WO2017140831A1 - Antibodies for il-17c - Google Patents
Antibodies for il-17c Download PDFInfo
- Publication number
- WO2017140831A1 WO2017140831A1 PCT/EP2017/053592 EP2017053592W WO2017140831A1 WO 2017140831 A1 WO2017140831 A1 WO 2017140831A1 EP 2017053592 W EP2017053592 W EP 2017053592W WO 2017140831 A1 WO2017140831 A1 WO 2017140831A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- region
- antibody fragment
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present application relates to antibodies or antibody fragments which interact with human IL-17C.
- the invention also relates to nucleic acids, vectors and host cells capable of expressing said antibodies or fragments thereof, pharmaceutical compositions comprising said antibodies or fragments thereof and uses of said antibodies or fragments thereof for the treatment of specific diseases.
- IL-17C is a secreted homodimer of the IL17 protein family. In vitro it has been shown that IL-17C stimulates the release of TNF-a and IL- ⁇ ⁇ from the monocytic cell line THP-1 (Li er a/. (2000) Proc. Natl. Acad. Sci. U. S. A. 97, 773-8). IL-17C can induce the mRNA expression of inflammatory cytokines such as IL- ⁇ ⁇ , IL-6 and IL-23 in peritoneal exudates cells (PECS) and the 3T3 cell line (Yamaguchi et al. (2007) J. Immunol 179, 7128-36).
- PECS peritoneal exudates cells
- WO 2013/057241 Recently in WO 2013/057241 it was experimentally evaluated that inhibition of IL-17C is a promising approach to treat inflammatory disorders.
- respective antibodies used in WO 2013/057241 were surrogate antibodies specific for mouse IL- 7C, but were shown not to be reactive to human IL-17C at all.
- further antibodies that antagonize IL-17C were already suggested (e.g. in WO 1999/060127), but are either polyclonal sera or surrogate antibodies which specifically bind to mouse IL-17C only.
- the present disclosure provides novel antibodies and antibody fragments.
- the antibodies and antibody fragments disclosed herein bind to human IL-17C and also cross-react with IL-17C from the cynomolgus monkey and the mouse.
- the disclosed antibodies inhibit binding of IL-17C to its receptor throughout the relevant species - human, mouse and cynomolgus monkey - with an IC50 concentration of 80 pM or less.
- said antibodies proved to be effective in various in vivo mouse models for atopic dermatitis and psoriasis.
- the disclosed antibodies or antibody fragments are superior in terms of effectiveness and provide well suited and promising compounds for the treatment of humans having, for example; atopic dermatitis or psoriasis.
- the present disclosure provides antibodies or antibody fragments that bind to human IL-17C having CDR regions according to Table 1 of the present specification.
- the present disclosure also provides specific antibodies or antibody fragments having a variable heavy chain region and a variable light chain CDR regions comprising the amino acid sequences according to Table 1 of the present specification.
- the present disclosure also provides specific antibodies or antibody fragments which compete with the specific antibodies or antibody fragments disclosed herein.
- the present disclosure also provides specific antibodies or antibody fragments which bind to the same epitope as the specific antibodies or antibody fragments disclosed herein.
- the present disclosure also provides the isolated antibodies or antibody fragments of the present disclosure for use in medicine.
- the present disclosure also provides also provides methods for treating a subject suffering from a disorder, such as an inflammatory disorder, by administering to said subject an effective amount of the antibodies or antibody fragments of the present disclosure.
- a disorder such as an inflammatory disorder
- Preferably said subject is a human.
- the present disclosure also provides pharmaceutical compositions comprising the isolated antibodies or antibody fragments of the present disclosure, and a pharmaceutically acceptable carrier.
- the present disclosure also provides nucleic acids encoding the antibodies or antibody fragments of the present disclosure.
- the present disclosure also provides vectors comprising nucleic acids encoding the antibodies or antibody fragment antibodies of the present disclosure.
- the present disclosure also provides host cell comprising vector or nucleic acids encoding the antibodies or antibody fragments of the present disclosure.
- Utilization of the claimed antibodies or antibody fragments is to alter the biological activity of human IL-17C.
- the claimed antibodies or antibody fragments are for therapeutic use, such as the treatment of inflammatory disorders like e.g. rheumatoid arthritis, psoriasis, pulmonary inflammation, COPD and/or the treatment of atopic dermatitis (AD), including moderate-to-severe AD.
- inflammatory disorders like e.g. rheumatoid arthritis, psoriasis, pulmonary inflammation, COPD and/or the treatment of atopic dermatitis (AD), including moderate-to-severe AD.
- AD atopic dermatitis
- Figure 1 MAB#1 dose-dependently prevents the ear thickening induced by topical application of MC903 on ear skin.
- FIG. 1 MAB#1 dose-dependently reduces the ear inflammation induced by topical application of MC903 on ear skin.
- Ear inflammation was assessed at Day 5 using in vivo imaging.
- Statistical significance versus MC903+MOR03207 was calculated using ANOVA and Dunnett's multiple comparison test: * p ⁇ 0.05; ** p ⁇ 0.01 ; *** p ⁇ 0.001.
- Right panel representative images of mouse ears from animals from different treatment groups were acquired on the Bruker !n-vivo Xtreme Imager 24h after injection of the Prosense 680 probe. (DEX: dexamethasone; EtOH: ethanol)
- FIG. 3 MAB#1 dose-dependently reduces the thickening of epidermal and dermal skin layer induced by topical application of MC903 on ear skin.
- IL-33 expresssion in ear and TARC levels in plasma.
- Figure 7 Therapeutic administration of MAB#1 dose-dependently reduces the thickening of epidermal and dermal skin layer induced by topical
- Figure 8 Therapeutic administration of MAB#1 dose-dependently reduces the dermal infiltration of eosinophils, T cells and mast cells.
- the disclosure pertains to a number of antibodies or antibody fragments that recognize human IL-17C.
- IL-17C refers to a protein known as interleukin 17C.
- Human IL-17C has the amino acid sequence of (UniProt Q9P0M4):
- Mouse IL-17C has the amino acid sequence of (UniProt Q8K4C5):
- Cynomolgus monkey IL-17C has the amino acid sequence of (XP_005592825.1 ):
- IL17RA refers to a protein known as interleukin 17 receptor A. Human IL17RA has the amino acid sequence of (UniProt Q96F46):
- IL17RE refers to a protein known as interleukin 17 receptor E.
- Human IL17RE has the amino acid sequence of (UniProt Q8NFR9): GSSRLAALLLPLLLIVIDLSDSAGIGFRHLPHWNTRCPLASHTDDSFTGSSAYIPCRT
- Murine IL17RE has the amino acid sequence of (UniProt Q8BH06):
- an IL-17C antagonist includes, but is not limited to, antibodies or antibody fragments specifically binding to IL-17C.
- an IL-17C antagonist in the present disclosure is an antibody specific for human IL-17C.
- Such an antibody may be of any type, such as a murine, a rat, a chimeric, a humanized or a human antibody.
- antibody refers to a protein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds which interacts with an antigen.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FR's arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, and FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- antibody includes for example, monoclonal antibodies, human antibodies, humanized antibodies, camelised antibodies and chimeric antibodies.
- the antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2) or subclass. Both the light and heavy chains are divided into regions of structural and functional homology.
- antibody fragment refers to one or more portions of an antibody that retain the ability to specifically interact with (e.g., by binding, steric hindrance, stabilizing spatial distribution) an antigen.
- binding fragments include, but are not limited to, a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH1 domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et a/., (1989) Nature 341 :544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- F(ab)2 fragment
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et a/., (1988) Science 242:423-426; and Huston et a/. , (1988) Proc. Natl. Acad. Sci. 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term "antibody fragment”.
- Antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
- Antibody fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, (2005) Nature Biotechnology 23: 1126-1 136).
- Antibody fragments can be grafted into scaffolds based on polypeptides such as Fibronectin type III (Fn3) (see U.S. Pat. No. 6,703, 199, which describes fibronectin polypeptide monobodies).
- Fn3 Fibronectin type III
- Antibody fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (VH-CH1 -VH-CH1 ) which, together with complementary light chain polypeptides, form a pair of antigen-binding sites (Zapata et a/., (1995) Protein Eng. 8: 1057-1062; and U.S. Pat. No. 5,641 ,870).
- a “human antibody” or “human antibody fragment”, as used herein, includes antibodies and antibody fragments having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region also is derived from such sequences.
- Human origin includes, e.g., human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik et a/. , (2000) J Mol Biol 296:57-86).
- immunoglobulin variable domains e.g., CDRs
- CDRs may be defined using well known numbering schemes, e.g., the Kabat numbering scheme, the Chothia numbering scheme, or a combination of Kabat and Chothia (see, e.g., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services (1991 ), eds. Kabat et al. , Lazikani et a/. , (1997) J. Mol. Bio. 273:927-948); Kabat et al. , (1991 ) Sequences of Proteins of Immunological Interest, 5th edit., NIH Publication no. 91 -3242 U.S.
- a “humanized antibody” or “humanized antibody fragment” is defined herein as an antibody molecule which has constant antibody regions derived from sequences of human origin and the variable antibody regions or parts thereof or only the CDRs are derived from another species.
- a humanized antibody can be CDR-g rafted, wherein the CDRs of the variable domain are from a non-human origin, while one or more frameworks of the variable domain are of human origin and the constant domain (if any) is of human origin.
- chimeric antibody or “chimeric antibody fragment” is defined herein as an antibody molecule which has constant antibody regions derived from, or corresponding to, sequences found in one species and variable antibody regions derived from another species.
- the constant antibody regions are derived from, or corresponding to, sequences found in humans
- the variable antibody regions are derived from sequences found in a non-human animal, e.g. a mouse, rat, rabbit or hamster.
- isolated refers to a compound, which can be e.g. an antibody or antibody fragment, that is substantially free of other antibodies or antibody fragments having different antigenic specificities. Moreover, an isolated antibody or antibody fragment may be substantially free of other cellular material and/or chemicals. Thus, in some aspects, antibodies provided are isolated antibodies which have been separated from antibodies with a different specificity. An isolated antibody may be a monoclonal antibody. An isolated antibody may be a recombinant monoclonal antibody. An isolated antibody that specifically binds to an epitope, isoform or variant of a target may, however, have cross-reactivity to other related antigens, e.g., from other species (e.g., species homologs).
- recombinant antibody includes all antibodies that are prepared, expressed, created or segregated by means not existing in nature. For example antibodies isolated from a host cell transformed to express the antibody, antibodies selected and isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences or antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom.
- recombinant antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences.
- such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- a recombinant antibody may be a monoclonal antibody.
- the antibodies and antibody fragment disclosed herein are isolated from the Ylanthia ® antibody library as disclosed in US 13/321 ,564 or US 13/299,367, which both herein are incorporated by reference.
- monoclonal antibody refers to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a unique binding site having a unique binding specificity and affinity for particular epitopes.
- an antibody or antibody fragment that specifically binds to a target is an antibody or antibody fragment that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
- an antibody or antibody fragment specifically binds to an epitope on a protein that is conserved among the protein from different species.
- specific binding can include, but does not require exclusive binding.
- the antibodies or antibody fragments disclosed herein specifically bind to human IL-17C.
- the disclosed antibodies or antibody fragments specific for human IL-17C specifically bind to IL-17C of another species, such as IL-17C from mouse, rat, rhesus monkey and/or cynomolgus monkey. Even more preferred the antibodies or antibody fragments disclosed herein are specific for human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C.
- Methods for determining whether two molecules specifically bind include, for example, a standard ELISA assay.
