atrophy; neuropathic diseases including campylobacter-associated motor axonopathies, Charcot-Marie-Tooth, chronic inflammatory demyelinating polyneuropathy, diabetic amyotrophy avulsion, diabetic neuropathies, Guillain Barre Syndrome; auditory disorders including Conductive hearing loss, Sensorineural hearing loss (SNHL), Mixed hearing loss; psychiatric disorders including major depressive disorder, treatment-refractory depression, treatment-resistant depression; trauma and injury including central nervous system (CNS) injuries, traumatic brain injury, spinal cord injury, crush injuries,
  • CNS central nervous system
  • scIl-10 proteins may be used to treat patients who suffer from, for example cancer of the uterus, cervix, breast, ovaries, prostate, testes, penis, gastrointestinal tract, esophagus, oropharynx, stomach, small or large intestines, colon, or rectum, kidney, renal cell, bladder, bone, bone marrow, skin, head or neck, skin, liver, gall bladder, heart, lung, pancreas, salivary gland, adrenal gland, thyroid, brain, gliomas, ganglia, central nervous system (CNS) and peripheral nervous system (PNS), and immune system, spleen or thymus, papilloma virus-induced cancers, epithelial cell cancers, endothelial cell cancers, squamous cell carcinomas, adenocarcinomas, carcinomas, melanomas, sar
  • scIL-10 fusion proteins in accordance with the invention may be used to treat patients who suffer from auditory disorders, renal cell carcinoma, melanoma, psoriasis, fibrosis, depression, and inflammatory bowel disease (IBD).
  • IBD inflammatory bowel disease
  • scIL-10 fusion proteins (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) in accordance with the invention may also be used in the manufacture of a medicament to treat patients to diseases as set forth above,
  • compositions comprising scIL-10 proteins (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) described herein.
  • Therapeutic formulations comprising scIL-10 proteins are prepared for storage by mixing the described proteins having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of aqueous solutions, lyophilized or other dried formulations.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol;
  • buffers such as phosphate, citrate, and other organic acids
  • antioxidants including ascorbic acid and methionine
  • preservatives such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzy
  • polypeptides such as serum albumin, gelatin, or immunoglobulins
  • hydrophilic polymers such as polyvinylpyrrolidone
  • amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine
  • chelating agents such as EDTA
  • sugars such as sucrose, mannitol, trehalose or sorbitol
  • salt-forming counter-ions such as sodium
  • metal complexes e.g., Zn-protein complexes
  • non-ionic surfactants such as TWEENTM, PLURONICSTM or polyethylene glycol (PEG).
  • formulations herein may also contain more than one active compounds as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
  • scIL-10 proteins in accordance with the invention may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and
  • Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the fibronectin based scaffold proteins described herein, which matrices are in the form of shaped articles, e.g., films, or microcapsules.
  • sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or polyvinyl alcohol)), polylactides, copolymers of lactide and glycolide, copolymers of L-glutamic acid and y ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid- glycolic acid copolymers. While polymers such as ethylene-vinyl acetate and lactic acid- gly colic acid enable sustained release of, certain hydrogels release proteins for shorter time periods.
  • encapsulated proteins When encapsulated proteins remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37° C, resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S— S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
  • the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight.
  • dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1-30 mg/kg.
  • An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months.
  • Dosage regimens include 1 mg/kg body weight or 3 mg/kg body weight by intravenous administration, with the protein being given using one of the following dosing schedules: every four weeks for six dosages, then every three months; every three weeks; 3 mg/kg body weight once followed by 1 mg/kg body weight every three weeks.
