WO2017065837A1 - Anti-age antibodies and methods of use thereof - Google Patents

Anti-age antibodies and methods of use thereof Download PDF

Info

Publication number
WO2017065837A1
WO2017065837A1 PCT/US2016/034880 US2016034880W WO2017065837A1 WO 2017065837 A1 WO2017065837 A1 WO 2017065837A1 US 2016034880 W US2016034880 W US 2016034880W WO 2017065837 A1 WO2017065837 A1 WO 2017065837A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
age
sequence identity
amino acid
Prior art date
Application number
PCT/US2016/034880
Other languages
English (en)
French (fr)
Inventor
Lewis S. Gruber
Original Assignee
Siwa Corporation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US14/974,561 external-priority patent/US10358502B2/en
Priority to RU2018110885A priority Critical patent/RU2766209C2/ru
Priority to CA3000815A priority patent/CA3000815C/en
Priority to BR112018007422A priority patent/BR112018007422A2/pt
Priority to CN201680059997.5A priority patent/CN108431044A/zh
Priority to JP2018519727A priority patent/JP2018535953A/ja
Application filed by Siwa Corporation filed Critical Siwa Corporation
Priority to AU2016336959A priority patent/AU2016336959A1/en
Priority to US15/768,425 priority patent/US10889634B2/en
Priority to MX2018004545A priority patent/MX2018004545A/es
Priority to EP16731696.7A priority patent/EP3362483A1/en
Priority to KR1020187010762A priority patent/KR20180056689A/ko
Publication of WO2017065837A1 publication Critical patent/WO2017065837A1/en
Priority to IL258397A priority patent/IL258397A/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/02Muscle relaxants, e.g. for tetanus or cramps
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • A61P27/12Ophthalmic agents for cataracts
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4738Cell cycle regulated proteins, e.g. cyclin, CDC, INK-CCR
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Sarcopenia is the loss of muscle mass, quality and strength associated with aging. Humans begin to lose muscle mass and function at some point in the third decade of life. This loss of muscle mass typically accelerates around age 75.
  • Sarcopenia develops in both physically active and physically inactive people. As the average human lifespan continues to increase, sarcopenia is becoming a significant health concern. The loss of muscle mass from sarcopenia may lead to poor balance, reduced gait speed and frailty. Individuals suffering from sarcopenia are more susceptible to injury and disability, and may be unable to live independently as a result. The spread of sarcopenia will likely result in increases in health care and assisted living expenses.
  • sarcopenia has been considered to be an inevitable result of aging and the natural deterioration of the body over time.
  • the primary treatment for sarcopenia is exercise. Physical exercise, particularly resistance training or strength training, can reduce the impact of sarcopenia.
  • Testosterone, anabolic steroids, ghrelin, vitamin D, angiotensin converting enzyme inhibitors (ACE inhibitors), eicosapentaenoic acid (EPA), myostatin, selective androgen receptor modulators (SARMs), urocortin II (Ucn2) and hormone replacement therapy have been investigated or are being studied as potential treatments for sarcopenia.
  • ACE inhibitors angiotensin converting enzyme inhibitors
  • EPA eicosapentaenoic acid
  • SARMs selective androgen receptor modulators
  • Ucn2 urocortin II
  • FDA U.S. Food and Drug Administration
  • Senescent cells are cells that are partially-functional or non-functional and are in a state of irreversible proliferative arrest. Senescence is a distinct state of a cell, and is associated with biomarkers, such as activation of the biomarker p16 lnk4a , and expression of ⁇ -galactosidase.
  • AGEs Advanced glycation end-products
  • AGEs also referred to AGE-modified proteins, or glycation end-products
  • AGEs arise from a non-enzymatic reaction of sugars with protein side-chains in aging cells
  • Maho K. et al., Membrane Proteins of Human Erythrocytes Are Modified by Advanced Glycation End Products during Aging in the Circulation, Biochem Biophys Res Commun., Vol. 258, 23, 125 (1999)
  • This process begins with a reversible reaction between the reducing sugar and the amino group to form a Schiff base, which proceeds to form a covalently-bonded Amadori rearrangement product.
  • the Amadori product undergoes further rearrangement to produce AGEs.
  • Hyperglycemia caused by diabetes mellitus (DM), and oxidative stress promote this post-translational modification of membrane proteins (Lindsey JB, et al., "Receptor For Advanced Glycation End-Products (RAGE) and soluble RAGE (sRAGE):
  • AGEs have been associated with several pathological conditions including diabetic complications, inflammation, retinopathy, nephropathy, atherosclerosis, stroke, endothelial cell dysfunction, and neurodegenerative disorders (Bierhaus A, "AGEs and their interaction with AGE-receptors in vascular disease and diabetes mellitus. I. The AGE concept,” Cardiovasc Res, Vol. 37(3), 586-600 (1998)).
  • AGE-modified proteins are also a marker of senescent cells. This association between glycation end-product and senescence is well known in the art. See, for example, Gruber, L. (WO 2009/14341 1 , 26 Nov. 2009), Ando, K. et al. (Membrane Proteins of Human Erythrocytes Are Modified by Advanced Glycation End Products during Aging in the Circulation, Biochem Biophys Res Commun., Vol. 258, 123, 125 (1999)), Ahmed, E.K. et al. ("Protein Modification and Replicative Senescence of WI-38 Human Embryonic Fibroblasts" Aging Cells, vol. 9, 252, 260 (2010)), Vlassara, H.
  • Ahmed, E.K. et al. indicates that glycation end-products are "one of the major causes of spontaneous damage to cellular and extracellular proteins" (Ahmed, E.K. et al., see above, page 353). Accordingly, the accumulation of glycation end- products is associated with senescence and lack of function.
  • AD Alzheimer's disease
  • Microglial cell senescence associated with normal aging is exacerbated by the presence of the amyloid plaques indicative of AD (Flanary, B. E. et al., "Evidence That Aging And Amyloid Promote Microglial Cell Senescence", Rejuvenation Research, Vol. 10(1 ), pp. 61-74 (March 2007)).
  • the presence of AGEs with astrocytes and microglial cells in AD is further evidence of the presence of senescent cells (Takeda, A., et al. "Advanced glycation end products co-localize with astrocyes and microglial cells in Alzheimer's disease brain", Acta Neuropathologica, Vol. 95, pp. 555-558 (1998)).
  • Chinta et al. proposed that environmental stressors associated with
  • Parkinson's disease may act in part by eliciting senescence within non-neuronal glial cells, contributing to the characteristic decline in neuronal integrity that occurs in this disorder (Chinta, S. J. et al. "Environmental stress, ageing and glial cell
  • senescence a novel mechanistic link to Parkinson's disease?", J Intern Med, Vol. 273, pp. 429-436 (2013)). Astrocyte senescence is also associated with PD (M. Mori, "The Parkinsonian Brain: Cellular Senescence and Neurodegeneration, SAGE (June 30, 2015) (sage.buckinstitute.org/the-parkinsonian-brain-cellular-senescence-and- neurodegeneration/). In a rodent model of familial amyotrophic lateral sclerosis (ALS) overexpressing mutant superoxide dismutase-1 (m-SOD1 ), the rate of astrocytes acquiring a senescent phenotype is accelerated (Das, M. M.
  • ALS familial amyotrophic lateral sclerosis
  • m-SOD1 mutant superoxide dismutase-1
  • Satellite cells also known as myosatellite cells, present in the muscle tissue of ALS patients exhibit an abnormal senescent-like morphology, although they may be capable of proliferating in vitro (Pradat, P.-F. et al., "Abnormalities of satellite cells function in amyotrophic lateral sclerosis” Amyotrophic Lateral Sclerosis, Vol. 12, pp. 264-271 (201 1 )). Satellite cells are small multipotent cells found in mature muscle, which are able to give rise to additional satellite cells, or differentiate into myoblasts as well as provide additional myonuclei.
  • Myoblasts are precursor cells which differentiate into myocytes (also referred to as muscle cells).
  • a characteristic of PD and Lewy body dementia is the formation of Lewy bodies that form inside nerve cells.
  • the primary structural component of the Lewy bodies is alpha-synuclein protein, in the form of fibrils.
  • the presence of tangles and plaques are a characteristic of AD, the presence of which is used to definitively diagnose the condition.
  • Plaques, composed of beta-amyloid protein also referred to as amyloid beta, ⁇ or Abeta
  • Prion diseases also known as transmissible spongiform encephalopathies (TSEs)
  • TSEs transmissible spongiform encephalopathies
  • TSEs include a variety of human and animal disorder such as Creutzfeldt-Jakob disease, variant Creutzfeldt-Jakob disease, bovine spongiform encephalopathy ("mad cow” disease), scrapie (in sheep and goats), chronic wasting disease (in deer and elk), kuru and fatal familial insomnia.
  • Prion protein is a misfolded protein molecule which may propagate by transmitting a misfolded protein state, resulting in the accumulation of the misfolded protein and causing tissue damage and cell death (Dobson, D.M., "The structural basis of protein folding and its links with human disease” Phil. Trans. R. Soc. Lond. B, Vol. 356, pp. 133-145 (2001)). In these diseases, it is believed the protein is a normal protein which misfolds or forms an abnormal aggregate. In the case of some patients with familial ALS, a mutated superoxide dismutase-1 (SOD1 ) forms inclusions and accumulates (Kato, S., et al.
  • SOD1 superoxide dismutase-1
  • Senescent cells are also known to fuel the growth of cancer cells. Senescent cells are associated with secretion of many factors involved in intercellular signaling, including pro-inflammatory factors; secretion of these factors has been termed the senescence-associated secretory phenotype, or SASP.
  • SASP senescence-associated secretory phenotype