- the scoring may be carried out by standard color development (e.g. secondary antibody with horseradish peroxide and tetramethyl benzidine with hydrogen peroxide).
- the reaction in certain wells is scored by the optical density, for example, at 450 nm.
- determination of binding specificity is performed by using not a single reference antigen, but a set of about three to five unrelated antigens, such as milk powder, BSA, transferrin or the like.
- the term "avidity” is used to describe the combined strength of multiple bond interactions between proteins. Avidity is distinct from affinity which describes the strength of a single bond. As such, avidity is the combined synergistic strength of bond affinities (functional affinity) rather than the sum of bonds.
- both antigen-binding sites from the VHA L pairs simultaneously interact with IL-17C . Whilst each single binding interaction may be readily broken (depending on the relative affinity), because many binding interactions are present at the same time, transient unbinding of a single site does not allow the molecule to diffuse away, and binding of that site is likely to be reinstated. The overall effect is synergistic, strong binding of antigen to antibody.
- affinity refers to the strength of interaction between the polypeptide and its target at a single site. Within each site, the binding region of the polypeptide interacts through weak non-covalent forces with its target at numerous sites; the more interactions, the stronger the affinity.
- KD refers to the dissociation constant, which is obtained from the ratio of Kd to K a (i.e. K K a ) and is expressed as a molar concentration (M).
- KD values for antigen binding moieties like e.g. monoclonal antibodies can be determined using methods well established in the art. Methods for determining the KD of an antigen binding moiety like e.g. a monoclonal antibody are SET (soluble equilibrium titration) or surface plasmon resonance using a biosensor system such as a Biacore® system.
- an antibody specific to IL-17C typically has a dissociation rate constant (KD) (k 0 ff/k on ) of less than 5x10 2 M, less than 10 2 M, less than 5x10 3 M, less than 10 3 M, less than 5x10 4 M, less than 10 M, less than 5x10 5 M, less than 10 S M, less than 5x10 "6 M, less than 10 6 M, less than 5x10 7 M, less than 10 7 M, less than 5x10 8 M, less than 10 "8 M, less than 5x10 9 M, less than 10 9 M, less than 5x10 0 M, less than 10 "
- KD dissociation rate constant
- Cross-competes means the ability of an antibody, antibody fragment or other antigen- binding moieties to interfere with the binding of other antibodies, antibody fragments or antigen- binding moieties to a specific antigen in a standard competitive binding assay.
- the ability or extent to which an antibody, antibody fragment or other antigen-binding moieties is able to interfere with the binding of another antibody, antibody fragment or antigen-binding moieties to a specific antigen, and, therefore whether it can be said to cross-compete according to the invention, can be determined using standard competition binding assays.
- One suitable assay involves the use of the Biacore technology (e.g.
- Cross-competition is present if the antibody or antibody fragment under investigation reduces the binding of one of the antibodies described in Table 1 to IL-17C by 60% or more, specifically by 70% or more and more specifically by 80% or more and if one of the antibodies described in Table 1 reduces the binding of said antibody or antibody fragment to IL-17C by 60% or more, specifically by 70% or more and more specifically by 80% or more.
- epitope includes any proteinacious region which is specifically recognized by an antibody or fragment thereof or a T-cell receptor or otherwise interacts with a molecule.
- epitopes are of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and generally may have specific three-dimensional structural characteristics, as well as specific charge characteristics. As will be appreciated by one of skill in the art, practically anything to which an antibody can specifically bind could be an epitope.
- “Binds the same epitope as” means the ability of an antibody, antibody fragment or other antigen-binding moiety to bind to a specific antigen and binding to the same epitope as the exemplified antibody when using the same epitope mapping technique for comparing the antibodies.
- the epitopes of the exemplified antibody and other antibodies can be determined using epitope mapping techniques.
- Epitope mapping techniques are well known in the art. For example, conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two- dimensional nuclear magnetic resonance. Compositions of the present disclosure may be used for therapeutic or prophylactic applications.
- the present disclosure therefore, includes a pharmaceutical composition containing an antibody (or functional antibody fragment) as disclosed herein and a pharmaceutically acceptable carrier or excipient therefor.
- the present disclosure provides a method for treating an inflammatory disorder. Such method contains the steps of administering to a subject in need thereof an effective amount of the pharmaceutical composition that contains an antibody (or functional antibody fragment) as described or contemplated herein.
- the present disclosure provides therapeutic methods comprising the administration of a therapeutically effective amount of an IL-17C antibody as disclosed to a subject in need of such treatment.
- a “therapeutically effective amount” or “effective amount”, as used herein, refers to the amount of an IL-17C antibody necessary to elicit the desired biological response.
- the therapeutic effective amount is the amount of an IL-17C antibody necessary to treat and/or prevent a disease.
- Subject or “species”, as used in this context refers to any mammal, including rodents, such as mouse or rat, and primates, such as cynomolgus monkey (Macaca fascicularis), rhesus monkey (Macaca mulatta) or humans (Homo sapiens).
- rodents such as mouse or rat
- primates such as cynomolgus monkey (Macaca fascicularis), rhesus monkey (Macaca mulatta) or humans (Homo sapiens).
- Macaca fascicularis cynomolgus monkey
- Macaca mulatta rhesus monkey
- humans Homo sapiens
- the subject is a primate, most preferably a human.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C wherein said antibody or antibody fragment comprises
- a HCDR1 region comprising the amino acid sequence of SEQ ID No : 7, a HCDR2 region comprising the amino acid sequence of SEQ ID No.: 8, a HCDR3 region comprising the amino acid sequence of SEQ ID No.: 9, a LCDR1 region comprising the amino acid sequence of SEQ ID No.: 13, a LCDR2 region comprising the amino acid sequence of SEQ ID No.: 14 and a LCDR3 region comprising the amino acid sequence of SEQ ID No.: 15, or
- a HCDR1 region comprising the amino acid sequence of SEQ ID No.: 20, a HCDR2 region comprising the amino acid sequence of SEQ ID No.: 21 , a HCDR3 region comprising the amino acid sequence of SEQ ID No.: 22, a LCDR1 region comprising the amino acid sequence of SEQ ID No.: 26, a LCDR2 region comprising the amino acid sequence of SEQ ID No.: 27 and a LCDR3 region comprising the amino acid sequence of SEQ ID No.: 28.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises
- the HCDR1 region of SEQ ID No.: 20 the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.: 22, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C wherein said antibody or antibody fragment comprises
- a HCDR1 region comprising the amino acid sequence of SEQ ID No.: 10
- a HCDR2 region comprising the amino acid sequence of SEQ ID No.: 1 1
- a HCDR3 region comprising the amino acid sequence of SEQ ID No.: 12
- a LCDR1 region comprising the amino acid sequence of SEQ ID No.: 13
- a LCDR2 region comprising the amino acid sequence of SEQ ID No.: 14
- a LCDR3 region comprising the amino acid sequence of SEQ ID No.: 15, or
- a HCDR1 region comprising the amino acid sequence of SEQ ID No.: 23, a HCDR2 region comprising the amino acid sequence of SEQ ID No.: 24, a HCDR3 region comprising the amino acid sequence of SEQ ID No.: 25, a LCDR1 region comprising the amino acid sequence of SEQ ID No.: 26, a LCDR2 region comprising the amino acid sequence of SEQ ID No.: 27 and a LCDR3 region comprising the amino acid sequence of SEQ ID No.: 28.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No.: 1 1 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No.: 14 and the LCDR3 region of SEQ ID No.: 15, or
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C wherein said antibody or antibody fragment comprises
- a HCDR1 region comprising the amino acid sequence of SEQ ID No.: 7, a HCDR2 region comprising the amino acid sequence of SEQ ID No.: 8, a HCDR3 region comprising the amino acid sequence of SEQ ID No.: 9, a LCDR1 region comprising the amino acid sequence of SEQ ID No.: 13, a LCDR2 region comprising the amino acid sequence of SEQ ID No.: 14 and a LCDR3 region comprising the amino acid sequence of SEQ ID No.: 15, or
- a HCDR1 region comprising the amino acid sequence of SEQ ID No.: 10
- a HCDR2 region comprising the amino acid sequence of SEQ ID No.: 1 1
- a HCDR3 region comprising the amino acid sequence of SEQ ID No.: 12
- a LCDR1 region comprising the amino acid sequence of SEQ ID No.: 13
- a LCDR2 region comprising the amino acid sequence of SEQ ID No.: 14
- a LCDR3 region comprising the amino acid sequence of SEQ ID No.: 15, or
- a HCDR1 region comprising the amino acid sequence of SEQ ID No.: 20, a HCDR2 region comprising the amino acid sequence of SEQ ID No.: 21 , a HCDR3 region comprising the amino acid sequence of SEQ ID No.: 22, a LCDR1 region comprising the amino acid sequence of SEQ ID No.: 26, a LCDR2 region comprising the amino acid sequence of SEQ ID No.: 27 and a LCDR3 region comprising the amino acid sequence of SEQ ID No.: 28.
- a HCDR1 region comprising the amino acid sequence of SEQ ID No.: 23, a HCDR2 region comprising the amino acid sequence of SEQ ID No.: 24, a HCDR3 region comprising the amino acid sequence of SEQ ID No.: 25, a LCDR1 region comprising the amino acid sequence of SEQ ID No.: 26, a LCDR2 region comprising the amino acid sequence of SEQ ID No.: 27 and a LCDR3 region comprising the amino acid sequence of SEQ ID No.: 28.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No.: 1 1 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No.: 14 and the LCDR3 region of SEQ ID No.: 15, or the HCDR1 region of SEQ ID No.: 20, the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.: 22, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28, or
- the antibody or antibody fragment specifically binds to human IL-17C.
- the antibody or antibody fragment is a monoclonal antibody or antibody fragment.
- the antibody or antibody fragment is a human, humanized or chimeric antibody or antibody fragment. In another embodiment of the present disclosure the antibody or antibody fragment is of the IgG isotype. In another embodiment the antibody or antibody fragment is IgGl
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No.: 1 1 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.. 13, the LCDR2 region of SEQ ID No. : 14 and the LCDR3 region of SEQ ID No.: 15 and further comprises a heavy chain of SEQ ID No.: 17 or a light chain of SEQ ID No.. 16, or
- the HCDR1 region of SEQ ID No.: 20 the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.: 22, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.. 27 and the LCDR3 region of SEQ ID No.: 28 and further comprises a heavy chain of SEQ ID No.: 30 or a light chain of SEQ ID No.: 29, or
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 17 and a light chain of SEQ ID No.: 16.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 30 and a light chain of SEQ ID No.: 29.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 43 and a light chain of SEQ ID No.: 42.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 56 and a light chain of SEQ ID No.: 55.
- the antibody or antibody fragment is an isolated antibody or antibody fragment.
- the antibody or antibody fragment is a recombinant antibody or antibody fragment.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C for use in the treatment of a disorder or condition associated with the undesired presence of IL-17C.
- the present disclosure refers to a nucleic acid composition
- a nucleic acid composition comprising a nucleic acid sequence or a plurality of nucleic acid sequences encoding an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment comprises
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No.: 1 1 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No.: 14 and the LCDR3 region of SEQ ID No.: 15, or the HCDR1 region of SEQ ID No.: 20, the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.: 22, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28, or
- the HCDR1 region of SEQ ID No.: 23 the HCDR2 region of SEQ ID No.: 24, the HCDR3 region of SEQ ID No.: 25, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28.
- the present disclosure refers to a vector composition
- a vector composition comprising a vector or a plurality of vectors comprising the nucleic acid sequence or plurality of nucleic acid sequences encoding an antibody or antibody fragment as disclosed in Table 1.