  • scIL-10 fusion proteins including fusions of each to an appropriate fusion partner and dimerized complexes thereof in accordance with the invention is usually administered on multiple occasions. Intervals between single dosages can
  • INCORPORATED BY REFERENCE (RULE 20.6) be, for example, weekly, monthly, every three months or yearly. Intervals can also be irregular as indicated by measuring blood levels of the soluble protein in the patient. In some methods, dosage is adjusted to achieve a plasma concentration of soluble protein of about 0.1-1000 pg/ml and in some methods about 5- 300 mg/ml.
  • scIL-10 proteins (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) in accordance with the invention are administered to a subject, in a pharmaceutically acceptable dosage form. They can be administered intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, subcutaneous, intra-ocular, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. The protein may also be administered by intratumoral, peritumoral, intralesionaL or perilesional routes, to exert local as well as systemic therapeutic effects.
  • Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of skill in the art as the clinical situation warrants.
  • suitable carriers, diluents and/or excipients include: (1) Dulbecco's phosphate buffered saline, pH about 7.4. containing about 1 mg/ml to 25 mg/ml human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose.
  • the methods of the present invention can be practiced in vitro, in vivo, or ex vivo.
  • scIL-10 proteins including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof
  • additional therapeutic agents may occur as described above for therapeutic applications.
  • Suitable pharmaceutically acceptable carriers, diluents, and excipients for co-administration will be understood by the skilled artisan to depend on the identity of the particular therapeutic agent being co-administered.
  • scIL-10 When present in an aqueous dosage form, rather than being lyophilized, scIL-10 (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) typically will be formulated at a concentration of about 0.1 mg/ml to 100 mg/ml, although wide variation outside of these ranges is permitted.
  • the appropriate dosage of scIL-10 (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) will depend on the type of disease to be treated, the severity and course of the disease, whether the scIL-10 proteins (including fusions of scIL-10 to an appropriate fusion partner and dimerized complexes thereof) are administered for preventive or therapeutic purposes, the course of previous therapy, the patient's clinical history and response to the scIL-10 protein (including fusions of scIL-10
  • the scIL-10 protein is suitably administered to the patient at one time or over a series of treatments.
  • the scIL-10 single chain fusion body molecule contains a covalently linked IL-10 homodimer fusion protein linked to the CL-CHl-Fc (Formula 3) domain or the CHl-CL-Fc of the IgGl heavy chain (FIGs.1 and 2).
  • the amino acid sequences of each molecule synthesized is found in Table 1.
  • the genes were synthetically synthesized and supplied in pcDNA3.1 expression vector (GeneArt), and transiently expressed in HEK293 cells using the Expi293 expression
  • the molecules were analyzed by SDS PAGE gel under reducing and non-reducing conditions (FIG. 3).
  • FOG. 3 For reducing and non-reducing conditions, 2.5ug of protein was loaded onto an Any kD gel (Invitrogen) with a Precision Plus Protein Kaleidoscope standard
  • Cells were incubated for 72 hours at 37°C, 5% CO2 with varying concentrations of human IL-10 (R&D Systems), SCIL-10:CL:CH1 :FC, SCIL-10:CHI:CL:FC or scIL-10:Fc. After 72 hours, the cells were stained with CellTiter-Blue (Promega) for 4 hours at 37°C, 5% CO2 according to the manufacturer's protocol. Fluorescent measurements were taken at 560/590 nm.
  • SCIL-10:CL:CH1 :FC, SCIL-10:CHI:CL:FC, and scIL-10:Fc pharmacokinetics in mice were evaluated at a single intravenous doses of 0.5 mg/kg administered into tail vein and a single subcutaneous doses of 2.5 mg/kg administered into the interscapular region.
  • serum was pooled and concentrations were measured using standard MSD techniques.
  • Bioanalytical data was subjected to non-compartmental pharmacokinetic analysis using Phoenix WinNonlin 6.4 software.
  • the pharmacokinetic parameter included standard pharmacokinetic parameters of
  • the scIL-10 of Formula 1 are fused to a single chain Fc linker of Formula 2 wherein LI is CL-CHl-Fc as per Formula 3.
  • the ammo acid sequences of each full length scIL-10- Ll-HINGE-Fc fusion variant protein synthesized is found in Table 4.