  • the present invention is an anti-AGE antibody, comprising a protein or peptide comprising at least one amino acid sequence having at least 90% sequence identity, preferably at least 95% sequence identity, more preferably at least 98% sequence identity, with an amino acid sequence selected from the group
  • the antibody binds to a protein or peptide that exhibits a carboxymethyllysine modification.
  • the present invention is an anti-AGE antibody, comprising a protein or peptide comprising at least one amino acid sequence having at least 90% sequence identity, preferably at least 95% sequence identity, more preferably at least 98% sequence identity, with an amino acid sequence selected from the group
  • the antibody binds to a protein or
  • the present invention is an anti-AGE antibody comprising a heavy chain and a light chain.
  • the heavy chain comprises an amino acid sequence having at least 90% sequence identity, preferably at least 95% sequence identity, more preferably at least 98% sequence identity, with an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NO: 17, SEQ ID NO: 29, SEQ ID NO: 31 , and SEQ ID NO: 33, or the light chain comprises an amino acid sequence having at least 90% sequence identity, preferably at least 95% sequence identity, more preferably at least 98% sequence identity, with an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 35, SEQ ID NO: 37, and SEQ ID NO: 39.
  • the antibody binds to a protein or peptide that exhibits a
  • the present invention is an anti-AGE antibody comprising a heavy chain and a light chain.
  • the heavy chain comprises an amino acid sequence having at least 90% sequence identity, preferably at least 95% sequence identity, more preferably at least 98% sequence identity, with an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NO: 17, SEQ ID NO: 29, SEQ ID NO: 31 , and SEQ ID NO: 33
  • the light chain comprises an amino acid sequence having at least 90% sequence identity, preferably at least 95% sequence identity, more preferably at least 98% sequence identity, with an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 35, SEQ ID NO: 37, and SEQ ID NO: 39.
  • the antibody binds to a protein or peptide that exhibits a carboxymethyllysine modification.
  • the present invention is an anti-AGE antibody, comprising
  • the antibody binds to a protein or peptide that exhibits a carboxymethyllysine modification.
  • the antibody is substantially non- immunogenic to a species selected from the group consisting of mice, rats, goats, sheep, cows, horses, dogs and cats.
  • the present invention is an antibody conjugate, comprising an anti-AGE antibody fragment comprising a protein or peptide comprising at least one amino acid sequence having at least 90% sequence identity, preferably at least 95% sequence identity, more preferably at least 98% sequence identity, with an amino acid sequence selected from the group consisting of SEQ ID NO: 1 , SEQ ID NO: 3, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 31 , SEQ ID NO: 33, SEQ ID NO 35, SEQ ID NO: 37, and SEQ ID NO: 39, and an agent that causes the destruction of AGE-modified cells.
  • the agent that causes the destruction of AGE-modified cells is conjugated to the anti-AGE antibody fragment.
  • the antibody binds to a protein or peptide that exhibits a carboxymethyllysine modification.
  • peptide means a molecule composed of 2-50 amino acids.
  • protein means a molecule composed of more than 50 amino acids.
  • muscle mass means the syndrome characterized by the presence of (1) low muscle mass and (2) low muscle function (low muscle strength or reduced physical performance).
  • Muscle mass may be measured by body imaging techniques, such as computed tomography scanning (CT scan), magnetic resonance imaging (MRI) or dual energy X-ray absorptiometry (DXA or DEXA); bioimpedance analysis (BIA); body potassium measurement, such as total body potassium (TBK) or partial body potassium (PBK); or anthropometric measurements, such as mid-upper arm circumference, skin fold thickness or calf circumference.
  • CT scan computed tomography scanning
  • MRI magnetic resonance imaging
  • DEXA dual energy X-ray absorptiometry
  • BIOA bioimpedance analysis
  • body potassium measurement such as total body potassium (TBK) or partial body potassium (PBK)
  • anthropometric measurements such as mid-upper arm circumference, skin fold thickness or calf circumference.
  • muscle mass is measured by CT scan, MRI or DXA.
  • Muscle strength may
  • muscle strength is measured by handgrip strength.
  • Physical performance may be measured by the Short Physical Performance Battery, gait speed measurement, timed get-up-and-go (TGUG) or the stair climb power test.
  • TGUG timed get-up-and-go
  • physical performance is measured by gait speed measurement.
  • a subject may be identified as having sarcopenia or in need of treatment if (1) the subject is at least 25 years old and (2) his or her measured muscle mass and measured muscle function are two standard deviations or more below the mean value for healthy 25 year olds of the same gender and no alternative pathology has been identified to account for the reduced muscle mass and reduced muscle function.
  • a subject being treated for sarcopenia is at least 40 years old. More preferably, a subject being treated for sarcopenia is at least 50 years old. Most preferably, a subject being treated for sarcopenia is at least 60 years old.
  • a subject may be identified as having sarcopenia or in need of treatment if (1 ) his or her gait speed is less than 1.0 m/s across a 4 m course and (2) he or she has an objectively measured low muscle mass, such as, for example, an appendicular mass relative to the square of height less than or equal to 7.23 kg/m 2 for male subjects or less than or equal to 5.67 kg/m 2 for female subjects (Fielding, R.
  • neurodegenerative disorder means disorders which result in neurons loosing function and/or dying, in the central nervous system including the brain.
  • disorders included central nervous system neurodegenerative disorders such as AD, PD, Lewy body dementia, MS, prion diseases (also known as transmissible spongiform encephalopathies (TSEs), including Creutzfeldt-Jakob disease, variant Creutzfeldt- Jakob disease, bovine spongiform encephalopathy ("mad cow” disease), scrapie (in sheep and goats), chronic wasting disease (in deer and elk), kuru and fatal familial insomnia), and ALS.
  • TSEs transmissible spongiform encephalopathies
  • Neurodegenerative proteins are proteins which accumulate in a patient having a neurodegenerative disorders and which are associated with the neurodegenerative disorder. Examples include, beta-amyloid protein plaques (associated with AD), tau protein tangles (associated with AD), mutated superoxide dismutase-1 (associated with ALS), prion protein aggregates (associated with TSEs) and alpha-synuclein protein fibrils (associated with PD and Lewy Body dementia).
  • a “neurodegenerative protein” is the form of the protein which accumulates during the neurodegenerative disorder, typically a mutant or mis-folded form.
  • AGE-modified protein or peptide refers to modified proteins or peptides that are formed as the result of the reaction of sugars with protein side chains that further rearrange and form irreversible cross-links. This process begins with a reversible reaction between a reducing sugar and an amino group to form a Schiff base, which proceeds to form a covalently-bonded Amadori rearrangement product. Once formed, the Amadori product undergoes further rearrangement to produce AGEs.
  • AGE- modified proteins and antibodies to AGE-modified proteins are described in U.S.
  • Glycated proteins or peptides that have not undergone the necessary rearrangement to form AGEs are not AGEs.
  • AGEs may be identified by the presence of AGE modifications (also referred to as AGE epitopes or AGE moieties) such as 2-(2-furoyl)-4(5)-(2-furanyl)-1 H-imidazole (“FFI”); 5- hydroxymethyl-1-alkylpyrrole-2-carbaldehyde (“Pyrraline”); 1-alkyl-2-formyl-3,4- diglycosyl pyrrole (“AFGP”), a non-fluorescent model AGE; carboxymethyllysine; and pentosidine.
  • ALI another AGE, is described in Al-Abed.
  • an antibody that binds to an AGE-modified protein on a cell means an antibody, antibody fragment or other protein or peptide that binds to an AGE-modified protein or peptide which preferably includes a constant region of an antibody, where the protein or peptide which has been AGE- modified is a protein or peptide normally found bound on the surface of a cell, preferably a mammalian cell, more preferably a human, cat, dog, horse, camelid (for example, camel or alpaca), cattle, sheep, or goat cell.
  • an antibody that binds to an AGE- modified protein on a cell does not include an antibody or other protein which binds with the same specificity and selectivity to both the AGE-modified protein or peptide, and the same non-AGE-modified protein or peptide (that is, the presence of the AGE modification does not increase binding).
  • AGE- modified albumin is not an AGE-modified protein on a cell, because albumin is not a protein normally found bound on the surface of cells.
  • An antibody that binds to an AGE-modified protein on a cell only includes those antibodies which lead to removal, destruction, or death of the cell.
  • antibodies which are conjugated, for example to a toxin, drug, or other chemical or particle Preferably, the antibodies are monoclonal antibodies, but polyclonal antibodies are also possible.
  • senescent cell means a cell which is in a state of irreversible proliferative arrest and expresses one or more biomarkers of senescence, such as activation of p16 lnk4a or expression of senescence-associated ⁇ -galactosidase. Also included are cells which express one or more biomarkers of senescence, do not proliferate in vivo, but may proliferate in vitro under certain conditions, such as some satellite cells found in the muscles of ALS patients.
  • age-related phenotypes include, for example, sarcopenia, cataracts, loss of adipose tissue and lordokyphosis.