- the present disclosure refers to a cell comprising a vector composition comprising a vector or a plurality of vectors comprising the nucleic acid sequence or plurality of nucleic acid sequences encoding an antibody or antibody fragment as disclosed in Table 1.
- the present disclosure refers to a pharmaceutical composition
- a pharmaceutical composition comprising an antibody or antibody fragment as disclosed in Table 1 and a pharmaceutically acceptable carrier or excipient.
- said antibody or antibody fragment specific for IL-17C blocks the binding of IL-17C to the receptor of IL-17C. In a further embodiment, said antibody or antibody fragment specific for IL-17C blocks the binding of IL-17C to the receptor of IL-17C, wherein said receptor is IL17RE. In another embodiment the present disclosure refers to an antibody or antibody fragment specific for IL-17C, wherein said antibody or antibody fragment blocks the binding of IL-17C to IL17RE.
- said antibody or antibody fragment comprises the HCDR1 region of SEQ ID No.: 7, the HCDR2 region of SEQ ID No.: 8, the HCDR3 region of SEQ ID No.: 9, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No.: 14 and the LCDR3 region of SEQ ID No. : 15, or
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No : 1 1 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No.: 14 and the LCDR3 region of SEQ ID No.: 15, or
- the HCDR1 region of SEQ ID No.: 20 the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.: 22, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28, or the HCDR1 region of SEQ ID No.: 23, the HCDR2 region of SEQ ID No.: 24, the HCDR3 region of SEQ ID No.: 25, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28.
- said antibody or antibody fragment comprises a heavy chain of SEQ ID No.. 17 and a light chain of SEQ ID No.: 16 or a heavy chain of SEQ ID No.. 30 and a light chain of SEQ ID No : 29 or a heavy chain and a light chain that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the a heavy chain of SEQ ID No.: 17 or 30 and to the light chain of SEQ ID No.: 16 or 29.
- the present disclosure refers to an antibody or antibody fragment specific for IL-17C wherein said antibody or antibody fragment bivalently binds to an IL-17C homodimer and forms a complex consisting of said antibody or antibody fragment and one IL-17C homodimer and wherein said antibody or antibody fragment blocks the binding of IL-17C to IL17RE.
- said antibody or antibody fragment specific for IL-17C blocks the binding of IL-17C to one or more receptors of IL-17C.
- said antibody or antibody fragment comprises the HCDR1 region of SEQ ID No.: 7, the HCDR2 region of SEQ ID No : 8, the HCDR3 region of SEQ ID No.: 9, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No. : 14 and the LCDR3 region of SEQ ID No.: 15, or
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No.: 11 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No : 14 and the LCDR3 region of SEQ ID No.: 15, or
- the HCDR1 region of SEQ ID No.: 20 the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.: 22, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28, or
- said antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 17 and a light chain of SEQ ID No.: 16 or a heavy chain of SEQ ID No.: 30 and a light chain of SEQ ID No.: 29 or a heavy chain and a light chain that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the a heavy chain of SEQ ID No.: 17 or 30 and to the light chain of SEQ ID No.: 16 or 29.
- said antibody or antibody fragment specific for the receptor of IL-17C blocks the binding of IL-17C to receptors of IL-17C, wherein the receptors of IL-17C include IL17RE and IL17RA.
- said antibody or antibody fragment specific for the receptor of IL-17C blocks the binding of IL-17C to IL17RE and IL17RA. In certain embodiments, said antibody or antibody fragment specific for IL-17C blocks the binding of IL-17C to IL17RE with an IC 50 concentration of less than 100nM, 90nM, 80nM, 70nM, 60nM, 50nM, 40nM, 30nM, 20nM, 10nM, 9nM, 8nM, 7nM, 6n , 5nM, 4nM, 3nM, 2nM, 1 nM, 100pM, 90pM, 80pM, 70pM, 60pM, 50pM, 40pM, 30pM, 20pM, 10pM, 9pM, 8p , 7pM, 6pM, 5pM, 4pM, 3pM, 2pM or 1 pM.
- the IC 5 o concentration can be determined by ELISA; SET, FACS or MSD (Meso Scale Discovery).
- the IC50 concentration can be determined by the method as described herein in Example 3.
- said antibody or antibody fragment comprises a heavy chain of SEQ ID No. : 17 and a light chain of SEQ ID No.: 16 or a heavy chain of SEQ ID No.: 30 and a light chain of SEQ ID No.: 29 or a heavy chain and a light chain that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the a heavy chain of SEQ ID No.. 17 or 30 and to the light chain of SEQ ID No.: 16 or 29.
- the disclosed antibody or antibody fragment is specific for human IL-17C.
- the disclosed antibody or antibody fragment specific for IL-17C is cross-reactive with IL-17C of another species, such as IL-17C from mouse, rat, rhesus monkey and/or cynomolgus monkey.
- the antibody or antibody fragment is specific for human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C.
- the antibody or antibody fragment is specific for human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C.
- the antibody or antibody fragment is specific for human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C, wherein said antibody or antibody fragment comprises
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No.: 1 1 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No.: 14 and the LCDR3 region of SEQ ID No.: 15, or
- the HCDR1 region of SEQ ID No.: 20 the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.. 22, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28, or
- the HCDR1 region of SEQ ID No.: 23 the HCDR2 region of SEQ ID No.: 24, the HCDR3 region of SEQ ID No.: 25, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28.
- said antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 17 and a light chain of SEQ ID No.: 16 or a heavy chain of SEQ ID No.: 30 and a light chain of SEQ ID No.: 29 or a heavy chain and a light chain that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the a heavy chain of SEQ ID No.: 17 or 30 and to the light chain of SEQ ID No.: 16 or 29.
- the disclosed antibody or antibody fragment specifically binds to human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C and blocks the binding of human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C to its specific receptor IL17RE with an ICso concentration of less than 100nM, 90n , 80nM, 70nM, 60nM, 50nM, 40nM, 30nM, 20nM, 10nM, 9nM, 8nM, 7nM, 6nM, 5nM, 4nM, 3nM, 2nM, 1 n , 100pM, 90pM, 80pM, 70pM, 60pM, 50pM, 40pM, 30pM, 20pM, 10pM, 9pM, 8pM, 7pM, 6pM, 5pM, 4pM, 3p , 2pM or 1 pM.
- said antibody is in lgG1 format
- the disclosed antibody or antibody fragment specifically binds to human IL-17C and blocks the binding of human IL-17C to human IL17RE with an IC 5 o concentration of less than 100nM, 90nM, 80nM, 70nM, 60nM, 50nM, 40nM, 30nM, 20nM, 10nM, 9nM, 8nM, 7nM, 6nM, 5nM, 4nM, 3nM, 2nM, 1 n , 100p , 90pM, 80pM, 70pM, 60pM, 50pM, 40pM, 30pM, 20pM, 10pM, 9p , 8pM, 7pM, 6pM, 5pM, 4pM, 3pM, 2pM or 1 pM.
- said antibody is in lgG1 format.
- said IC 5 o concentration is determined in a Receptor Inhibition Assay as described herein in Example 3.
- the disclosed antibody or antibody fragment specifically binds to cynomolgus monkey IL-17C and blocks the binding of cynomolgus monkey IL-17C to cynomolgus monkey IL17RE with an IC 5 o concentration of less than ⁇ ⁇ , 90nM, 80nM, 70nM, 60nM, 50nM, 40nM, 30nM, 20nM, 10nM, 9nM, 8nM, 7nM, 6nM, 5nM, 4nM, 3nM, 2nM, 1 nM, 100pM, 90pM, 80pM, 70pM, 60pM, 50pM, 40pM, 30pM, 20pM, 10pM, 9pM, 8pM, 7pM, 6pM, 5pM, 4pM, 3pM, 2pM or 1 pM.
- said antibody is in lgG1 format.
- said ICso concentration is determined in a
- the disclosed antibody or antibody fragment specifically binds to human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C, and blocks the binding of human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C, to human IL17RE, cynomolgus monkey IL17RE and mouse IL17RE, respectively, each with an IC50 concentration of less than 100nM, 90nM, 80n , 70nM, 60nM, 50nM, 40nM, 30nM, 20nM, 10nM, 9nM, 8nM, 7nM, 6nM, 5nM, 4nM, 3nM, 2nM, 1 nM, 100pM, 90pM, 80pM, 70pM, 60pM, 50pM, 40pM, 30p , 20pM, 10pM, 9pM, 8pM, 7pM, 6pM, 5pM, 4p , 3pM
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No.: 1 1 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No.: 14 and the LCDR3 region of SEQ ID No.: 15, or
- the HCDR1 region of SEQ ID No.: 20 the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.: 22, the LCDR1 region of SEQ ID No.. 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28, or
- the HCDR1 region of SEQ ID No.: 23 the HCDR2 region of SEQ ID No.: 24, the HCDR3 region of SEQ ID No.: 25, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28.
- said antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 17 and a light chain of SEQ ID No.: 16 or a heavy chain of SEQ ID No.: 30 and a light chain of SEQ ID No.: 29 or a heavy chain and a light chain that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the heavy chain of SEQ ID No.: 17 or 30 and to the light chain of SEQ ID No.: 16 or 29.
- said antibody is in lgG1 format.
- said IC50 concentration is determined in a Receptor Inhibition Assay as described herein in Example 3.
- the disclosed antibody or antibody fragment inhibits human IL-17C, cynomolgus monkey IL-17C and mouse IL-17C driven activation of a NF- ⁇ reporter gene in NIH3T3 cells with an IC50 concentration of less than 10OpM, 90pM, 80pM, 70pM, 60pM, 50p , 40pM, 30pM, 20pM, 10pM, 9pM, 8pM, 7pM, 6pM, 5pM, 4pM, 3pM, 2pM or 1 pM.
- said antibody or antibody fragment comprises
- the HCDR1 region of SEQ ID No.: 10 the HCDR2 region of SEQ ID No.: 1 , the HCDR3 region of SEQ ID No.: 12, the LCDR1 region of SEQ ID No.: 13, the LCDR2 region of SEQ ID No.: 14 and the LCDR3 region of SEQ ID No.: 15, or the HCDR1 region of SEQ ID No : 20, the HCDR2 region of SEQ ID No.: 21 , the HCDR3 region of SEQ ID No.: 22, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28, or
- the HCDR1 region of SEQ ID No.: 23 the HCDR2 region of SEQ ID No.: 24, the HCDR3 region of SEQ ID No.: 25, the LCDR1 region of SEQ ID No.: 26, the LCDR2 region of SEQ ID No.: 27 and the LCDR3 region of SEQ ID No.: 28.
- said antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 17 and a light chain of SEQ ID No.: 16 or a heavy chain of SEQ ID No.: 30 and a light chain of SEQ ID No.: 29 or a heavy chain and a light chain that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the heavy chain of SEQ ID No.: 17 or 30 and to the light chain of SEQ ID No.: 16 or 29.
- said antibody is in lgG1 format.
- said IC50 concentration is determined in a IL-17C-driven NF- ⁇ reporter assay as described herein in Example 4.
- the disclosed antibody or antibody fragment is specific for human IL-17C encoded by the amino acid sequence of SEQ ID No.: 1. In one embodiment the disclosed antibody or antibody fragment is specific for a polypeptide comprising the amino acid sequence of SEQ ID No.: 1. In a further embodiment said monoclonal antibody or antibody fragment is a monoclonal antibody specific for a polypeptide consisting of the amino acid sequence of SEQ ID No.: 1. In another embodiment the disclosed antibody or antibody fragment is specific for human IL-17C encoded by the amino acid sequence of SEQ ID No.: 1 and is a monoclonal antibody or antibody fragment.