  • the description column of Table 4 indicates the scIL-10 used in the construct with the fusion partner.
  • wtIL-10:linker:D41F indicates that in accordance with Formula 1, the first monomer subunit is wt IL-10 of SEQ ID NO: 1 and is therefore unsubstituted linked to a linker which is in turn linked to the second monomer subunit wherein the wtlLlO of SEQ ID NO: 1 is substituted at amino acid 41 such that the isoleucine at amino acid 41 is substituted with phenylalanine (D41F).
  • N-terminal leader sequence of SEQ ID NO: 48 was added to each of the protein sequences found in Table 4.
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NALRDLRDAF SRVKTFFQMK NQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT HQGLSSPVTK SFNRGECGGG GSGGGGSGGG GSGGGGSAST KGPSVFPLAP SSKSTSGGTA ALGCLVKDYF PEPVTVSWNS GALTSGVHTF PAVLQSSGLY SLSSWTVPS
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NALRDLRDAF SRVKTFFQMK DQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT HQGLSSPVTK SFNRGECGGG GSGGGGSGGG GSGGGGSAST KGPSVFPLAP SSKSTSGGTA ALGCLVKDYF PEPVTVSWNS GALTSGVHTF PAVLQSSGLY SLSSWTVPS
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NALRDLRDAF SRVKTFFQMK FQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT HQGLSSPVTK SFNRGECGGG GSGGGGSGGG GSGGGGSAST KGPSVFPLAP SSKSTSGGTA ALGCLVKDYF PEPVTVSWNS GALTSGVHTF PAVLQSSGLY SLSSWTVPS
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NMLRDLRDAF SRVKTFFQMK DQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NMLRDLRDAF SRVKTFFQMK DQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT HQGLSSPVTK SFNRGECGGG GSGGGGSGGG GSGGGGSAST KGPSVFPLAP SSKSTSGGTA ALGCLVKDYF PEPVTVSWNS GALTSGVHTF PAVLQSSGLY SLSSWTV
  • D41F:linker:D41F (Rl SRVKTFFQMK FQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA mutant) ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NMLRDLRDAF SRVKTFFQMK FQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT HQGLSSPVTK SFNRGECGGG GSGGGGSGGG GSGGGGSAST KGPSVFPLAP SSKSTSGGTA ALGCLVKDYF PEPVTVSWNS GALTSGVHTF PAVLQSSGLY SLSSWTV
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NMLRDLRDAF SRVKTFFQMK DQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT HQGLSSPVTK SFNRGECGGG GSGGGGSGGG GSGGGGSAST KGPSVFPLAP SSKSTSGGTA ALGCLVKDYF PEPVTVSWNS GALTSGVHTF PAVLQSSGLY SLSSWTV
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NALRDLRDAF SRVKTFFQMK FQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT HQGLSSPVTK SFNRGECGGG GSGGGGSGGG GSGGGGSAST KGPSVFPLAP SSKSTSGGTA ALGCLVKDYF PEPVTVSWNS GALTSGVHTF PAVLQSSGLY SLSSWTVPS
  • LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGSGGGGSGG SPGQGTQSEN SCTHFPGNLP NALRDLRDAF SRVKTFFQMK FQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN GGGGSGGGGS RTVAAPSVFI FPPSDEQLKS GTASWCLLN NFYPREAKVQ WKVDNALQSG NSQESVTEQD SKDSTYSLSS TLTLSKADYE KHKVYACEVT HQGLSSPVTK SFNRGECGGG GSGGGGSGGG GSGGGGSAST KGPSVFPLAP SSKSTSGGTA ALGCLVKDYF PEPVTVSWNS GALTSGVHTF PAVLQSSGLY SLSSWTVPS
  • the genes were synthetically synthesized and supplied in pcDNA3.1 expression vector (GeneArt), and transiently expressed in HEK293 cells using the Expi293 expression system (Life Technologies). Proteins were purified using Protein A (GE Healthcare) with low pH elution and dialyzed against 2L IX PBS 2 times.
  • the molecules were analyzed by SDS PAGE gel under reducing and non-reducing conditions. For reducing and non-reducing conditions, 2.5ug of protein was loaded onto an Any kD gel (Invitrogen) with a Precision Plus Protein Kaleidoscope standard (Invitrogen) (MW range lOkD - 250 kD). The molecule was characterized by analytical gel filtration on an XBridge Protein BEH SEC column, 200A, 3.5 ⁇ , 7.8 mm X 150 mm (Waters). The column was equilibrated and run at 0.9 ml/min with lOOmM sodium phosphate pH 7.0 as a running buffer for all analyses. Purified samples (0.5mg/ml) were injected (15ul) and eluted with a run time of 15 min.
  • PBMCs cells were plated at 50,000 cells/well in RPMI media containing 10% heat inactivated fetal bovine serum. Cells were incubated for 18 hours at 37°C, 5% CC with 100 ng/mL LPS and varying concentrations of the scIL-10 constructs (R&D Systems). After 18 hours, TNFa production was measured using V-Plex mouse TNFa MSD (Mesoscale Discovery). See Tables 5 and 6 below for IC50 values.
  • MC/9 mouse mast cell line
  • ATCC CRL-8306 mouse mast cell line
  • MC/9 cells were plated at 10,000 cells/well in DMEM media containing 10% heat inactivated fetal bovine serum, 2 mM glutamine and 0.05 mM 2-mercaptoethanol. Cells were incubated for 72 hours at 37°C, 5% CCh with varying concentrations of human IL-10 (R&D Systems), RDB3515, RDB3516 or RDB3509. After 72 hours, the cells were stained with CellTiter-Blue