  • variant means a nucleotide, protein or amino acid sequence different from the specifically identified sequences, wherein one or more nucleotides, proteins or amino acid residues is deleted, substituted or added. Variants may be naturally- occurring allelic variants, or non-naturally-occurring variants. Variants of the identified sequences may retain some or all of the functional characteristics of the identified sequences.
  • percent (%) sequence identity is defined as the percentage of amino acid residues in a candidate sequence that are identical to the amino acid residues in a reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Preferably, % sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program is publicly available from Genentech, Inc.
  • ALIGN-2 (South San Francisco, CA), or may be compiled from the source code, which has been filed with user documentation in the U.S. Copyright Office and is registered under U.S. Copyright Registration No. TXU510087.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • the % sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B.
  • FIG. 1 is a graph of the response versus time in an antibody binding experiment.
  • the identification of a link between cellular senescence and sarcopenia allows for new treatment possibilities. For example, if anti-AGE antibodies are administered to a subject, the antibodies will specifically and selectively target senescent cells, and kill or induce apoptosis in such cells expressing an AGE-modified protein or peptide.
  • the present invention makes use of the discovery that enhanced clearance of cells expressing AGE-modified proteins or peptides (AGE-modified cells) is beneficial in treating or ameliorating sarcopenia. This may be accomplished by administering anti- AGE antibodies to a subject.
  • Administering anti-AGE antibodies to a subject may also be used for increasing health span. Health span may be increased by reducing age-related phenotypes. Administering anti-AGE antibodies may be used, for example, to prevent or delay the onset of cataracts, lordokyphosis or loss of adipose tissue.
  • anti-AGE antibodies may be used therapeutically to treat neurodegenerative disorders or cancer.
  • anti-AGE antibody or "AGE antibody”
  • Examples include those described in U.S.
  • Examples include an antibody that binds to one or more AGE-modified proteins having an AGE modification such as FFI, pyrraline, AFGP, ALI, carboxymethyllysine, carboxyethyllysine and pentosidine, and mixtures of such antibodies.
  • the antibody binds carboxymethyllysine- modified proteins.
  • the antibody is non-immunogenic to the animal in which it will be used, such as non-immunogenic to humans; companion animals including cats, dogs and horses; and commercially important animals, such camels (or alpaca), cattle (bovine), sheep, and goats.
  • the antibody has the same species constant region as antibodies of the animal to reduce the immune response against the antibody, such as being humanized (for humans), felinized (for cats), caninized (for dogs), equuinized (for horses), camelized (for camels or alpaca), bovinized (for cattle), ovinized (for sheep), or caperized (for goats).
  • the antibody is identical to that of the animal in which it will be used (except for the variable region), such as a human antibody, a cat antibody, a dog antibody, a horse antibody, a camel antibody, a bovine antibody, a sheep antibody or a goat antibody. Details of the constant regions and other parts of antibodies for these animals are described below.
  • the antibody is a monoclonal antibody.
  • a particularly preferred anti-AGE antibody is an antibody which binds to a protein or peptide that exhibits a carboxymethyllysine modification.
  • Carboxymethyllysine also known as CML, N(epsilon)-(carboxymethyl)lysine, N(6)-carboxymethyllysine, or 2- Amino-6-(carboxymethylamino)hexanoic acid
  • CML-modified proteins or peptides are recognized by the receptor RAGE which is expressed on a variety of cells. CML has been well-studied and CML-related products are commercially available.
  • CML-BSA antigens for example, Cell Biolabs, Inc. sells CML-BSA antigens, CML polyclonal antibodies, CML immunoblot kits, and CML competitive ELISA kits (www.cellbiolabs.com/cml-assays).
  • a particularly preferred antibody includes the variable region of the commercially available mouse anti-glycation end-product antibody raised against carboxymethyl lysine conjugated with keyhole limpet hemocyanin, the carboxymethyl lysine MAb (Clone 318003) available from R&D Systems, Inc.
  • the anti-AGE antibody has low rate of dissociation from the antibody-antigen complex, or k d (also referred to as k back or off-rate), preferably at most 9 x 10 ⁇ 3 , 8 x 10 ⁇ 3 , 7 x 10 ⁇ 3 or 6 x 10 "3 (sec 1 ).
  • the anti-AGE antibody has a high affinity for the AGE- modified protein of a cell, which may be expressed as a low dissociation constant K D of at most 9 x 10 '6 , 8 x 10 '6 , 7 x 10 "6 , 6 x 10 " *, 5 x 10 "6 , 4 x 10 '6 or 3 x 10 '6 (M).
  • the binding properties of the anti-AGE antibody are similar to, the same as, or superior to the carboxymethyl lysine MAb (Clone 318003) available from R&D Systems, Inc. (Minneapolis, MN; catalog no. MAB3247), illustrated in FIG. 1.
  • carboxymethyl lysine MAb Clone 318003 available from R&D Systems, Inc. (Minneapolis, MN; catalog no. MAB3247), illustrated in FIG. 1.
  • the anti-AGE antibody may destroy AGE-modified cells through antibody- dependent cell-mediated cytotoxicity (ADCC).
  • ADCC is a mechanism of cell-mediated immune defense in which an effector cell of the immune system actively lyses a target cell whose membrane-surface antigens have been bound by specific antibodies.
  • ADCC may be mediated by natural killer (NK) cells, macrophages, neutrophils or eosinophils. The effector cells bind to the Fc portion of the bound antibody.
  • the anti-AGE antibody may be conjugated to an agent that causes the destruction of AGE-modified cells.
  • agents may be a toxin, a cytotoxic agent, magnetic nanoparticles, and magnetic spin-vortex discs.
  • a toxin such as pore-forming toxins (PFT) (Aroian R. et a/., "Pore-Forming Toxins and Cellular Non-Immune Defenses (CNIDs),” Current Opinion in Microbiology, 10:57-61 (2007)) conjugated to an anti-AGE antibody may be injected into a patient to selectively target and remove AGE-modified cells.
  • the anti-AGE antibody recognizes and binds to AGE-modified cells. Then, the toxin causes pore formation at the cell surface and subsequent cell removal through osmotic lysis.
  • Magnetic nanoparticles conjugated to the anti-AGE antibody may be injected into a patient to target and remove AGE-modified cells.
  • the magnetic nanoparticles can be heated by applying a magnetic field in order to selectively remove the AGE-modified cells.
  • magnetic spin-vortex discs which are magnetized only when a magnetic field is applied to avoid self-aggregation that can block blood vessels, begin to spin when a magnetic field is applied, causing membrane disruption of target cells.
  • Magnetic spin-vortex discs, conjugated to anti-AGE antibodies specifically target AGE- modified cell types, without removing other cells.
  • Antibodies typically comprise two heavy chains and two light chains of polypeptides joined to form a ⁇ " shaped molecule.
  • the constant region determines the mechanism used to target the antigen.
  • the amino acid sequence in the tips of the "Y" (the variable region) varies among different antibodies. This variation gives the antibody its specificity for binding antigen.
  • the variable region which includes the ends of the light and heavy chains, is further subdivided into hypervariable (HV - also sometimes referred to as complementarity determining regions, or CDRs) and framework (FR) regions.
  • bi-specific antibodies When antibodies are prepared recombinantly, it is also possible to have a single antibody with variable regions (or complementary determining regions) that bind to two different antigens, with each tip of the " being specific to each antigen; these are referred to as bi-specific antibodies.
  • a humanized anti-AGE antibody according to the present invention may have the human constant region sequence of amino acids shown in SEQ ID NO: 22.
  • the heavy chain complementarity determining regions of the humanized anti-AGE antibody may have one or more of the protein sequences shown in SEQ ID NO: 23 (CDR1 H), SEQ ID NO: 24 (CDR2H) and SEQ ID NO: 25 (CDR3H).
  • the light chain complementarity determining regions of the humanized anti-AGE antibody may have one or more of the protein sequences shown in SEQ ID NO: 26 (CDR1 L), SEQ ID NO: 27 (CDR2L) and SEQ ID NO: 28 (CDR3L).
  • the heavy chain of human (Homo sapiens) antibody immunoglobulin G1 may have or may include the protein sequence of SEQ ID NO: 1 .
  • the variable domain of the heavy chain may have or may include the protein sequence of SEQ ID NO: 2.
  • the complementarity determining regions of the variable domain of the heavy chain (SEQ ID NO: 2) are shown in SEQ ID NO: 41 , SEQ ID NO: 42 and SEQ ID NO: 43.
  • the kappa light chain of human (Homo sapiens) antibody immunoglobulin G1 may have or may include the protein sequence of SEQ ID NO: 3.
  • the variable domain of the kappa light chain may have or may include the protein sequence of SEQ ID NO: 4.
  • the arginine (Arg or R) residue at position 128 of SEQ ID NO: 4 may be omitted.
  • the complementarity determining regions of the variable domain of the light chain (SEQ ID NO: 4) are shown in SEQ ID NO: 44, SEQ ID NO: 45 and SEQ ID NO. 46.
  • the variable regions may be codon-optimized, synthesized and cloned into expression vectors containing human immunoglobulin G1 constant regions.
  • the variable regions may be used in the humanization of non-human antibodies.
  • the antibody heavy chain may be encoded by the DNA sequence of SEQ ID NO: 12, a murine anti-AGE immunoglobulin G2b heavy chain.
  • the protein sequence of the murine anti-AGE immunoglobulin G2b heavy chain encoded by SEQ ID NO: 12 is shown in SEQ ID NO: 16.
  • the variable region of the murine antibody is shown in SEQ ID NO: 20, which corresponds to positions 25-142 of SEQ ID NO: 16.
  • the antibody heavy chain may alternatively be encoded by the DNA sequence of SEQ ID NO: 13, a chimeric anti-AGE human immunoglobulin G1 heavy chain.