- the disclosed antibody or antibody fragment specific for IL-17C is a monoclonal antibody or antibody fragment.
- the disclosed antibody or antibody fragment specific for IL-17C is a human, humanized or chimeric antibody.
- said antibody or antibody fragment specific for IL-17C is an isolated antibody or antibody fragment.
- said antibody or antibody fragment is a recombinant antibody or antibody fragment.
- said antibody or antibody fragment is a recombinant human antibody or antibody fragment.
- said recombinant human antibody or antibody fragment is an isolated recombinant human antibody or antibody fragment.
- said recombinant human antibody or antibody fragment or isolated recombinant human antibody or antibody fragment is monoclonal.
- the disclosed antibody or antibody fragment comprises a heavy chain of SEQ ID No.: 17 and a light chain of SEQ ID No : 16 or a heavy chain of SEQ ID No.: 30 and a light chain of SEQ ID No.: 29 or a heavy chain and a light chain that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the a heavy chain of SEQ ID No.: 17 or 30 and to the light chain of SEQ ID No.: 16 or 29.
- the disclosed antibody or antibody fragment comprises a human heavy chain constant region and a human light chain constant region.
- said human heavy chain constant region comprises the amino acid sequences of SEQ ID No.: 17 and the human light chain constant region comprises the amino acid sequences of SEQ ID No.: 16 or said human heavy chain constant region comprises the amino acid sequences of SEQ ID No.: 30 and the human light chain constant region comprises the amino acid sequences of SEQ ID No.: 29.
- the disclosed antibody or antibody fragment is of the IgG isotype. In another embodiment said antibody is lgG1.
- said antibody fragment is a bivalent antibody fragment.
- the present disclosure refers to an antibody or antibody fragment that cross-competes with an antibody described in Table 1.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising 6 CDRs defined by Kabat of one of the antibodies in Table 1 .
- the present disclosure refers to an antibody or antibody fragment specific for human IL-17C wherein said antibody or antibody fragment bivalently binds to an IL-17C homodimer and forms a complex consisting of said antibody or antibody fragment and one IL-17C homodimer and wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising 6 CDRs defined by Kabat of one of the antibodies in Table 1.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising 6 CDRs, wherein the HCDR1 is the amino acid sequence of SEQ ID No. : 7, the HCDR2 is the amino acid sequence of SEQ ID No.: 8, the HCDR3 is the amino acid sequence of SEQ ID No.: 9, the LCDR1 is the amino acid sequence of SEQ ID No.: 13, the LCDR2 is the amino acid sequence of SEQ ID No.: 14 and the LCDR3 is the amino acid sequence of SEQ ID No.: 15.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising the VH according to SEQ ID No.: 17 and the VL according to SEQ ID No.: 16.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising 6 CDRs, wherein the HCDR1 is the amino acid sequence of SEQ ID No.: 20, the HCDR2 is the amino acid sequence of SEQ ID No.: 21 , the HCDR3 is the amino acid sequence of SEQ ID No.: 22, the LCDR1 is the amino acid sequence of SEQ ID No.: 26, the LCDR2 is the amino acid sequence of SEQ ID No.: 27 and the LCDR3 is the amino acid sequence of SEQ ID No.: 28.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross- competes with an antibody or antibody fragment comprising the VH according to SEQ ID No.: 30 and the VL according to SEQ ID No.: 29.
- the present disclosure refers to an antibody or antibody fragment that cross-competes with an antibody described in Table 1.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising 6 CDRs defined by Chothia of one of the antibodies in Table 1 .
- the present disclosure refers to an antibody or antibody fragment specific for human IL-17C wherein said antibody or antibody fragment bivalently binds to an IL-17C homodimer and forms a complex consisting of said antibody or antibody fragment and one IL-17C homodimer and wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising 6 CDRs defined by Chothia of one of the antibodies in Table 1 .
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising 6 CDRs, wherein the HCDR1 is the amino acid sequence of SEQ ID No.: 10, the HCDR2 is the amino acid sequence of SEQ ID No.: 11 , the HCDR3 is the amino acid sequence of SEQ ID No.: 12, the LCDR1 is the amino acid sequence of SEQ ID No.: 13, the LCDR2 is the amino acid sequence of SEQ ID No.: 14 and the LCDR3 is the amino acid sequence of SEQ ID No.: 15.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross- competes with an antibody or antibody fragment comprising the VH according to SEQ ID No.: 17 and the VL according to SEQ ID No.: 18.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross-competes with an antibody or antibody fragment comprising 6 CDRs, wherein the HCDR1 is the amino acid sequence of SEQ ID No.: 23, the HCDR2 is the amino acid sequence of SEQ ID No.: 24, the HCDR3 is the amino acid sequence of SEQ ID No.: 25, the LCDR1 is the amino acid sequence of SEQ ID No.: 26, the LCDR2 is the amino acid sequence of SEQ ID No.: 27 and the LCDR3 is the amino acid sequence of SEQ ID No.: 28.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment cross- competes with an antibody or antibody fragment comprising the VH according to SEQ ID No.. 30 and the
- the disclosure refers to an antibody or antibody fragment that cross-competes with an antibody described in Table 1 and reduces the specific binding of one of the antibodies described in Table 1 by at least 70%, 80% or 90% in an ELISA-based cross- competition assay.
- the present disclosure refers to an monoclonal antibody or antibody fragment that cross-competes with an antibody described in Table 1 and reduces the specific binding of one of the antibodies described in Table 1 to IL-17C by at least 70%, 80% or 90% in an ELISA-based cross-competition assay.
- a representative assay set-up is illustrated in Example 6 in the present disclosure.
- the present disclosure refers to an antibody or antibody fragment that binds to (e.g., by binding, stabilizing, spatial distribution) the same epitope as one of the antibodies in Table 1.
- said antibody or antibody fragment binds to (e.g., by binding, stabilizing, spatial distribution) the same epitope as an antibody or antibody fragment comprising 6 CDRs defined by Kabat of one of the antibodies in Table 1 .
- said antibody or antibody fragment binds to (e.g., by binding, stabilizing, spatial distribution) the same epitope of IL-17C as an antibody or antibody fragment comprising 6 CDRs defined by Kabat of one of the antibodies in Table 1 .
- said antibody or antibody fragment binds to (e.g., by binding, stabilizing, spatial distribution) the same epitope of polypeptide comprising the amino acid sequence of SEQ ID No.: 1 as an antibody or antibody fragment comprising 6 CDRs defined by Kabat of one of the antibodies in Table 1.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment binds to the same epitope as an antibody or antibody fragment comprising 6 CDRs, wherein the HCDR1 is the amino acid sequence of SEQ ID No.: 10, the HCDR2 is the amino acid sequence of SEQ ID No.: 1 1 , the HCDR3 is the amino acid sequence of SEQ ID No.: 12, the LCDR1 is the amino acid sequence of SEQ ID No.: 13, the LCDR2 is the amino acid sequence of SEQ ID No.: 14 and the LCDR3 is the amino acid sequence of SEQ ID No.: 15.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment binds to the same epitope as an antibody or antibody fragment comprising the VH according to SEQ ID No.: 17 and the VL according to SEQ ID No.: 18.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment binds to the same epitope as an antibody or antibody fragment comprising 6 CDRs, wherein the HCDR1 is the amino acid sequence of SEQ ID No.: 23, the HCDR2 is the amino acid sequence of SEQ ID No.: 24, the HCDR3 is the amino acid sequence of SEQ ID No : 25, the LCDR1 is the amino acid sequence of SEQ ID No.: 26, the LCDR2 is the amino acid sequence of SEQ ID No.: 27 and the LCDR3 is the amino acid sequence of SEQ ID No.: 28.
- the present disclosure refers to an antibody or antibody fragment, wherein said antibody or antibody fragment binds to the same epitope as an antibody or antibody fragment comprising the VH according to SEQ ID No.: 30 and the VL according to SEQ ID No.: 29.
- Regions of a given polypeptide that include an epitope can be identified using any number of epitope mapping techniques, well known in the art. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66 (Glenn E.Morris, Ed., 1996) Humana Press, Totowa, New Jersey.
- epitopes may be determined by e.g., concurrently synthesizing large numbers of peptides on solid supports, the peptides corresponding to portions of the protein molecule, and reacting the peptides with antibodies while the peptides are still attached to the supports. Such techniques are known in the art and described in, e.g., U.S. Patent No.
- epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, supra.
- Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Omiga version 1.0 software program available from the Oxford Molecular Group.
- This computer program employs the Hopp/Woods method, Hopp et al., (1981 ) Proc. Natl. Acad. Sci USA 78:3824-3828; for determining antigenicity profiles, and the Kyte-Doolittle technique, Kyte et al., (1982) J. Mol. Biol. 157:105-132; for hydropathy plots.
- the present disclosure refers to an antibody or antibody fragment comprising 6 CDRs defined by Kabat of any of the antibodies in Table 1 .
- the disclosure pertains to an isolated monoclonal antibody or fragment thereof comprising 6 CDRs defined by Kabat of each of the antibodies in Table 1.
- the present disclosure refers to an antibody or antibody fragment comprising 6 CDRs defined by Chotia of any of the antibodies in Table 1.
- the disclosure pertains to an isolated monoclonal antibody or fragment thereof comprising 6 CDRs defined by Chotia of each of the antibodies in Table 1.
- the present disclosure refers to the antibodies or antibody fragments disclosed in in Table 1 , wherein said antibodies or antibody fragments can bind to IL-17C with an affinity of about less than 100 nM, more preferably less than about 60 nM, and still more preferably less than about 30 nM. Further preferred are antibodies or antibody fragments that bind to IL-17C with an affinity of less than about 10 nM, and more preferably less than about 3 nM.
- the present disclosure refers to the antibodies or antibody fragments disclosed in Table 1 , wherein said antibodies or antibody fragments can bind to IL-17C with a monovalent affinity of about less than 100 nM, more preferably less than about 60 nM, and still more preferably less than about 30 nM. Further preferred are antibodies or antibody fragments that bind to IL-17C with a monovalent affinity of less than about 10 nM, and more preferably less than about 3 nM.
- the present disclosure refers to antibodies or antibody fragments specific for IL-17C, wherein said antibodies or antibody fragments have a monovalent affinity to IL-17C with a dissociation rate constant (KD) of less than 5x10 2 M, less than 10 2 M, less than 5x10 3 M, less than 10 3 M, less than 5x10 "4 M, less than 10 " M, less than 5x10 5 M, less than 10 5 M, less than 5x10 6 M, less than 10 6 M, less than 5x10 7 M, less than 10 "7 M, less than 5x10 8 M, less than 10 e M, less than 5x10 "9 M, less than 10 9 M, less than 5x10- 10 M, less than 10 "10 M, less than 5x10 1 M, less than 10 "1 M, less than 5x10 12 M, less than 10- 12 M, less than 5x10 3 M, less than 10 3 M, less than 5x10 14 M, less than 10 1 M, less than 5x10 5 M, or less than 10
- compositions of the present disclosure are preferably pharmaceutical compositions comprising an antibody or antibody fragment specific for IL-17C as disclosed herein and a pharmaceutically acceptable carrier, diluent or excipient, for the treatment of an inflammatory disorder or cancer.
- a pharmaceutically acceptable carrier, diluent or excipient for the treatment of an inflammatory disorder or cancer.
- Such carriers, diluents and excipients are well known in the art, and the skilled artisan will find a formulation and a route of administration best suited to treat a subject with the IL-17C antibodies or antibody fragments of the present disclosure.
- the present disclosure refers to pharmaceutical compositions comprising an antibody or antibody fragment specific for IL-17C as disclosed herein for the use in the treatment of a disorder or condition associated with the undesired presence of IL-17C.