  • the ratio for WT IL-10 was ⁇ 11.
  • the ratio for SEQ ID NO: 12 was 1000, showing thatjust by building the scIL-10 sequence on the CL:CHl:Fc scaffold, the anti-inflammatory window is increased.
  • the following experiments were conducted with various configurations of scIL-10 molecules of Formula 1 including unsubstituted scIL-10, scIL-10 variants and LINKER lengths of various sizes on the CL:CHl :Fc scaffold.
  • Mutations that simultaneously disrupt one of the IL-10R1 and one of the IL-10R2 interfaces were explored as illustrated in FIG. 8. Mutations located in the IL-10R1 and IL- 10R2 sites from the same side of the scIL-10 fused dimer (SEQ ID NOS: 26 AND 27) demonstrate weakened potency for both anti-inflammatory and immunostimulatory activities; one of those combinations (SEQ ID NO: 27) displays a significantly increased antiinflammatory window size. Mutations located in an IL-10R1 interface and an IL-10R2 interface from opposite sides of the scIL-10 fused dimer (SEQ ID NOS: 28 and 29) display weakened anti-inflammatory potency, and no measurable immunostimulatory activities at the concentrations tested.
  • IL-10 receptor signal transduction requires IL-10R1 and IL-10R2 to be clustered following IL-10 binding
  • these data indicate that the optimal strategy for attenuating immunstimulatory activity (and thereby increasing the anti-inflammatory window) is to target both of the pairs of IL-10R1/IL-10R2 receptor chains.
  • the IL-10R1 interface scan revealed that signaling requires that at least one IL-10R1 interface be competent for binding, it is necessary to target the IL-10R2 interface on the opposite side of the scIL-10 fused dimer, to effectively disrupt both pairs of IL-10R1/IL-10R2 receptor chains that cluster upon scIL- 10 binding. This pattern of mutations more dramatically modulates scIL-10 bioactivity on cells that mediate immunostimulation, while the cells that mediate the anti-inflammatory effects remain quite sensitive to scIL-10 signaling.
  • N-terminal leader sequence of SEQ ID NO: 48 was added to each of the protein sequences found in Table 7.
  • the amino acid sequences of each fusion protein are found in Table 7. Expression of peptides are as described in Example 2. Bioactivity of was tested in a mouse PBMC cytokine release assay and an MC/9 assay as described in Example 2. The results are found in Table 5 of Example 2. The results show that decreasing the size of the linker reduces the size of the anti-inflammatory window, implying that the linker length affects the strength of the IL-10R1 and IL-10R2 interfaces in ways that reduce the selectivity for anti-inflammatory potency over immunostimulatory potency.
  • Example 4 Modulating the anti-inflammatory window of scIL-10 via steric crowding.
  • Bioactivity of SEQ ID NOS 45 and 46 will be further tested in a mouse PBMC cytokine release assay and an MC/9 assay as described in Example 2. The results will show that the scIL-10 moiety, absent any fusion partner, demonstrates highly potent bioactivity, consistent with the trends observed for scIL-10 Fc fusion proteins.
  • the scIL-10 of Formula l was fused to a mucin domain linker comprising a tandem repeat of MUC 20 which in turn was fused to an Fc domain.
  • the amino acid sequence of the (scIL-10 (5aa linker))-(mucin linker)-Fc is found in Table 10.
  • the N-terminal leader sequence of SEQ ID NO: 48 was added to the protein found in Table 11.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
PCT/US2017/038747 2016-06-22 2017-06-22 Compositions and methods for modulating il-10 immunostimulatory and anti-inflammatory properties Ceased WO2018005226A2 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
NZ748787A NZ748787B2 (en) 2016-06-22 2017-06-22 Compositions and methods for modulating il-10 immunostimulatory and anti-inflammatory properties
JP2018566552A JP7084881B2 (ja) 2016-06-22 2017-06-22 Il-10の免疫刺激特性および抗炎症特性を調節するための組成物および方法
CA3026393A CA3026393C (en) 2016-06-22 2017-06-22 Compositions and methods for modulating il-10 immunostimulatory and anti-inflammatory properties
EP17820960.7A EP3474884A4 (en) 2016-06-22 2017-06-22 COMPOSITIONS AND METHODS FOR MODULATING THE IMMUNOSTIMULANT AND ANTI-INFLAMMATORY PROPERTIES OF IL-10
AU2017291321A AU2017291321B2 (en) 2016-06-22 2017-06-22 Compositions and methods for modulating IL-10 immunostimulatory and anti-inflammatory properties
AU2020204457A AU2020204457A1 (en) 2016-06-22 2020-07-03 Compositions and methods for modulating il-10 immunostimulatory and anti-inflammatory properties