  • the protein sequence of the chimeric anti-AGE human immunoglobulin G1 heavy chain encoded by SEQ ID NO: 13 is shown in SEQ ID NO: 17.
  • the chimeric anti-AGE human immunoglobulin includes the murine variable region of SEQ ID NO: 20 in positions 25-142.
  • the antibody light chain may be encoded by the DNA sequence of SEQ ID NO: 14, a murine anti-AGE kappa light chain.
  • the protein sequence of the murine anti-AGE kappa light chain encoded by SEQ ID NO: 14 is shown in SEQ ID NO: 18.
  • the variable region of the murine antibody is shown in SEQ ID NO: 21 , which corresponds to positions 21-132 of SEQ ID NO: 18.
  • the antibody light chain may alternatively be encoded by the DNA sequence of SEQ ID NO: 15, a chimeric anti-AGE human kappa light chain.
  • the protein sequence of the chimeric anti-AGE human kappa light chain encoded by SEQ ID NO: 15 is shown in SEQ ID NO: 19.
  • the chimeric anti-AGE human immunoglobulin includes the murine variable region of SEQ ID NO: 21 in positions 21 -132.
  • a humanized anti-AGE antibody according to the present invention may have or may include one or more humanized heavy chains or humanized light chains.
  • a humanized heavy chain may be encoded by the DNA sequence of SEQ ID NO: 30, 32 or 34.
  • the protein sequences of the humanized heavy chains encoded by SEQ ID NOs: 30, 32 and 34 are shown in SEQ ID NOs: 29, 31 and 33, respectively.
  • a humanized light chain may be encoded by the DNA sequence of SEQ ID NO: 36, 38 or 40.
  • the protein sequences of the humanized light chains encoded by SEQ ID NOs: 36, 38 and 40 are shown in SEQ ID NOs: 35, 37 and 39, respectively.
  • the humanized anti-AGE antibody maximizes the amount of human sequence while retaining the original antibody specificity.
  • a complete humanized antibody may be constructed that contains a heavy chain having a protein sequence chosen from SEQ ID NOs: 29, 31 and 33 and a light chain having a protein sequence chosen from SEQ ID NOs: 35, 37 and 39.
  • the protein sequence of an antibody from a non-human species may be modified to include the variable domain of the heavy chain having the sequence shown in SEQ ID NO: 2 or the kappa light chain having the sequence shown in SEQ ID NO: 4.
  • the non-human species may be a companion animal, such as the domestic cat or domestic dog, or livestock, such as cattle, the horse or the camel. Preferably, the non-human species is not the mouse.
  • the heavy chain of the horse (Equus caballus) antibody immunoglobulin gamma 4 may have or may include the protein sequence of SEQ ID NO: 5 (EMBL/GenBank accession number AY445518).
  • the heavy chain of the horse (Equus caballus) antibody immunoglobulin delta may have or may include the protein sequence of SEQ ID NO: 6 (EMBL/GenBank accession number AY631942).
  • the heavy chain of the dog (Canis familiaris) antibody immunoglobulin A may have or may include the protein sequence of SEQ ID NO: 7 (GenBank accession number L36871 ).
  • the heavy chain of the dog (Canis familiaris) antibody immunoglobulin E may have or may include the protein sequence of SEQ ID NO: 8 (GenBank accession number L36872).
  • the heavy chain of the cat (Felis catus) antibody immunoglobulin G2 may have or may include the protein sequence of SEQ ID NO: 9 (DDBJ/EMBL/GenBank accession number KF811175).
  • camelids Animals of the camelid family, such as camels (Camelus dromedarius and Camelus bactrianus), llamas (Lama glama, Lama pacos and Lama vicugna), alpacas (Vicugna pacos) and guanacos (Lama guanicoe), have a unique antibody that is not found in other mammals.
  • camelids In addition to conventional immunoglobulin G antibodies composed of heavy and light chain tetramers, camelids also have heavy chain immunoglobulin G antibodies that do not contain light chains and exist as heavy chain dimers.
  • variable domain of a camelid heavy chain antibody is known as the VHH.
  • the camelid heavy chain antibodies lack the heavy chain CH1 domain and have a hinge region that is not found in other species.
  • the variable region of the Arabian camel (Camelus dromedarius) single-domain antibody may have or may include the protein sequence of SEQ ID NO: 10 (GenBank accession number
  • variable region of the heavy chain of the Arabian camel (Camelus dromedarius) tetrameric immunoglobulin may have or may include the protein sequence of SEQ ID NO: 11 (GenBank accession number AJ245184).
  • heavy chain antibodies are also found in cartilaginous fishes, such as sharks, skates and rays.
  • This type of antibody is known as an immunoglobulin new antigen receptor or IgNAR
  • the variable domain of an IgNAR is known as the VNAR.
  • the IgNAR exists as two identical heavy chain dimers composed of one variable domain and five constant domains each. Like camelids, there is no light chain.
  • the protein sequences of additional non-human species may be readily found in online databases, such as the International ImMunoGeneTics Information System (www.imgt.org), the European Bioinformatics Institute (www.ebi.ac.uk), the DNA Databank of Japan (ddbj.nig.ac.jp/arsa) or the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov).
  • An anti-AGE antibody or a variant thereof may include a heavy chain variable region having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO:
  • variable region having at least 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity may contain substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-AGE antibody including that sequence retains the ability to bind to AGE.
  • substitutions, insertions, or deletions may occur in regions outside the variable region.
  • An anti-AGE antibody or a variant thereof may include a light chain variable region having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 4 or SEQ ID NO:
  • variable region having at least 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity may contain substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-AGE antibody including that sequence retains the ability to bind to AGE.
  • substitutions, insertions, or deletions may occur in regions outside the variable region.
  • the antibody may have the complementarity determining regions of commercially available mouse anti-glycation end-product antibody raised against carboxymethyl lysine conjugated with keyhole limpet hemocyanin (CML-KLH), the carboxymethyl lysine MAb (Clone 318003) available from R&D Systems, Inc.
  • CML-KLH keyhole limpet hemocyanin
  • CDN carboxymethyl lysine MAb
  • the antibody may have or may include constant regions which permit destruction of targeted cells by a subject's immune system.
  • Bi-specific antibodies which are anti-AGE antibodies directed to two different epitopes, may also be used. Such antibodies will have a variable region (or
  • Antibody fragments may be used in place of whole antibodies.
  • immunoglobulin G may be broken down into smaller fragments by digestion with enzymes.
  • Papain digestion cleaves the N-terminal side of inter-heavy chain disulfide bridges to produce Fab fragments.
  • Fab fragments include the light chain and one of the two N-terminal domains of the heavy chain (also known as the Fd fragment).
  • Pepsin digestion cleaves the C-terminal side of the inter-heavy chain disulfide bridges to produce F(ab')2 fragments.
  • F(ab')2 fragments include both light chains and the two N- terminal domains linked by disulfide bridges.
  • Pepsin digestion may also form the Fv (fragment variable) and Fc (fragment crystallizable) fragments.
  • the Fv fragment contains the two N-terminal variable domains.
  • the Fc fragment contains the domains which interact with immunoglobulin receptors on cells and with the initial elements of the complement cascade.
  • Pepsin may also cleave immunoglobulin G before the third constant domain of the heavy chain (C H 3) to produce a large fragment F(abc) and a small fragment pFc'.
  • Antibody fragments may alternatively be produced recombinantly. If additional antibodies are desired, they can be produced using well-known methods.
  • polyclonal antibodies can be raised in a mammalian host by one or more injections of an immunogen, and if desired, an adjuvant.
  • an immunogen and if desired, an adjuvant.
  • the immunogen (and adjuvant) is injected in a mammal by a subcutaneous or intraperitoneal injection.
  • the immunogen may be an AGE-modified protein of a cell, such as AGE-antithrombin III, AGE-calmodulin, AGE-insulin, AGE-ceruloplasmin, AGE- collagen, AGE-cathepsin B, AGE-albumin, AGE-crystallin, AGE-plasminogen activator, AGE-endothelial plasma membrane protein, AGE-aldehyde reductase, AGE-transferrin, AGE-fibrin, AGE-copper/zinc SOD, AGE-apo B, AGE-fibronectin, AGE-pancreatic ribose, AGE-apo A-l and II, AGE-hemoglobin, AGE-Na + /K + -ATPase, AGE-plasminogen, AGE-myelin, AGE-lysozyme, AGE-immunoglobulin, AGE-red cell Glu transport protein, AGE-P-N-ace
  • AGE-modified cells such as AGE- modified erythrocytes, whole, lysed, or partially digested, may also be used as AGE antigens.
  • adjuvants include Freund's complete, monophosphoryl Lipid A synthetic-trehalose dicorynomycolate, aluminum hydroxide (alum), heat shock proteins HSP 70 or HSP96, squalene emulsion containing monophosphoryl lipid A, a2- macroglobulin and surface active substances, including oil emulsions, pleuronic polyols, polyanions and dinitrophenol.
  • an immunogen may be conjugated to a polypeptide that is immunogenic in the host, such as keyhole limpet hemocyanin (KLH), serum albumin, bovine thyroglobulin, cholera toxin, labile
  • pAbs may be made in chickens, producing IgY molecules.
  • Monoclonal antibodies (mAbs) may also be made by immunizing a host or lymphocytes from a host, harvesting the mAb-secreting (or potentially secreting) lymphocytes, fusing those lymphocytes to immortalized cells (for example, myeloma cells), and selecting those cells that secrete the desired mAb.
  • Other techniques may be used, such as the EBV-hybridoma technique.
  • chimeric antibodies that are substantially human (humanized) or substantially “ized” to another animal (such as cat, dog, horse, camel or alpaca, cattle, sheep, or goat) at the amino acid level.