- said condition associated with the undesired presence of IL-17C is an inflammatory disorder or cancer.
- said inflammatory disorder is rheumatoid arthritis, psoriasis, pulmonary inflammation, COPD and/or atopic dermatitis (AD), including moderate-to-severe AD.
- said inflammatory disorder is atopic dermatitis (AD) and/or moderate-to-severe AD.
- the present disclosure refers to the use of said pharmaceutical compositions comprising an antibody or antibody fragment specific for IL-17C as disclosed herein in the preparation of a medicament for the treatment of a disorder or condition associated with the undesired presence of IL-17C.
- said condition associated with the undesired presence of IL-17C is an inflammatory disorder or cancer.
- said inflammatory disorder is rheumatoid arthritis, psoriasis, pulmonary inflammation, COPD and/or atopic dermatitis (AD), including moderate-to-severe AD.
- said inflammatory disorder is atopic dermatitis (AD) and/or moderate- to-severe AD.
- the present disclosure refers to the use of said pharmaceutical composition for the treatment of a disorder or condition associated with the undesired presence of IL-17C.
- said condition associated with the undesired presence of IL-17C is an inflammatory disorder or cancer.
- said inflammatory disorder is rheumatoid arthritis, psoriasis, pulmonary inflammation, COPD and/or atopic dermatitis (AD), including moderate-to-severe AD.
- said inflammatory disorder is atopic dermatitis (AD) and/or moderate-to-severe AD.
- a method of treating atopic dermatitis (AD) and/or moderate-to-severe atopic dermatitis (AD) in a subject comprising administering a pharmaceutical composition comprising a therapeutically effective amount of the IL-17C antibodies or antibody fragments of the present disclosure.
- said subject is resistant, non-responsive or inadequately responsive to treatment by either a topical corticosteroid (TCS) or a calcineurin inhibitor.
- TCS topical corticosteroid
- a calcineurin inhibitor a calcineurin inhibitor.
- the subject is a subject in need thereof.
- said subject is a human.
- said subject is a rodent, such as a rat or a mouse.
- the present disclosure refers to a method for the prophylaxis of an inflammatory disorder in a subject, said method comprising administering an IL-17C antagonist to said subject.
- "Prophylaxis" as used in this context refers to methods which aim to prevent the onset of a disease or which delay the onset of a disease.
- said subject is a human.
- said subject is a rodent, such as a rat or a mouse.
- the antibodies or antibody fragments specific for IL-17C of the present disclosure are administered subcutaneously. In other aspects the antibodies or antibody fragments specific for IL-17C of the present disclosure are administered intravenously, intra-articularly or intra-spinally.
- the disclosure pertains to an isolated monoclonal antibody or fragment thereof comprising a VH and a VL of any of the antibodies in Table 1.
- the disclosure pertains to an isolated monoclonal antibody or fragment thereof comprising a Heavy chain (lgG1 ) and a Light chain of any of the antibodies in Table 1.
- the disclosure refers to an isolated nucleic acid encoding a heavy chain sequence and/or light chain sequence of an antibody that binds to IL-17C the nucleic acid comprising a HCDR1 region of SEQ ID No. : 58, the HCDR2 region of SEQ ID No.: 59, the HCDR3 region of SEQ ID No.: 60, the LCDR1 region of SEQ ID No.: 64, the LCDR2 region of SEQ ID No.
- the disclosure refers to a nucleic acid encoding an isolated monoclonal antibody or fragment thereof wherein the nucleic acid comprises a VH region of SEQ ID No.: 19 and a VL region of SEQ ID No.: 18, or a VH region and a VL region that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the VH region of SEQ ID No.: 19 and/or the VL region of SEQ ID No.: 18.
- the disclosure refers to a nucleic acid encoding an isolated monoclonal antibody or fragment thereof wherein the nucleic acid comprises a VH region of SEQ ID No.: 68 and a VL region of SEQ ID No.: 67, or a VH region and a VL region that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the VH region of SEQ ID No.: 68 and/or the VL region of SEQ ID No.: 67.
- the disclosure refers to a nucleic acid encoding an isolated monoclonal antibody or fragment thereof wherein the nucleic acid comprises a VH region of SEQ ID No.: 32 and a VL region of SEQ ID No.: 31 , or a VH region and a VL region that has at least 60%, at least 70 %, at least 80%, at least 90% or at least 95% identity to the VH region of SEQ ID No.: 32 and/or the VL region of SEQ ID No.: 31 ,
- the disclosure refers to a nucleic acid encoding an isolated monoclonal antibody or fragment thereof wherein the nucleic acid comprises a Heavy chain (lgG1 ) of SEQ ID No.: 45 and a Light chain of SEQ ID No.: 44.
- the disclosure refers to a nucleic acid encoding an isolated monoclonal antibody or fragment thereof wherein the nucleic acid comprises a Heavy chain (lgG1 ) of SEQ ID No. : 70 and a Light chain of SEQ ID No. : 69.
- the disclosure refers to a nucleic acid encoding an isolated monoclonal antibody or fragment thereof wherein the nucleic acid comprises a Heavy chain (lgG 1 ) of SEQ ID No. : 71 and a Light chain of SEQ ID No. : 57.
- the nucleic acid comprises a Heavy chain (lgG 1 ) of SEQ ID No. : 71 and a Light chain of SEQ ID No. : 57.
- the disclosure refers to a nucleic acid encoding an isolated monoclonal antibody or fragment thereof wherein the nucleic acid comprises a VH and a VL of any of the antibodies in Table 1 .
- the disclosure refers to a nucleic acid encoding an isolated monoclonal antibody or fragment thereof wherein the nucleic acid comprises a Heavy chain (SgG1 ) and a Light chain of any of the antibodies in Table 1 .
- SgG1 Heavy chain
- SgG1 Light chain of any of the antibodies in Table 1 .
- the disclosure refers to a method of producing an isolated monoclonal antibody or fragment thereof of any of the antibodies in Table 1 .
- IL-17C form different species was purchased from different providers or produced in- house and solubilised, if necessary.
- Per 100 g protein 4 ⁇ biotinylation reagent of the ECLTM biotinylation module were added and incubated for 60 min at room temperature in the dark with gentle agitation. Subsequently biotinylated protein was purified using ZebaTM Desalt spin columns and OD280nm was determined.
- Antigens were biotinylated by using the ECLTM biotinylation module (GE Healthcare; #1061918). After biotinlyation the product was purified using ZebaTM Desalt spin columns (Pierce; #89889).
- Biotinylated and non-biotinylated mouse, cynomolgus and human IL-17C were subjected to a quality control comprising analyses under denaturing, reducing and denaturing, non-reducing conditions in SDS-PAGE and in native state by High Pressure-Size Exclusion Chromatography (HP-SEC) and Dynamic Light Scattering (DLS).
- HP-SEC High Pressure-Size Exclusion Chromatography
- DLS Dynamic Light Scattering
- HP-SEC was performed on a Dionex UltiMate 3000 Titanium HPLC system (Dionex Corporation, Germering, Germany) in combination with Wyatt miniDAWN Treos and Wyatt Optilab rEX (Wyatt Technology Europe, Dernbach, Germany).
- a Tosoh TSK- Gel G3000SWxl column was used (Tosoh Bioscience, Stuttgart, Germany).
- separation was performed at a flow rate of 0.5 ml/min and recorded analyzing the UV absorption at 280 nm.
- the running buffer was composed of 49 mM NaH 2 P0 4 , 51 mM Na 2 HP0 4 , 100 mM K 2 S0 4 , 0.0005% Tween-80 at pH 6.8.
- Both constructs were transiently expressed in HKB1 1 cells.
- the cell suspension was scaled up three days post transfection and the cell culture supernatant was harvested 6 days post transfection. After sterile filtration, the solution was subjected to protein A affinity chromatography. Buffer exchange was performed to PBS and samples were sterile filtered (0.2 pm pore size). Protein concentrations were determined by UV-spectrophotometry. Purity of the products was analysed under denaturing, reducing and denaturing, non-reducing conditions in SDS-PAGE and in native state by HP-SEC and DLS.
- MorphoSys Ylanthia ® library was used to select Fab fragments against human IL-17C.
- the MorphoSys Ylanthia ® library (Tiller et al. mAbs 5:3, 1- 26; May/June (2013) and U.S. Patent No. 8,728,981 ) is a commercially available phagemid library and employs the CysDisplay ® technology for displaying the Fab on the phage surface (Lohning et al., WO2001/05950).
- Each panning strategy comprised at least 3 individual rounds of panning against the respective antigens including human IL-17C (SEQ ID NO.: 1 ) and mouse IL-17C.
- the isolated clones identified were maturated, engineered and/or germlined in order to increase affinity and/or functionality. Thereafter several hundred clones were screened and functionality was rigorously tested in in vitro assays comprising e.g. the evaluation of binding to human, cynomolgus monkey and mouse IL-17C via SET, inhibition of binding of human, cynomolgus monkey and mouse IL-17C to its respective IL-17RE and functional inhibition of IL-17C (IL-17RE-driven NF- ⁇ reporter assay in mouse NIH3T3 cells and IL-17C mediated CSF3 expression in mouse primary keratinocytes (MPEK)).
- in vitro assays comprising e.g. the evaluation of binding to human, cynomolgus monkey and mouse IL-17C via SET, inhibition of binding of human, cynomolgus monkey and mouse IL-17C to its respective IL-17RE and functional inhibition of IL-17C (IL-17RE-driven NF-
- Example 2 Affinity determination in monovalent Fab and bivalent IgG format
- Monovalent Fab and bivalent IgG affinity was determined by SET. Therefore purified Fabs were titrated on human, cynomolgus or mouse IL-17C for determination of KD. Respectively purified IgGs were titrated on human, cynomolgus or mouse IL-17C for EC50 determination.
- Solution equilibrium titration was basically performed as described in the literature (Friquet et al., (1985) J. Immunol. Meth. 77: 305-19). In order to improve the sensitivity and accuracy of the SET method, it was transferred from classical ELISA to ECL based technology (Haenel et al. (2005) Anal Biochem. 339.1 : 182-84).
- Example 3 Cfiaracterization of IL-17C specific Fabs or IgGs for receptor inhibition activity
- IL-17C specific Fabs or IgGs were tested for its capacity to inhibit the binding of IL-17C to its specific receptor IL-17RE. Therefore MA6000 384-well plates (Meso Scale Discovery, MSD) were coated with 30 ⁇ of mouse IL17RE/Fc chimeric protein at 75 ng/ml in PBS at 4°C overnight. The next day a serial antibody dilution (concentrations from 0.001 to 100 nM) were pre-incubated for 30 min at RT with an equal volume of biotinylated human/cynomolgus or mouse IL-17C to determine an IC50 concentration for receptor binding inhibition. After blocking of plates for 1 h with 2.5% BSA in PBST, previously formed antibody- ligand complexes were added for 1 h to coated IL17RE/Fc and receptor binding was detected via Streptavidin-ECL using MSD Sector Imager.
- IL-17C specific IgGs were further tested for their ability to inhibit the biological activity of human, mouse and cynomolgus IL-17C in a functional cell based assay that monitors the IL-17C driven activation of a NF- ⁇ reporter gene in NIH3T3 cells overexpressing the murine IL-17RE.
- NIH3T3 cells were cultured in DMEM supplemented with 10% FBS and 1% Pen/Strep at 37°C, 5% CO2.
- NIH3T3 cells were transfected in suspension with total amount of 100ng DNA (20 ng mouse IL-17RE expression construct, 50ng NF- ⁇ luciferase reporter construct and 30ng pBluescript) using the Polyplus jet-PEI transfection agent.