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662353478P 2016-06-22 2016-06-22
US62/353,478 2016-06-22

Publications (2)

Publication Number Publication Date
WO2018005226A2 true WO2018005226A2 (en) 2018-01-04
WO2018005226A3 WO2018005226A3 (en) 2018-04-05

Family

ID=60674961

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/038747 Ceased WO2018005226A2 (en) 2016-06-22 2017-06-22 Compositions and methods for modulating il-10 immunostimulatory and anti-inflammatory properties

Country Status (6)

Country Link
US (2) US10335459B2 (enExample)
EP (1) EP3474884A4 (enExample)
JP (1) JP7084881B2 (enExample)
AU (2) AU2017291321B2 (enExample)
CA (1) CA3026393C (enExample)
WO (1) WO2018005226A2 (enExample)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3233920A4 (en) * 2014-12-19 2018-07-25 Alkermes, Inc. Single chain fc fusion proteins
US10335459B2 (en) 2016-06-22 2019-07-02 Alkermes, Inc. Compositions for modulating IL-10 immunostimulatory and anti-inflammatory properties
WO2020172631A3 (en) * 2019-02-21 2020-10-08 Xencor, Inc. Untargeted and targeted il-10 fc-fusion proteins
US12054495B2 (en) 2019-11-25 2024-08-06 Alkermes, Inc. Substituted macrocyclic compounds and related methods of treatment
US12441710B2 (en) 2020-12-21 2025-10-14 Alkermes, Inc. Substituted piperidino compounds and related methods of treatment