  • the mAbs may be purified from the culture medium or ascites fluid by conventional procedures, such as protein A-sepharose, hydroxylapatite
  • human monoclonal antibodies can be generated by immunization of transgenic mice containing a third copy IgG human trans-loci and silenced endogenous mouse Ig loci or using human-transgenic mice. Production of humanized monoclonal antibodies and fragments thereof can also be generated through phage display technologies.
  • a “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.
  • Preferred examples of such carriers or diluents include water, saline, Ringer's solutions and dextrose solution. Supplementary active compounds can also be incorporated into the compositions.
  • Solutions and suspensions used for parenteral administration can include a sterile diluent, such as water for injection, saline solution, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injection include sterile aqueous solutions or dispersions for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, CREMOPHOR EL® (BASF; Parsippany, NJ) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid so as to be administered using a syringe.
  • Such compositions should be stable during manufacture and storage and must be preserved against contamination from microorganisms such as bacteria and fungi.
  • Various antibacterial and anti-fungal agents for example, parabens, chlorobutanol, phenol, ascorbic acid, and thimerosal, can contain microorganism contamination.
  • Isotonic agents such as sugars, polyalcohols, such as manitol, sorbitol, and sodium chloride can be included in the composition.
  • Compositions that can delay absorption include agents such as aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by incorporating antibodies, and optionally other therapeutic agents, and optionally other therapeutic agents, and optionally other therapeutic agents, and optionally other therapeutic agents, and optionally other therapeutic agents.
  • Methods of preparation of sterile solids for the preparation of sterile injectable solutions include vacuum drying and freeze-drying to yield a solid.
  • the antibodies may be delivered as an aerosol spray from a nebulizer or a pressurized container that contains a suitable propellant, for example, a gas such as carbon dioxide.
  • a suitable propellant for example, a gas such as carbon dioxide.
  • Antibodies may also be delivered via inhalation as a dry powder, for example using the iSPERSETM inhaled drug delivery platform (PULMATRIX, Lexington, Mass.).
  • the use of anti-AGE antibodies which are chicken antibodies (IgY) may be non-immunogenic in a variety of animals, including humans, when administered by inhalation.
  • An appropriate dosage level of each type of antibody will generally be about 0.01 to 500 mg per kg patient body weight.
  • the dosage level will be about 0.1 to about 250 mg/kg; more preferably about 0.5 to about 100 mg/kg.
  • a suitable dosage level may be about 0.01 to 250 mg/kg, about 0.05 to 100 mg/kg, or about 0.1 to 50 mg/kg. Within this range the dosage may be 0.05 to 0.5, 0.5 to 5 or 5 to 50 mg/kg.
  • each type of antibody may be administered on a regimen of 1 to 4 times per day, such as once or twice per day, antibodies typically have a long half-life in vivo. Accordingly, each type of antibody may be administered once a day, once a week, once every two or three weeks, once a month, or once every 60 to 90 days.
  • a subject that receives administration of an anti-AGE antibody may be tested to determine if it has been effective to treat the sarcopenia, by measuring changes in muscle mass over time. For example, a baseline muscle mass in a subject may be measured followed by administration of the anti-AGE antibody. The effectiveness of the treatment may be determined by periodically measuring muscle mass in the subject and comparing the subsequent measurements to the baseline measurement. A subject may be considered to have effective treatment of sarcopenia if he or she does not demonstrate loss of muscle mass between subsequent measurements or over time. Alternatively, the concentration and/or number of senescent cells in fat or muscle tissue may also be monitored. Administration of antibody and subsequent testing may be repeated until the desired therapeutic result is achieved.
  • Unit dosage forms can be created to facilitate administration and dosage uniformity.
  • Unit dosage form refers to physically discrete units suited as single dosages for the subject to be treated, containing a therapeutically effective quantity of one or more types of antibodies in association with the required pharmaceutical carrier.
  • the unit dosage form is in a sealed container and is sterile.
  • Any mammal that could develop sarcopenia or other diseases or disorders associated with cellular senescence may be treated by the methods herein described.
  • Humans are a preferred mammal for treatment.
  • Other mammals that may be treated include mice, rats, goats, sheep, cows, horses and companion animals, such as dogs or cats.
  • a subject in need of treatment may be identified by the diagnosis of a disease or disorder that is known to cause elevated levels of AGEs such as, for example, diabetes (both Type 1 and Type 2), or the presence of a pathological condition associated with AGEs such as, for example, atherosclerosis, inflammation, retinopathy, nephropathy, stroke, endothelial cell dysfunction, neurodegenerative disorders or cancer.
  • subjects may be identified for treatment based on their age.
  • a human over 75 years of age may be treated for sarcopenia, while a human under 30 years of age might not be identified as in need of treatment for sarcopenia.
  • any of the mammals or subjects identified above may be excluded from the patient population in need of treatment for sarcopenia.
  • a subject may be identified as having sarcopenia or in need of treatment if (1) the subject is at least 25 years old and (2) his or her measured muscle mass and measured muscle function are two standard deviations or more below the mean value for healthy 25 year olds of the same gender and no alternative pathology has been identified to account for the reduced muscle mass and reduced muscle function.
  • a subject being treated for sarcopenia is at least 40 years old. More preferably, a subject being treated for sarcopenia is at least 50 years old. Most preferably, a subject being treated for sarcopenia is at least 60 years old.
  • a subject may be identified as having sarcopenia or in need of treatment if (1 ) his or her gait speed is less than 1.0 m/s across a 4 m course and (2) he or she has an objectively measured low muscle mass, such as, for example, an appendicular mass relative to the square of height less than or equal to 7.23 kg/m 2 for male subjects or less than or equal to 5.67 kg/m 2 for female subjects.
  • an objectively measured low muscle mass such as, for example, an appendicular mass relative to the square of height less than or equal to 7.23 kg/m 2 for male subjects or less than or equal to 5.67 kg/m 2 for female subjects.
  • a composition containing the anti-AGE antibody directly into the central nervous system.
  • administration include intrathecal administration; administration into the ventricular system of the brain (intraventricular administration), for example, through a catheter or a permanent shunt, or other administration device which may be placed during a ventriculostomy (see, for example, Takami, A. et al. "Treatment of primary central nervous system lymphoma with induction of complement-dependent cytotoxicity by intraventricular administration of autologous- serum-supplemented rituximab", Cancer Sci. Vol. 97, pp.
  • central nervous system administration may optionally also include administration of a serum supplement (such as autologous serum), to enhance the cell killing properties of the AGE antibody; administration of serum supplement may be prior to, simultaneous with, or subsequent to, the administration of the AGE antibody.
  • a serum supplement such as autologous serum
  • any of the composition containing AGE antibodies described herein may further contain a serum supplement (such as an autologous serum supplement).
  • a serum supplement such as an autologous serum supplement
  • purified immune system cells may also be used, either autologous immune system cells, or immune system cells from a donor; examples of such cells include natural killer cells.
  • artificial natural killer cells such as those of NANTKWEST®, engineered to bind directly to antibodies, or engineered to bind directly to an AGE antigen (such as carboxymethyllysine) (see www.nantkwest.com).
  • a mammal that could develop metastatic cancer may be treated by the methods herein described.
  • Humans are a preferred mammal for treatment.
  • Other mammals that may be treated include mice, rats, goats, sheep, cows, horses and companion animals, such as dogs or cats.
  • a subject in need of treatment may be identified by the diagnosis of a cancer.
  • Cancers which are particularly subject to metastasis include lung cancer, melanoma, colon cancer, renal cell carcinoma, prostate cancer, cancer of the cervix, bladder cancer, rectal cancer, esophageal cancer, liver cancer, mouth and throat cancer, multiple myeloma, ovarian cancer, and stomach cancer. Treatment may be of patients experiencing metastatic cancer.
  • Treatment may also be administered to patients who have cancer, but prior to any identified metastasis, in order to prevent metastasis.
  • a subject that receives administration of an anti-AGE antibody may be tested to determine if it has been effective to treat the cancer by examining the patient for the spread of the cancer to different parts of the body, particularly in lymph nodes. Administration of antibody and subsequent testing may be repeated until the desired therapeutic result is achieved.