- the DNA was diluted in 5 ⁇ 1 150 mM NaCI (per well) and 0.2 ⁇ jet-PEI in ⁇ 1 150 m NaCI (per well) was prepared. After 5 minutes incubation at room temperature, the JetPEI ® solution was added to the DNA solution and further incubated for 20-30 minutes at room temperature.
- NIH3T3 cells were diluted to have ⁇ 40,000 cells in 87 ⁇ medium. The cells were added to the DNA-JetPEI I ® mix (87 ⁇ cells and 13 ⁇ DNA-JetPEI I ® mix/well) and the final volume was transferred into 96 well plates.
- IL-17C a serial antibody dilution made in DPBS that was pre-incubated for 30 minutes at room temperature with an equal volume of purified recombinant IL-17C (either human IL-17C (Novus #NBP1 -42910), mouse mlL-17C (R&D Systems #2306-ml-025) or cynomolgus IL-17C (produced in house)), was added to the cells. The final concentration of IL-17C was 0.5 ng/ml.
- Example 5 IL-17C-d riven gene expression in primary human keratinocytes
- Keratinocytes endogenously express the IL-17RE and IL-17RA receptors, both of which are needed for functional signaling of IL-17C.
- Human primary keratinocytes derived from healthy individuals and mouse primary keratinocytes derived from C57BL/6 mice were therefore used to determine the capacity of MAB#1 lgG1 and MAB#2 lgG1 to inhibit the biological activity of respectively human and mouse IL-17C in a more physiological context.
- NHEK normal human epidermal keratinocytes
- Keratinocyte Growth Medium with supplements (KGM-GoldTM Bullet kit, Lonza) following manufacturer's protocol.
- NHEKs that were sub-cultured to and cryopreserved at passage 3 were thawed and immediately seeded in KGM cell culture medium at 30,000 cells/well in a 96 well cell culture plate. After 2 days, the medium was removed and changed to KGM-Gold w/o hydrocortisone prior to addition of hlL-17C (Novus #NBP1 -42910) and hTNFa (Peprotech #300-01 A) to final concentrations of 10 ng/ml each.
- the human IL-17C was first pre-incubated for 30 minutes at room temperature with an equal volume of a serial dilution of antibody made in DPBS. Cells were stimulated with recombinant IL-17C (pre-incubated with or without a dilution of antibody) in presence of TNFa. Co stimulation with IL-17C and TNFa is known to result in synergistic induction of various genes and was shown to be necessary as IL-17C alone has limited effect on the expression of investigated genes .
- qPCR quantitative polymerase chain reaction
- 10 ⁇ PGR reactions were prepared using Taqman ® universal PGR master mix/No AmpErase ® UNG and predesigned Assay-on-demand Gene expression primer/probe sets for DEF4B or CSF3 (#Hs00823638_m1 , all Applied Biosystems).
- qPCR was performed on the ViiA7TM Real-Time PGR instrument (Applied Biosystems). Gene expression was normalized to a housekeeping gene either ⁇ -actin (Taqman primer set #4310881 E) or GAPDH (Taqman primer set #4310893E).
- Cross-competition of an anti-IL-17C antibody or another IL-17C binding agent may be detected by using an ELISA assay according to the following standard procedure.
- the general principle of the ELISA-assay involves coating of an anti-IL-17C antibody (such as MAB#1 or MAB#2) onto the wells of an ELISA plate. An excess amount of a second, potentially cross-competitive, anti-IL-17C antibody is then added in solution (i.e. not bound to the ELISA plate). Subsequently a limited amount of IL-17C-Fc is then added to the wells.
- an anti-IL-17C antibody such as MAB#1 or MAB#2
- IL-17C may be fused with a tag, e.g. Fc, Flag, etc. which can be detected via an appropriate tag-specific agent.
- An antibody in solution that is cross-competitive to the coated antibody will be able to cause a decrease in the number of IL-17C molecules that the coated antibody can bind relative to the number of IL-17C molecules that the coated antibody can bind in the absence of the second, solution phase antibody.
- Ab-X is chosen to be the immobilized antibody
- Ab-Y is coated onto the wells of the ELISA plate, after which the plates are blocked with a suitable blocking solution to minimize non-specific binding of reagents that are subsequently added.
- An excess amount of Ab-Y is then added to the ELISA plate such that the moles of Ab-Y IL-17C binding sites per well are at least 10 fold higher than the moles of Ab-X IL-17C binding sites that are used, per well, during the coating of the ELISA plate.
- IL-17C is added such that the moles of IL-17C added per well were at least 25-fold lower than the moles of Ab-X IL-17C binding sites that are used for coating each well.
- the ELISA plate is washed and a detection reagent specific for the IL-17C antigen is added to measure the amount of IL-17C molecules specifically bound by the coated anti-IL-17C antibody (in this case Ab-X).
- the background signal for the assay is defined as the signal obtained in wells with the coated antibody (in this case Ab-X), second solution phase antibody (in this case Ab-Y), buffer only (i.e. no IL-17C) and detection reagents.
- the positive control signal for the assay is defined as the signal obtained in wells with the coated antibody (in this case Ab-X), second solution phase antibody buffer only (i.e. no second solution phase antibody), IL-17C detection reagents.
- the ELISA assay needs to be run in such a manner so as to have the positive control signal be at least 6 times the background signal.
- the cross-blocking assay needs to be run in two formats: 1 ) format 1 is where Ab-X is the antibody that is coated onto the ELISA plate and Ab- Y is the competitor antibody that is in solution and 2) format 2 is where Ab-Y is the antibody that is coated onto the ELISA plate and Ab-X is the competitor antibody that is in solution.
- Example 7 IL-23 induced psoriasis-model in mice
- both candidate antibodies were further evaluated in an IL-23 induced psoriasis-model in mice.
- mice The IL-23 induced psoriasis-model in mice was essentially carried out as described by Rizzo H et ai. J Immunol (201 1 ) Vol. 186(3) pp. 1495-1502.
- mice skin lesions were induced in Balb/C mice by intradermal injection of IL-23 into the ears(1 g) for 4 consecutive days (dayl to day4). Measurement of gross ear thickness was done daily up to day 5 on which the mice were sacrificed. At sacrifice, the pinna ears were sampled and cut longitudinally in 2 halves. One half was fixed in formalin for in depth histological analysis of epidermal/dermal thickness of ear skin.
- RNAIater for quantitative reverse-transcription polymerase chain reaction (qRT-PCR) analysis of mRNA expression levels of disease-relevant IL-17A, IL-22 and i L-1 ⁇ proinflammatory cytokines and LCN2, S100A8 and S100A9 anti-microbial proteins.
- both candidates IgGs MAB#1 and MAB#2 (2x10 mg/kg) ameliorated the IL-23 induced skin inflammation, demonstrating the in vivo efficacy and therapeutic potential of both antibodies.
- Both antibodies had similar effects at level of IL-23 induced epidermal thickening and a similar impact at level of IL-23 induced gene expression, (see Table 4).
- the efficacy of the MAB#1 antibody in atopic dermatitis was examined in a noninfectious cutaneous inflammation mouse model of atopic dermatitis where topical application of the low-calcemic vitamin D3 analogue MC903 (calcipotriol) induces atopic dermatitis like skin lesion characterized by a red and scaly skin, accompanied by an epidermal hyperplasia and dermal infiltration of various cell types as well as an increase of Th2 cytokine in skin and elevated serum IgE (Li M et ai. Proc Natl Acad Sci USA ( 2006) Vol. 103(31 ) pp. 1 1736-1 1741 ; Li M et al. J Invest Dermatol. (2009) Vol. 129(2). pp. 498-502).
- mice female, 8-week old mice were obtained from Janvier Labs (France). Mice were kept on a 12 hours light/dark cycle (0700-1900). Temperature was maintained at 22°C, and food and water were provided ad libitum.
- Ear skin samples were also taken for analysis of cytokine expression using qPCR or ELISA. Ear tissue pieces for qPCR gene analysis were submerged in RNALater® stabilisation solution (Ambion) and stored at -20°C. Ear skin samples for quantification at protein level were immediately snap frozen in liquid N2 and stored at -80°C. For gene expression analysis, tissue was disrupted and lysed in RNA lysis solution using Precellys homogenisator (microtubes filled with 1.4 mm ceramide beads, 3 times 3 cycles of 15 sec at 6000 rpm).
- Precellys homogenisator microtubes filled with 1.4 mm ceramide beads, 3 times 3 cycles of 15 sec at 6000 rpm.
- ACt Ctgene-Geomean Ct-value (housekeeping genes).
- tissues were first disrupted and lysed in 250 ⁇ lysis buffer (T-PERTM Tissue Protein Extraction Reagent (Pierce) supplemented with Protease Inhibitor Cocktail (Roche) and HaltTM Phosphatase Inhibitor Cocktail (Pierce)) using Precellys homogenisator (microtubes filled with 2.8 mm metal beads, 10 min 14000 rpm at 4°C).
- the amount of TSLP in ears was determined using a TSLP mouse DuoSet ELISA kits from R&D System. The amount was normalized to total protein content in lysate which was determined using Coomassie Protein Assay Reagent (Thermo Fisher) in reference to BSA protein standard. Data were expressed as amount of cytokine in ear which was calculated using the formula: concentration cytokine in sample / concentration of protein in sample x total ear protein content.
- MAB#1 The efficacy of various doses of MAB#1 in the MC903 atopic dermatitis model was assessed in a prophylactic setting.
- skin lesions were induced in BALB/c mice by topical administration of 2 nmol MC903 (dissolved in ethanol) on both ears for 5 consecutive days; mice were sacrificed at Day 8.
- MAB#1 was administered i.p. 3 times, i.e. 3 days before, at start of and 4 days after the first MC903 application. Effects on ear swelling, ear inflammation, epidermal hyperplasia, dermal thickness and gene expression were evaluated.
- a group of mice which received an isotype negative control antibody (MOR03207) served as comparator.
- the severity of skin inflammation was followed during the course of the experiment.
- the gross ear thickness was measured using a Mitutoyo thickness gage during the course of the experiment. Inflammation was further assessed at Day 5 using an in vivo imaging technique as described in 8.2).
- MAB#1 histological sections of ears collected at Day 8 were stained with hematoxylin and eosin for histomorphometric evaluation of epidermal and dermal thickness. Values of five fields per ear covering the whole ear from top to bottom were captured, and averaged per mouse. MAB#1 at doses of 10 mg/kg and higher significantly prevented the increase in thickness of both epidermal and dermal layer (Figure 3).
- MAB#1 was shown to prevent the downregulation of FLG2 in MC903-treated ears, which might suggest a potential role of MAB#1 in restoring barrier function.
- MAB#1 The efficacy of various doses of MAB#1 in the MC903 atopic dermatitis model was assessed in a more disease-relevant therapeutic setting.
- skin lesions were induced in BALB/c mice before the start of any treatment by topical administration of 2 nmol MC903 (dissolved in ethanol) on both ears for 5 consecutive days.
- MAB#1 was administered i.p. 4 times, with the first administration at the last day of MC903 skin application (Day 5) and following ones at Day 8, 12 and 15. Mice were sacrificed at Day 16. Effects on ear swelling, ear inflammation, epidermal hyperplasia, dermal thickness and gene expression were evaluated.
- mice which received an isotype negative control antibody served as comparator.
- Dexamethasone (1 mg/kg in 0.5% methyl cellulose, administered p.o. starting as of the last day of MC903 application at Day 5 and subsequently from Day 8 to 12 and from Day 15 to 16) was used as active comparator.
- the gross ear thickness was measured using a Mitutoyo thickness gage during the course of the experiment.