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015171965A2 (en) 2014-05-07 2015-11-12 Applied Molecular Transport Llc Cholix toxin-derived fusion molecules for oral delivery of biologically active cargo
US11246915B2 (en) 2010-09-15 2022-02-15 Applied Molecular Transport Inc. Cholix toxin-derived fusion molecules for oral delivery of biologically active cargo
US9090691B2 (en) 2010-09-15 2015-07-28 Applied Molecular Transport Llc Systems and methods of delivery of bioactive agents using bacterial toxin-derived transport sequences
KR20210005602A (ko) * 2018-03-23 2021-01-14 가비쉬-가릴리 바이오 어플리케이션스 리미티드. 막-결합된 IL-10을 발현하는 유전자 리프로그래밍된 Treg
KR20210110294A (ko) 2018-11-07 2021-09-07 어플라이드 몰레큘라 트랜스포트 인크. 통과세포외배출용 전달 구조체 및 관련 방법
WO2021034727A1 (en) 2019-08-16 2021-02-25 Applied Molecular Transport Inc. Compositions, formulations, and interleukin production and purification
EP3795583A1 (en) * 2019-09-19 2021-03-24 Ecole Polytechnique Federale de Lausanne (EPFL) Il10/fc fusion proteins useful as enhancers of immunotherapies
CN112625137B (zh) * 2019-10-08 2021-10-08 北京东方百泰生物科技股份有限公司 一种人白细胞介素10-Fc融合蛋白及其医药用途
US20230103554A1 (en) * 2020-04-03 2023-04-06 Baylor College Of Medicine TNFa SIGNALING TRIGGERS TUMOR-PROMOTING INFLAMMATION THAT CAN BE TARGETED TO THERAPY
MX2022014239A (es) * 2020-05-12 2023-02-09 Regeneron Pharma Nuevos agonistas de il10 y metodos para su uso.
WO2021243057A1 (en) * 2020-05-28 2021-12-02 The Board Of Trustees Of The Leland Stanford Junior University Engineered interleukin-10 polypeptides and uses thereof
EP4612165A1 (en) * 2022-11-02 2025-09-10 Synerkine Pharma B.V. Engineered immunocytokines, fusion polypeptides, and il10 polypeptides
WO2024131864A1 (zh) * 2022-12-21 2024-06-27 广东菲鹏制药股份有限公司 一种il-10单体融合蛋白
WO2024144336A1 (ko) * 2022-12-30 2024-07-04 주식회사 프로젠 신규 이중 특이성 융합단백질 및 그의 용도
TW202502807A (zh) * 2023-06-02 2025-01-16 美商新舍凱公司 融合il10多肽