  • the anti-AGE antibodies may be used in cellular purification processes, such as immunopanning and immunoadsorption. Purification processes are useful in isolating desirable or unwanted cells from tissue cultures, cell cultures or blood. Cellular purification may be used in transplantations, such as a bone marrow transplant, or transfusions, such as a blood transfusion. Cellular purification is especially useful in autologous stem cell transplantation during chemotherapy to remove malignant cells and concentrate beneficial stem cells, such as hematopoietic cells expressing the CD34 protein (CD34 + cells). Immunopanning or immunoadsorption using an anti-AGE antibody may isolate partially-functional or non-functional cells, such as senescent cells, from a tissue culture, cell culture or blood sample.
  • cellular purification processes are useful in isolating desirable or unwanted cells from tissue cultures, cell cultures or blood.
  • Cellular purification may be used in transplantations, such as a bone marrow transplant, or transfusions, such as a blood transfusion. Cellular purification is especially useful in autolog
  • an immunopanning process may involve immobilizing the anti-AGE antibody on a surface, such as a cell culture plate.
  • a tissue culture or cell culture may then be applied to the surface. Any senescent cells present in the tissue culture or cell culture will bind to the anti-AGE antibody, leaving a purified tissue culture or cell culture that is free from senescent cells.
  • an immunoadsorption process may involve binding the anti-AGE antibody to senescent cells in a cell culture.
  • the cells may then be passed through a column packed with beads that are coated with a protein that binds to the anti-AGE labeled senescent cells.
  • the cells which pass through the column without binding will be cells that do not express AGE, such as fully-functional cells.
  • An immunoadsorption process may be carried out with a CEPRATE SC Stem Cell Concentration System (CellPro, Inc., Bothell, WA) or similar apparatus.
  • CellPro, Inc. Bothell, WA
  • the one-letter amino acid sequence that corresponds to SEQ ID NO: 1 is shown below:
  • Positions 16-133 of the above amino acid sequence correspond to SEQ ID NO: 2. Positions 46-50 of the above amino acid sequence correspond to SEQ ID NO: 41 . Positions 65-81 of the above amino acid sequence correspond to SEQ ID NO: 42. Positions 1 14-122 of the above amino acid sequence correspond to SEQ ID NO: 43.
  • Positions 16-128 of the above amino acid sequence correspond to SEQ ID NO: 4.
  • the arginine (Arg or R) residue at position 128 of SEQ ID NO: 4 may be omitted.
  • Positions 39-54 of the above amino acid sequence correspond to SEQ ID NO: 44.
  • Positions 70-76 of the above amino acid sequence correspond to SEQ ID NO: 45.
  • Positions 109-1 17 of the above amino acid sequence correspond to SEQ ID NO: 46.
  • VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL SLSPGK
  • the one-letter amino acid sequence that corresponds to SEQ ID NO: 31 is MDPKGSLSWRILLFLSLAFELSYGQVQLVQSGAEVKKPGASVKVSCKASGYLFTTYW MHWVRQAPGQGLEWMGEISPTNGRAYYNAKFQGRVTMTVDKSTNTAYMELSSLRSE DTAVYYCARAYGNYFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNH
  • Example 1 In vivo study of the administration of anti-glycation end-product
  • the antibody was administered to the aged CD1 (ICR) mouse (Charles River Laboratories), twice daily by intravenous injection, once a week, for three weeks (Days 1 , 8 and 15), followed by a 10 week treatment-free period.
  • the test antibody was a commercially available mouse anti-glycation end-product antibody raised against carboxymethyl
  • MAB3247 A control reference of physiological saline was used in the control animals.
  • mice referred to as "young” were 8 weeks old, while mice referred to as “old” were 88 weeks ( ⁇ 2 days) old. No adverse events were noted from the administration of the antibody.
  • the different groups of animals used in the study are shown in Table 1.
  • Pre Subset of animals euthanized prior to treatment start for collection of adipose tissue.
  • Example 2 Affinity and kinetics of test antibody
  • Example 1 The affinity and kinetics of the test antibody used in Example 1 were analyzed using Na,Na-bis(carboxymethyl)-L-lysine trifluoroacetate salt (Sigma-Aldrich, St. Louis, MO) as a model substrate for an AGE-modified protein of a cell. Label-free interaction analysis was carried out on a BIACORETM T200 (GE Healthcare, Pittsburgh, PA), using a Series S sensor chip CM5 (GE Healthcare, Pittsburgh, PA), with Fc1 set as blank, and Fc2 immodilized with the test antibody (molecular weigh of 150,000 Da).
  • the running buffer was a HBS-EP buffer (10 mM HEPES, 150 mM NaCI, 3 mM EDTA and 0.05% P- 20, pH of 7.4), at a temperature of 25 °C.
  • Software was BIACORETM T200 evaluation software, version 2.0. A double reference (Fc2-1 and only buffer injection), was used in the analysis, and the data was fitted to a Langmuir 1 :1 binding model.
  • Example 3 Construction and production of murine anti-AGE lgG2b antibody and chimeric anti-AGE lgG1 antibody
  • sequence of murine anti-AGE antibody lgG2b heavy chain is shown in SEQ ID NO: 12.
  • the DNA sequence of chimeric human anti-AGE antibody lgG1 heavy chain is shown in SEQ ID NO: 13.
  • the DNA sequence of murine anti-AGE antibody kappa light chain is shown in SEQ ID NO: 14.
  • the DNA sequence of chimeric human anti-AGE antibody kappa light chain is shown in SEQ ID NO: 15.
  • the gene sequences were synthesized and cloned into high expression mammalian vectors. The sequences were codon optimized. Completed constructs were sequence confirmed before proceeding to transfection.
  • HEK293 cells were seeded in a shake flask one day before transfection, and were grown using serum-free chemically defined media.
  • the DNA expression constructs were transiently transfected into 0.03 liters of suspension HEK293 cells. After 20 hours, cells were sampled to obtain the viabilities and viable cell counts, and titers were measured (Octet QKe, ForteBio). Additional readings were taken throughout the transient transfection production runs. The cultures were harvested on day 5, and an additional sample for each was measured for cell density, viability and titer.
  • CE-SDS sulfate
  • CML-KLH KLH conjugated to KLH (CML-KLH) and both CML and CML-KLH were coated overnight onto an ELISA plate.
  • HRP-goat anti-mouse Fc was used to detect the control and murine (parental) anti-AGE antibodies.
  • HRP-goat anti-human Fc was used to detect the chimeric anti-AGE antibody.
  • the antigens were diluted to 1 pg/mL in 1x phosphate buffer at pH 6.5.
  • a 96-well microtiter ELISA plate was coated with 100 pL/well of the diluted antigen and let sit at 4°C overnight.
  • the plate was blocked with 1x PBS, 2.5% BSA and allowed to sit for 1-2 hours the next morning at room temperature.
  • the antibody samples were prepared in serial dilutions with 1x PBS, 1 % BSA with the starting concentration of 50 pg/mL.
  • Secondary antibodies were diluted 1 :5,000. 100 pL of the antibody dilutions was applied to each well. The plate was incubated at room temperature for 0.5-1 hour on a microplate shaker. The plate was washed 3 times with 1x PBS. 100 pL/well diluted HRP-conjugated goat anti-human Fc secondary antibody was applied to the wells. The plate was incubated for 1 hour on a microplate shaker. The plate was then washed 3 times with 1x PBS. 100 pL HRP substrate TMB was added to each well to develop the plate. After 3-5 minutes elapsed, the reaction was terminated by adding 100 pL of 1 N HCI. A second direct binding ELISA was performed with only CML coating. The absorbance at OD450 was read using a microplate reader.
  • the OD450 absorbance raw data for the CML and CML-KLH ELISA is shown in the plate map below. 48 of the 96 wells in the well plate were used. Blank wells in the plate map indicate unused wells.
  • the OD450 absorbance raw data for the CML-only ELISA is shown in the plate map below. 24 of the 96 wells in the well plate were used. Blank wells in the plate map indicate unused wells.
  • control and chimeric anti-AGE antibodies showed binding to both CML and
  • the murine (parental) anti-AGE antibody showed very weak to no binding to either CML or CML-KLH.
  • Data from repeated ELISA confirms binding of the control and chimeric anti-AGE to CML. All buffer control showed negative signal.
  • Humanized antibodies were designed by creating multiple hybrid sequences that fuse select parts of the parental (mouse) antibody sequence with the human framework sequences. Acceptor frameworks were identified based on the overall sequence identity across the framework, matching interface position, similarly classed CDR canonical positions, and presence of N-glycosylation sites that would have to be removed. Three humanized light chains and three humanized heavy chains were designed based on two different heavy and light chain human acceptor frameworks. The amino acid sequences of the heavy chains are shown in SEQ ID NO: 29, 31 and 33, which are encoded by the DNA sequences shown in SEQ ID NO: 30, 32 and 34, respectively. The amino acid sequences of the light chains are shown in SEQ ID NO:
  • the three heavy chains and three light chains were analyzed to determine their humanness.
  • Antibody humanness scores were calculated according to the method described in Gao, S. H., et al., "Monoclonal antibody humanness score and its applications", BMC Biotechnology, 13:55 (July 5, 2013).
  • the humanness score represents how human-like an antibody variable region sequence looks. For heavy chains a score of 79 or above is indicative of looking human-like; for light chains a score of 86 or above is indicative of looking human-like.
  • the humanness of the three heavy chains, three light chains, a parental (mouse) heavy chain and a parental (mouse) light chain are shown below in Table 6:
  • variable region sequences were designed by first synthesizing the variable region sequences. The sequences were optimized for expression in mammalian cells. These variable region sequences were then cloned into expression vectors that already contain human Fc domains; for the heavy chain, the lgG1 was used.
  • the binding of the humanized antibodies may be evaluated, for example, by dose-dependent binding ELISA or cell-based binding assay.
  • AGE glycation end product
  • VHHs camelid heavy chain antibodies