- Topical application of MC903 on ears elicited a marked increase in ear thickness as of Day 3 as compared to ears treated with ethanol (as vehicle control for MC903).
- Disease activity was well induced at Day 5 (i.e. day of first treatment) and continued to evolve after (even though MC903 application was stopped) as evident from a continued increase in ear swelling in the group treated with the negative control antibody MOR03207 ( Figure 5).
- MAB#1 prevented the generation of an atopic dermatitis-like skin inflammation in the MC903 model, with a significant impact on epidermal and dermal thickening, inflammation and type 2 T helper cell (Th2)-like gene expression when dosed prophylactically at 3x10 mg/kg intraperitoneally (i.p.). Significant effects on gross ear thickness were already observed in this model at doses of 3x2 mg/kg (i.p.). Also in the therapeutic MC903 model MAB#1 improved skin inflammation.
- Flaky Tail mice have a mutation in the Fig and Matt (Matt ma m8 Flg tm ) genes resulting in skin barrier dysfunction. These mice spontaneously develop atopy and progressive dermatitis characterised by a mixed Th2/Th17 inflammatory phenotype and reproduce cardinal features of AD in man.
- Flaky tail mice (Matt ma / ma Flg ft/ft ) mice on a congenic C57BL/6J background were used as described in Fallon et al (2009) Nat Genet. 41 (5): 602-608 and Saunders et al (2013) J Allergy Clin Immunol 132(5): 1 121 -1 129.
- Female Flaky tail mice 9-10 weeks old, were randomized into four groups (8 mice per group) and treated for 6 weeks as follows:
- Isotype negative control antibody (MOR03207) (30 mg/kg, ip twice weekly x 6 weeks)
- Group III MAB#1 (30mg/kg, ip twice weekly x 6 weeks)
- Group IV Dexamethasone 2mg/kg (jp twice per week x 6 weeks) as active comparator
- AD-like skin inflammation was scored using the macroscopic diagnostic criteria adapted from assessment of skin inflammation in the NC/Nga mouse model as described in Saunders et al (2013) J Allergy Clin Immunol 132(5): 1 121-1 129.
- a scoring system (0: none; 1 : mild; 2: moderate; 3: marked) was applied to the signs of erythema, excoriation and scaling.
- the total scores for each mouse (with the maximum of 9) were calculated from the sum of the individual scores for each of the three parameters.
- eczematous lesions in eyelid skin was monitored at end of the study and blepharitis was scored separately for its severity (0: normal, 1 : eyelid erythema and/or edema, 2: eyelid erythema, edema and scaling, 3: eyelid erythema, edema, scaling, erosion).
- the maximum blepharitis score (mean of both eyes) for each mouse is 3.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pulmonology (AREA)
- Dermatology (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Pain & Pain Management (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (33)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| TNP/2018/000289A TN2018000289A1 (en) | 2016-02-19 | 2017-02-17 | Antibodies for il-17c |
| SI201730777T SI3416983T1 (sl) | 2016-02-19 | 2017-02-17 | Protitelesa za IL-17C |
| ES17705873T ES2877376T3 (es) | 2016-02-19 | 2017-02-17 | Anticuerpos para IL-17C |
| AU2017219837A AU2017219837B2 (en) | 2016-02-19 | 2017-02-17 | Antibodies for IL-17C |
| SM20210361T SMT202100361T1 (it) | 2016-02-19 | 2017-02-17 | Anticorpi per il-17c |
| IL260733A IL260733B2 (en) | 2016-02-19 | 2017-02-17 | Antibodies for il-17c |
| HRP20211059TT HRP20211059T1 (hr) | 2016-02-19 | 2017-02-17 | Antitijela za il-17c |
| SG11201806161TA SG11201806161TA (en) | 2016-02-19 | 2017-02-17 | Antibodies for il-17c |
| MDE20190007T MD3416983T2 (ro) | 2016-02-19 | 2017-02-17 | Anticorpi pentru homodimerul IL-17C |
| CA3014842A CA3014842A1 (en) | 2016-02-19 | 2017-02-17 | Antibodies for il-17c |
| MA43088A MA43088B1 (fr) | 2016-02-19 | 2017-02-17 | Anticorps anti-il-17c |
| KR1020187024953A KR102715157B1 (ko) | 2016-02-19 | 2017-02-17 | Il-17c에 대한 항체 |
| LTEP17705873.2T LT3416983T (lt) | 2016-02-19 | 2017-02-17 | Il-17c antikūnai |
| CN201780011965.2A CN108699143B (zh) | 2016-02-19 | 2017-02-17 | Il-17c的抗体 |
| JP2018543220A JP6535139B2 (ja) | 2016-02-19 | 2017-02-17 | Il−17cに対する抗体 |
| BR112018016798-3A BR112018016798A2 (en) | 2016-02-19 | 2017-02-17 | specific antibody or antibody fragment, nucleic acid composition, vector composition, cell, and pharmaceutical composition |
| RS20210775A RS62012B1 (sr) | 2016-02-19 | 2017-02-17 | Antitela za il-17c |
| MA44227A MA44227B1 (fr) | 2016-02-19 | 2017-02-17 | Anticorps pour il-17c |
| US16/076,401 US20190048071A1 (en) | 2016-02-19 | 2017-02-17 | Antibodies for il-17c |
| EA201891594A EA037813B1 (ru) | 2016-02-19 | 2017-02-17 | Антитела к il-17c |
| CU2018000087A CU20180087A7 (es) | 2016-02-19 | 2017-02-17 | Anticuerpos para il-17-c |
| MX2018009860A MX2018009860A (es) | 2016-02-19 | 2017-02-17 | Anticuerpos para il-17c. |
| PL17705873T PL3416983T3 (pl) | 2016-02-19 | 2017-02-17 | Przeciwciała dla il-17c |
| DK17705873.2T DK3416983T3 (en) | 2016-02-19 | 2017-02-17 | Antistoffer for il-17c |
| EP17705873.2A EP3416983B1 (en) | 2016-02-19 | 2017-02-17 | Antibodies for il-17c |
| US16/058,143 US10259869B2 (en) | 2016-02-19 | 2018-08-08 | Antibodies for IL-17C |
| PH12018501739A PH12018501739A1 (en) | 2016-02-19 | 2018-08-16 | Antibodies for il-17c |
| CONC2018/0008724A CO2018008724A2 (es) | 2016-02-19 | 2018-08-21 | Anticuerpos para il-17c |
| ZA2018/06249A ZA201806249B (en) | 2016-02-19 | 2018-09-17 | Antibodies for il-17c |
| US16/286,231 US10633439B2 (en) | 2016-02-19 | 2019-02-26 | Antibodies for IL-17C |
| US16/822,844 US11987621B2 (en) | 2016-02-19 | 2020-03-18 | Antibodies for IL-17C |
| CY20211100604T CY1124296T1 (el) | 2016-02-19 | 2021-07-06 | Αντισωματα για il-17c |
| US18/635,426 US20250074978A1 (en) | 2016-02-19 | 2024-04-15 | Antibodies for il-17c |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP16156582.5 | 2016-02-19 | ||
| EP16156582 | 2016-02-19 | ||
| EP16156651.8 | 2016-02-22 | ||
| EP16156651 | 2016-02-22 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/058,143 Continuation US10259869B2 (en) | 2016-02-19 | 2018-08-08 | Antibodies for IL-17C |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017140831A1 true WO2017140831A1 (en) | 2017-08-24 |
Family
ID=58057136
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/053592 Ceased WO2017140831A1 (en) | 2016-02-19 | 2017-02-17 | Antibodies for il-17c |
Country Status (33)
| Country | Link |
|---|---|
| US (5) | US20190048071A1 (https=) |
| EP (1) | EP3416983B1 (https=) |
| JP (2) | JP6535139B2 (https=) |
| KR (1) | KR102715157B1 (https=) |
| CN (1) | CN108699143B (https=) |
| AU (1) | AU2017219837B2 (https=) |
| BR (1) | BR112018016798A2 (https=) |
| CA (1) | CA3014842A1 (https=) |
| CL (1) | CL2018002340A1 (https=) |
| CO (1) | CO2018008724A2 (https=) |
| CU (1) | CU20180087A7 (https=) |
| CY (1) | CY1124296T1 (https=) |
| DK (1) | DK3416983T3 (https=) |
| EA (1) | EA037813B1 (https=) |
| EC (1) | ECSP18070641A (https=) |
| ES (1) | ES2877376T3 (https=) |
| HR (1) | HRP20211059T1 (https=) |
| HU (1) | HUE054755T2 (https=) |
| IL (1) | IL260733B2 (https=) |
| LT (1) | LT3416983T (https=) |
| MA (2) | MA44227B1 (https=) |
| MD (1) | MD3416983T2 (https=) |
| MX (1) | MX2018009860A (https=) |
| PH (1) | PH12018501739A1 (https=) |
| PL (1) | PL3416983T3 (https=) |
| RS (1) | RS62012B1 (https=) |
| SG (1) | SG11201806161TA (https=) |
| SI (1) | SI3416983T1 (https=) |
| SM (1) | SMT202100361T1 (https=) |
| TN (1) | TN2018000289A1 (https=) |
| TW (1) | TW201734041A (https=) |
| WO (1) | WO2017140831A1 (https=) |
| ZA (1) | ZA201806249B (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3359161A1 (en) * | 2015-10-05 | 2018-08-15 | MorphoSys AG | Antagonists of il-17c for the treatment and/or prevention of atopic dermatitis |
| WO2019057982A1 (en) | 2017-09-25 | 2019-03-28 | Morphosys Ag | TREATMENT OF ATOPIC DERMATITIS |
| WO2019171267A1 (en) | 2018-03-06 | 2019-09-12 | Galapagos Nv | Antibodies and pharmaceutical compositions thereof for the treatment of autoimmune skin diseases |
| WO2020008361A1 (en) | 2018-07-03 | 2020-01-09 | Galapagos Nv | High concentration liquid antibody formulations |
| US20220411466A1 (en) * | 2019-11-22 | 2022-12-29 | Morphosys Ag | Method to increase antibody yield during ion exchange chromatography |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| HRP20211059T1 (hr) * | 2016-02-19 | 2021-10-01 | Morphosys Ag | Antitijela za il-17c |
| IL292940A (en) * | 2019-11-22 | 2022-07-01 | Morphosys Ag | Collection of extractant during antibody chromatography |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4708871A (en) | 1983-03-08 | 1987-11-24 | Commonwealth Serum Laboratories Commission | Antigenically active amino acid sequences |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| WO1999060127A2 (en) | 1998-05-15 | 1999-11-25 | Genentech, Inc. | Il-17 homologous polypeptides and therapeutic uses thereof |
| WO2001005950A2 (en) | 1999-07-20 | 2001-01-25 | Morphosys Ag | Methods for displaying (poly)peptides/proteins on bacteriophage particles via disulfide bonds |
| WO2003048731A2 (en) | 2001-12-03 | 2003-06-12 | Abgenix, Inc. | Antibody categorization based on binding characteristics |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| WO2007047738A1 (en) * | 2005-10-18 | 2007-04-26 | Zymogenetics, Inc. | Il-17c antagonists and methods of using the same |
| WO2013057241A1 (en) | 2011-10-19 | 2013-04-25 | Morphosys Ag | Antagonists of il17c for the treatment of inflammatory disorders |
| US8728981B2 (en) | 2010-11-19 | 2014-05-20 | Morphosys Ag | Collection and methods for its use |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2005295421A1 (en) | 2004-10-18 | 2006-04-27 | Zymogenetics, Inc. | Soluble Zcytor21, anti-Zcytor21 antibodies and binding partners and methods of using in inflammation |