Family Cites Families (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE10399023I2 (de) 1989-09-12 2006-11-23 Ahp Mfg B V TFN-bindende Proteine
JP2002530066A (ja) 1998-11-19 2002-09-17 スミスクライン・ビーチャム・コーポレイション Rhammアンタゴニスト抗体
US6428985B1 (en) * 1998-12-02 2002-08-06 The Regents Of The University Of Michigan Immunosuppressive structural definition of IL-10
JP4944324B2 (ja) 1999-07-13 2012-05-30 ボルダー バイオテクノロジー, インコーポレイテッド 免疫グロブリン融合タンパク質
AU2001231532A1 (en) 2000-02-11 2001-08-20 Maxygen Aps Improved interleukin 10
WO2004044006A1 (en) * 2002-11-14 2004-05-27 Maxygen, Inc. Conjugates of interleukin-10 and polymers
DE602004031390D1 (de) 2003-05-06 2011-03-24 Syntonix Pharmaceuticals Inc Gerinnungsfaktor VII-Fc chimäre Proteine zur Behandlung von hämostatischen Krankheiten
US7696322B2 (en) 2003-07-28 2010-04-13 Catalent Pharma Solutions, Inc. Fusion antibodies
US20150071948A1 (en) 2003-09-26 2015-03-12 Gregory Alan Lazar Novel immunoglobulin variants
WO2008140595A2 (en) 2006-12-01 2008-11-20 President And Fellows Of Harvard College Synthetic trivalent haptens, complexes thereof, and uses therefor
AU2010334974A1 (en) 2009-12-22 2012-07-12 Novartis Ag Tetravalent CD47-antibody constant region fusion protein for use in therapy
EP2519544A1 (en) * 2009-12-29 2012-11-07 Emergent Product Development Seattle, LLC Polypeptide heterodimers and uses thereof
AR080993A1 (es) 2010-04-02 2012-05-30 Hanmi Holdings Co Ltd Formulacion de accion prolongada de interferon beta donde se usa un fragmento de inmunoglobulina
AU2011226992B2 (en) 2010-05-10 2012-03-22 Ascend Biopharmaceuticals Pty Ltd Immunostimulatory and vaccine compositions
CN101962413B (zh) 2010-09-21 2013-03-13 中国科学技术大学 具有透皮能力和白细胞介素-10活性的融合蛋白及其编码基因与应用
KR101333958B1 (ko) 2010-10-20 2013-11-27 주식회사 한독 인간 인터루킨-1 수용체 길항제-하이브리드 Fc 융합단백질
EP2457579A1 (en) * 2010-11-26 2012-05-30 Technische Universität Dresden Covalently linked interleukin -10
TWI803876B (zh) 2011-03-28 2023-06-01 法商賽諾菲公司 具有交叉結合區定向之雙重可變區類抗體結合蛋白
EA201892619A1 (ru) * 2011-04-29 2019-04-30 Роше Гликарт Аг Иммуноконъюгаты, содержащие мутантные полипептиды интерлейкина-2
ES2758884T3 (es) 2011-06-24 2020-05-06 Stephen D Gillies Proteínas de fusión de inmunoglobulina a través de cadena ligera y métodos de uso de ellas
PT2748201T (pt) 2011-08-23 2018-02-08 Roche Glycart Ag Moléculas de ligação ao antigénio biespecíficas que ativam as células t
US9062120B2 (en) 2012-05-02 2015-06-23 Janssen Biotech, Inc. Binding proteins having tethered light chains
WO2013184938A2 (en) * 2012-06-08 2013-12-12 Alkermes. Inc. Fusion polypeptides comprising mucin-domain polypeptide linkers
AU2013293092A1 (en) 2012-07-23 2015-02-26 Zymeworks Inc. Immunoglobulin constructs comprising selective pairing of the light and heavy chains
MA20150232A1 (fr) * 2012-08-08 2015-07-31 Roche Glycart Ag Protéines de fusion de l'interleukine-10 et leurs utilisations
AU2014236769B2 (en) 2013-03-15 2018-09-27 Amgen Inc. Heterodimeric bispecific antibodies
AU2014257123A1 (en) 2013-04-24 2015-10-15 Armo Biosciences, Inc. Interleukin-10 compositions and uses thereof
KR20250152665A (ko) 2013-07-31 2025-10-23 암젠 인크 Fc-함유 폴리펩타이드의 안정화
EP3102594A1 (en) 2014-02-06 2016-12-14 F. Hoffmann-La Roche AG Interleukine 10 immunoconjugates
CN104403004B (zh) 2014-11-24 2017-10-13 苏州丁孚靶点生物技术有限公司 抗体‑干扰素异二聚体的制备和用途
US20160175458A1 (en) 2014-12-19 2016-06-23 Alkermes, Inc. Single chain fc fusion proteins
US11291721B2 (en) 2016-03-21 2022-04-05 Marengo Therapeutics, Inc. Multispecific and multifunctional molecules and uses thereof
EP3474884A4 (en) 2016-06-22 2020-08-19 Alkermes, Inc. COMPOSITIONS AND METHODS FOR MODULATING THE IMMUNOSTIMULANT AND ANTI-INFLAMMATORY PROPERTIES OF IL-10