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Neurology (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Ophthalmology & Optometry (AREA)
  • Hospice & Palliative Care (AREA)
  • Cell Biology (AREA)
  • Psychiatry (AREA)
  • Vascular Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Psychology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
PCT/US2016/034880 2015-10-13 2016-05-27 Anti-age antibodies and methods of use thereof WO2017065837A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
KR1020187010762A KR20180056689A (ko) 2015-10-13 2016-05-27 항-age 항체 및 이의 사용 방법
CA3000815A CA3000815C (en) 2015-10-13 2016-05-27 Anti-age antibodies and methods of use thereof
BR112018007422A BR112018007422A2 (pt) 2015-10-13 2016-05-27 anticorpos anti-age e métodos de uso dos mesmos
CN201680059997.5A CN108431044A (zh) 2015-10-13 2016-05-27 抗age抗体及其使用方法
JP2018519727A JP2018535953A (ja) 2015-10-13 2016-05-27 抗age抗体およびその使用方法
RU2018110885A RU2766209C2 (ru) 2015-10-13 2016-05-27 Антитела к age и способы их применения
AU2016336959A AU2016336959A1 (en) 2015-10-13 2016-05-27 Anti-age antibodies and methods of use thereof
US15/768,425 US10889634B2 (en) 2015-10-13 2016-05-27 Anti-age antibodies and methods of use thereof
MX2018004545A MX2018004545A (es) 2015-10-13 2016-05-27 Anticuerpos anti-age y metodos para utilizarlos.
EP16731696.7A EP3362483A1 (en) 2015-10-13 2016-05-27 Anti-age antibodies and methods of use thereof
IL258397A IL258397A (en) 2015-10-13 2018-03-27 Anti-aging antibodies and methods of using them