| EP2064237A2 (en) | 2006-10-18 | 2009-06-03 | ZymoGenetics, Inc. | Il-17c antagonists and methods of using the same |
| US20120201821A1 (en) * | 2010-10-25 | 2012-08-09 | Gonzalez Jr Lino | Treatment of Gastrointestinal Inflammation and Psoriasis and Asthma |
| WO2013016220A1 (en) | 2011-07-22 | 2013-01-31 | Amgen Inc. | Il-17 receptor a is required for il-17c biology |
| JP2015521591A (ja) * | 2012-06-12 | 2015-07-30 | オレガ・バイオテック | Il−17アイソフォームのアンタゴニストおよびその使用 |
| EP3233915B1 (en) * | 2014-12-15 | 2024-08-28 | MorphoSys AG | Antibodies for il-17c |
| HRP20211059T1 (hr) | 2016-02-19 | 2021-10-01 | Morphosys Ag | Antitijela za il-17c |
-
2017
- 2017-02-17 HR HRP20211059TT patent/HRP20211059T1/hr unknown
- 2017-02-17 SI SI201730777T patent/SI3416983T1/sl unknown
- 2017-02-17 SM SM20210361T patent/SMT202100361T1/it unknown
- 2017-02-17 EA EA201891594A patent/EA037813B1/ru unknown
- 2017-02-17 AU AU2017219837A patent/AU2017219837B2/en active Active
- 2017-02-17 MA MA44227A patent/MA44227B1/fr unknown
- 2017-02-17 LT LTEP17705873.2T patent/LT3416983T/lt unknown
- 2017-02-17 SG SG11201806161TA patent/SG11201806161TA/en unknown
- 2017-02-17 TN TNP/2018/000289A patent/TN2018000289A1/en unknown
- 2017-02-17 IL IL260733A patent/IL260733B2/en unknown
- 2017-02-17 CA CA3014842A patent/CA3014842A1/en active Pending
- 2017-02-17 US US16/076,401 patent/US20190048071A1/en not_active Abandoned
- 2017-02-17 HU HUE17705873A patent/HUE054755T2/hu unknown
- 2017-02-17 JP JP2018543220A patent/JP6535139B2/ja not_active Expired - Fee Related
- 2017-02-17 RS RS20210775A patent/RS62012B1/sr unknown
- 2017-02-17 BR BR112018016798-3A patent/BR112018016798A2/en not_active Application Discontinuation
- 2017-02-17 PL PL17705873T patent/PL3416983T3/pl unknown
- 2017-02-17 CU CU2018000087A patent/CU20180087A7/es unknown
- 2017-02-17 EP EP17705873.2A patent/EP3416983B1/en active Active
- 2017-02-17 MX MX2018009860A patent/MX2018009860A/es unknown
- 2017-02-17 DK DK17705873.2T patent/DK3416983T3/da active
- 2017-02-17 MA MA43088A patent/MA43088B1/fr unknown
- 2017-02-17 WO PCT/EP2017/053592 patent/WO2017140831A1/en not_active Ceased
- 2017-02-17 KR KR1020187024953A patent/KR102715157B1/ko active Active
- 2017-02-17 ES ES17705873T patent/ES2877376T3/es active Active
- 2017-02-17 MD MDE20190007T patent/MD3416983T2/ro unknown
- 2017-02-17 CN CN201780011965.2A patent/CN108699143B/zh active Active
- 2017-02-17 TW TW106105384A patent/TW201734041A/zh unknown
-
2018
- 2018-08-08 US US16/058,143 patent/US10259869B2/en active Active
- 2018-08-16 CL CL2018002340A patent/CL2018002340A1/es unknown
- 2018-08-16 PH PH12018501739A patent/PH12018501739A1/en unknown
- 2018-08-21 CO CONC2018/0008724A patent/CO2018008724A2/es unknown
- 2018-09-17 ZA ZA2018/06249A patent/ZA201806249B/en unknown
- 2018-09-19 EC ECSENADI201870641A patent/ECSP18070641A/es unknown
-
2019
- 2019-02-26 US US16/286,231 patent/US10633439B2/en active Active
- 2019-04-26 JP JP2019086144A patent/JP6916834B2/ja not_active Expired - Fee Related
-
2020
- 2020-03-18 US US16/822,844 patent/US11987621B2/en active Active
-
2021
- 2021-07-06 CY CY20211100604T patent/CY1124296T1/el unknown
-
2024
- 2024-04-15 US US18/635,426 patent/US20250074978A1/en active Pending
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4708871A (en) | 1983-03-08 | 1987-11-24 | Commonwealth Serum Laboratories Commission | Antigenically active amino acid sequences |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| WO1999060127A2 (en) | 1998-05-15 | 1999-11-25 | Genentech, Inc. | Il-17 homologous polypeptides and therapeutic uses thereof |
| WO2001005950A2 (en) | 1999-07-20 | 2001-01-25 | Morphosys Ag | Methods for displaying (poly)peptides/proteins on bacteriophage particles via disulfide bonds |
| WO2003048731A2 (en) | 2001-12-03 | 2003-06-12 | Abgenix, Inc. | Antibody categorization based on binding characteristics |
| WO2007047738A1 (en) * | 2005-10-18 | 2007-04-26 | Zymogenetics, Inc. | Il-17c antagonists and methods of using the same |
| US8728981B2 (en) | 2010-11-19 | 2014-05-20 | Morphosys Ag | Collection and methods for its use |
| WO2013057241A1 (en) | 2011-10-19 | 2013-04-25 | Morphosys Ag | Antagonists of il17c for the treatment of inflammatory disorders |
Non-Patent Citations (32)
| Title |
|---|
| AL-LAZIKANI ET AL., J. MOL. BIOL., vol. 273, 1997, pages 927 - 948 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| CHANG ET AL., IMMUNITY, vol. 35, 2011, pages 611 - 621 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883 |
| FALLON ET AL., NAT GENET., vol. 41, no. 5, 2009, pages 602 - 608 |
| FRIQUET ET AL., J. IMMUNOL. METH., vol. 77, 1985, pages 305 - 19 |
| GEYSEN ET AL., MOL. IMMUNOL, vol. 23, 1986, pages 709 - 715 |
| GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 8, 1984, pages 3998 - 4002 |
| GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 78 - 182 |
| GLENN E.MORRIS: "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS |
| HAENEL ET AL., ANAL BIOCHEM., vol. 339, no. 1, 2005, pages 182 - 84 |
| HOLLINGER; HUDSON, NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1126 - 1136 |
| HOPP ET AL., PROC. NATL. ACAD. SCI USA, vol. 78, 1981, pages 3824 - 3828 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI., vol. 85, 1988, pages 5879 - 5883 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, NIH PUBLICATION NO. 91-3242 |
| KNAPPIK ET AL., J MOL BIOL, vol. 296, 2000, pages 57 - 86 |
| KYTE ET AL., J.MOL. BIOL., vol. 157, 1982, pages 105 - 132 |
| LAZIKANI ET AL., J. MOL. BIO., vol. 273, 1997, pages 927 - 948 |
| LI ET AL., PROC. NATL. ACAD. SCI. U. S. A., vol. 97, 2000, pages 773 - 8 |
| LI M ET AL., J INVEST DERMATOL., vol. 129, no. 2, 2009, pages 498 - 502 |
| LI M ET AL., PROC NATL ACAD SCI USA, vol. 103, no. 31, 2006, pages 11736 - 11741 |
| RAJITA PAPPU ET AL: "The IL-17 Family Cytokines in Immunity and Disease", JOURNAL OF CLINICAL IMMUNOLOGY, KLUWER ACADEMIC PUBLISHERS-PLENUM PUBLISHERS, NE, vol. 30, no. 2, 23 February 2010 (2010-02-23), pages 185 - 195, XP019791216, ISSN: 1573-2592 * |
| RAMIREZ-CARROZZI ET AL., NATURE IMMUNOLOGY, vol. 12, 2011, pages 12 |
| RIZZO H ET AL., J IMMUNOL, vol. 186, no. 3, 2011, pages 1495 - 1502 |
| SAUNDERS ET AL., J ALLERGY CLIN IMMUNOL, vol. 132, no. 5, 2013, pages 1121 - 1129 |
| SONG ET AL., NATURE IMMUNOLOGY, vol. 12, 2011, pages 12 |
| TILLER ET AL., MABS, vol. 5, no. 3, May 2013 (2013-05-01), pages 1 - 26 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| XINYANG SONG, IMMUNITY, vol. 40, 2014, pages 140 - 152 |
| YAMAGUCHI ET AL., J. IMMUNOL, vol. 179, 2007, pages 7128 - 36 |
| ZAPATA ET AL., PROTEIN ENG, vol. 8, 1995, pages 1057 - 1062 |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3359161A1 (en) * | 2015-10-05 | 2018-08-15 | MorphoSys AG | Antagonists of il-17c for the treatment and/or prevention of atopic dermatitis |
| WO2019057982A1 (en) | 2017-09-25 | 2019-03-28 | Morphosys Ag | TREATMENT OF ATOPIC DERMATITIS |
| US20230203149A1 (en) * | 2017-09-25 | 2023-06-29 | Morphosys Ag | Treatment of atopic dermatitis |
| WO2019171267A1 (en) | 2018-03-06 | 2019-09-12 | Galapagos Nv | Antibodies and pharmaceutical compositions thereof for the treatment of autoimmune skin diseases |
| WO2020008361A1 (en) | 2018-07-03 | 2020-01-09 | Galapagos Nv | High concentration liquid antibody formulations |
| CN112533947A (zh) * | 2018-07-03 | 2021-03-19 | 加拉帕戈斯股份有限公司 | 高浓度液体抗体制剂 |
| US20210253692A1 (en) * | 2018-07-03 | 2021-08-19 | Galapagos Nv | High Concentration Liquid Antibody Formulations |
| JP2021530458A (ja) * | 2018-07-03 | 2021-11-11 | ガラパゴス エンフェーGalapagos NV | 高濃度液体抗体製剤 |
| JP7608173B2 (ja) | 2018-07-03 | 2025-01-06 | ガラパゴス エンフェー | 高濃度液体抗体製剤 |
| US20220411466A1 (en) * | 2019-11-22 | 2022-12-29 | Morphosys Ag | Method to increase antibody yield during ion exchange chromatography |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250074978A1 (en) | Antibodies for il-17c | |
| AU2012324895B2 (en) | Antagonists of IL17C for the treatment of inflammatory disorders | |
| KR20210096559A (ko) | 항IL-23p19 항체 및 이의 용도 | |
| CN105431452A (zh) | 中和IL-1β的人单克隆抗体 | |
| IL310427A (en) | Pharmaceutical composition of anti-il4r antibody and use thereof | |
| US10604566B2 (en) | Antagonists of IL-17C for the treatment and/or prevention of atopic dermatitis | |
| KR20240049304A (ko) | 융합 단백질을 함유하는 약학적 조성물 | |
| HK1259711B (en) | Antibodies for il-17c | |
| HK1259711A1 (en) | Antibodies for il-17c |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17705873 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201806161T Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 260733 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201891594 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 2017219837 Country of ref document: AU Date of ref document: 20170217 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2018/009860 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2018543220 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3014842 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 001543-2018 Country of ref document: PE |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018016798 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20187024953 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2018000436 Country of ref document: DZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: CR2018-000449 Country of ref document: CR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017705873 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2017705873 Country of ref document: EP Effective date: 20180919 |
|
| ENP | Entry into the national phase |
Ref document number: 112018016798 Country of ref document: BR Kind code of ref document: A2 Effective date: 20180816 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 744459 Country of ref document: NZ |