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3233920A4 (en) * 2014-12-19 2018-07-25 Alkermes, Inc. Single chain fc fusion proteins
US10881741B2 (en) 2014-12-19 2021-01-05 Alkermes, Inc. Single chain Fc fusion proteins
US10335459B2 (en) 2016-06-22 2019-07-02 Alkermes, Inc. Compositions for modulating IL-10 immunostimulatory and anti-inflammatory properties
US11534480B2 (en) 2016-06-22 2022-12-27 Alkermes, Inc. Compositions and methods for modulating IL-10 immunostimulatory and anti-inflammatory properties
WO2020172631A3 (en) * 2019-02-21 2020-10-08 Xencor, Inc. Untargeted and targeted il-10 fc-fusion proteins
US12006345B2 (en) 2019-02-21 2024-06-11 Xencor, Inc. Untargeted and targeted IL-10 Fc-fusion proteins
US12054495B2 (en) 2019-11-25 2024-08-06 Alkermes, Inc. Substituted macrocyclic compounds and related methods of treatment
US12441710B2 (en) 2020-12-21 2025-10-14 Alkermes, Inc. Substituted piperidino compounds and related methods of treatment

Also Published As

Publication number Publication date
CA3026393C (en) 2023-03-14
AU2017291321A1 (en) 2018-12-13
WO2018005226A3 (en) 2018-04-05
US20190336582A1 (en) 2019-11-07
US11534480B2 (en) 2022-12-27
JP7084881B2 (ja) 2022-06-15
JP2019527200A (ja) 2019-09-26
NZ748787A (en) 2021-06-25
EP3474884A4 (en) 2020-08-19
AU2017291321B2 (en) 2020-06-18
CA3026393A1 (en) 2018-01-04
AU2020204457A1 (en) 2020-07-23
US10335459B2 (en) 2019-07-02
EP3474884A2 (en) 2019-05-01
US20170368144A1 (en) 2017-12-28

Similar Documents

Publication Publication Date Title
US11534480B2 (en) Compositions and methods for modulating IL-10 immunostimulatory and anti-inflammatory properties
AU2018247255B2 (en) Single chain fc fusion proteins
JP7421338B2 (ja) 免疫調節融合タンパク質
DK2604693T3 (en) Single-chain TNFSF molecules
AU2024219567A1 (en) Cytokine-based bioactivatable drugs and methods of uses thereof
AU2020291942A1 (en) Novel interleukin-2 variants for the treatment of cancer
CN108948207A (zh) 一种人白细胞介素10-Fc融合蛋白及其编码基因与应用
JP2023096044A (ja) 免疫調節融合タンパク質
JP2023554097A (ja) 二機能性抗pd1/il-7分子
CN104974262A (zh) 新型重组双功能融合蛋白及其制法和用途
US20230303648A1 (en) Bifunctional molecules comprising an il-7 variant
NZ748787B2 (en) Compositions and methods for modulating il-10 immunostimulatory and anti-inflammatory properties
TW202421649A (zh) 用於治療慢性病毒感染之cd8抗原結合分子之融合體
US20240252601A1 (en) Ace2 fusion proteins and uses thereof
EP4359429A1 (en) Interleukin 15 variants
CN117597356A (zh) 基于白细胞介素-15的免疫细胞因子
HK1242337B (en) Single chain fc fusion proteins

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17820960

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3026393

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017291321

Country of ref document: AU

Date of ref document: 20170622

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018566552

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017820960

Country of ref document: EP

Effective date: 20190122