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562241007P 2015-10-13 2015-10-13
US62/241,007 2015-10-13
US14/974,561 US10358502B2 (en) 2014-12-18 2015-12-18 Product and method for treating sarcopenia
US14/974,561 2015-12-18

Publications (1)

Publication Number Publication Date
WO2017065837A1 true WO2017065837A1 (en) 2017-04-20

Family

ID=58518256

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/034880 WO2017065837A1 (en) 2015-10-13 2016-05-27 Anti-age antibodies and methods of use thereof

Country Status (12)

Country Link
EP (1) EP3362483A1 (ko)
JP (1) JP2018535953A (ko)
KR (1) KR20180056689A (ko)
CN (1) CN108431044A (ko)
AU (1) AU2016336959A1 (ko)
BR (1) BR112018007422A2 (ko)
CA (1) CA3000815C (ko)
IL (1) IL258397A (ko)
MA (1) MA42979A (ko)
MX (1) MX2018004545A (ko)
RU (1) RU2766209C2 (ko)
WO (1) WO2017065837A1 (ko)

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017143073A1 (en) * 2016-02-19 2017-08-24 Siwa Corporation Method and composition for treating cancer, killing metastatic cancer cells and preventing cancer metastasis using antibody to advanced glycation end products (age)
US9993535B2 (en) 2014-12-18 2018-06-12 Siwa Corporation Method and composition for treating sarcopenia
WO2018191718A1 (en) * 2017-04-13 2018-10-18 Siwa Corporation Humanized monoclonal advanced glycation end-product antibody
WO2018204679A1 (en) * 2017-05-04 2018-11-08 Siwa Corporation Diagnostic advanced glycation end-product antibodies
US10226531B2 (en) 2010-09-27 2019-03-12 Siwa Corporation Selective removal of age-modified cells for treatment of atherosclerosis
US10358502B2 (en) 2014-12-18 2019-07-23 Siwa Corporation Product and method for treating sarcopenia
WO2019183282A1 (en) * 2018-03-21 2019-09-26 Mayo Foundation For Medical Education And Research Senolytic agents for the treatment of tauopathies
WO2020023532A1 (en) * 2018-07-23 2020-01-30 Siwa Corporation Methods and compositions for treating chronic effects of radiation and chemical exposure
US10584180B2 (en) 2014-09-19 2020-03-10 Siwa Corporation Anti-AGE antibodies for treating inflammation and auto-immune disorders
US10858449B1 (en) 2017-01-06 2020-12-08 Siwa Corporation Methods and compositions for treating osteoarthritis
US10925937B1 (en) 2017-01-06 2021-02-23 Siwa Corporation Vaccines for use in treating juvenile disorders associated with inflammation
US10961321B1 (en) 2017-01-06 2021-03-30 Siwa Corporation Methods and compositions for treating pain associated with inflammation
US10960234B2 (en) 2010-11-22 2021-03-30 Siwa Corporation Selective removal of cells having accumulated agents
US10995151B1 (en) 2017-01-06 2021-05-04 Siwa Corporation Methods and compositions for treating disease-related cachexia
US20210253739A1 (en) * 2018-08-23 2021-08-19 Siwa Corporation Anticarboxymethyl lysine antibodies and ultrasound for removing age-modified cells
US11213585B2 (en) 2016-06-23 2022-01-04 Siwa Corporation Vaccines for use in treating various diseases and disorders
US11261241B2 (en) 2008-05-23 2022-03-01 Siwa Corporation Methods, compositions and apparatuses for facilitating regeneration
US11518801B1 (en) 2017-12-22 2022-12-06 Siwa Corporation Methods and compositions for treating diabetes and diabetic complications
WO2023177390A1 (en) * 2022-03-14 2023-09-21 Siwa Corporation Humanized monoclonal advanced glycation end-product antibody for treating pancreatic cancer
US11958900B2 (en) 2016-04-15 2024-04-16 Siwa Corporation Anti-age antibodies for treating neurodegenerative disorders

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10889634B2 (en) 2015-10-13 2021-01-12 Siwa Corporation Anti-age antibodies and methods of use thereof
JP6994876B2 (ja) * 2017-09-05 2022-01-14 株式会社エッグ 計測器
CN117642431A (zh) * 2021-07-13 2024-03-01 迈威(美国)生物治疗有限公司 抗c1s抗体和其用途
CN114031687B (zh) * 2021-11-12 2022-06-07 深圳市人民医院 靶向rage的纳米抗体及其应用

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4217344A (en) 1976-06-23 1980-08-12 L'oreal Compositions containing aqueous dispersions of lipid spheres
US4911928A (en) 1987-03-13 1990-03-27 Micro-Pak, Inc. Paucilamellar lipid vesicles
US4917951A (en) 1987-07-28 1990-04-17 Micro-Pak, Inc. Lipid vesicles formed of surfactants and steroids
US5702704A (en) 1991-12-20 1997-12-30 The Rockefeller University Antibodies to in vivo advanced glycosylation endproducts
US6380165B1 (en) 1997-09-19 2002-04-30 The Picower Institute For Medical Research Immunological advanced glycation endproduct crosslink
US6387373B1 (en) 1993-01-15 2002-05-14 Novavax, Inc. Vaccines containing paucilsmellar lipid vesicles as immunological adjuvants
JP2003160599A (ja) * 2001-11-22 2003-06-03 Transgenic Inc カルボキシメチル化ペプチドに対する抗体
WO2009143411A2 (en) 2008-05-23 2009-11-26 Siwa Corporation Methods, compositions and apparatus for facilitating regeneration
US20100226932A1 (en) 2006-02-22 2010-09-09 Novavax, Inc. Adjuvant and Vaccine Compositions

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU784045B2 (en) * 1999-06-25 2006-01-19 Genentech Inc. Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4217344A (en) 1976-06-23 1980-08-12 L'oreal Compositions containing aqueous dispersions of lipid spheres
US4911928A (en) 1987-03-13 1990-03-27 Micro-Pak, Inc. Paucilamellar lipid vesicles
US4917951A (en) 1987-07-28 1990-04-17 Micro-Pak, Inc. Lipid vesicles formed of surfactants and steroids
US5702704A (en) 1991-12-20 1997-12-30 The Rockefeller University Antibodies to in vivo advanced glycosylation endproducts
US6387373B1 (en) 1993-01-15 2002-05-14 Novavax, Inc. Vaccines containing paucilsmellar lipid vesicles as immunological adjuvants
US6380165B1 (en) 1997-09-19 2002-04-30 The Picower Institute For Medical Research Immunological advanced glycation endproduct crosslink
JP2003160599A (ja) * 2001-11-22 2003-06-03 Transgenic Inc カルボキシメチル化ペプチドに対する抗体
US20100226932A1 (en) 2006-02-22 2010-09-09 Novavax, Inc. Adjuvant and Vaccine Compositions
WO2009143411A2 (en) 2008-05-23 2009-11-26 Siwa Corporation Methods, compositions and apparatus for facilitating regeneration

Non-Patent Citations (74)

* Cited by examiner, † Cited by third party
Title
AHMED, E. K. ET AL.: "Protein Modification and Replicative Senescence of WI-38 Human Embryonic Fibroblasts", AGING CELLS, vol. 9, 2010, pages 252,260
AHMED, E.K. ET AL.: "Protein Modification and Replicative Senescence of WI-38 Human Embryonic Fibroblasts", AGING CELLS, vol. 9, 2010, pages 252,260
AMELI, S. ET AL.: "Effect of Immunization With Homologous LDL and Oxidized LDL on Early Atherosclerosis in Hypercholesterolemic Rabbits", ARTERIOSCLEROSIS, THROMBOSIS, AND VASCULAR BIOLOGY, vol. 16, 1996, pages 1074
ANDO K ET AL.: "Membrane Proteins of Human Erythrocytes Are Modified by Advanced Glycation End Products During Aging in the Circulation", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 258, 1999, pages 123 - 27, XP002729025, DOI: doi:10.1006/bbrc.1999.0606
ANDO, K. ET AL.: "Membrane Proteins of Human Erythrocytes Are Modified by Advanced Glycation End Products during Aging in the Circulation", BIOCHEM BIOPHYS RES COMMUN., vol. 258, 1999, pages 123,125
ANONYMOUS: "Carboxymethyl Lysine Antibody MAB3247", 13 October 2015 (2015-10-13), XP055292706, Retrieved from the Internet <URL:https://resources.rndsystems.com/pdfs/datasheets/mab3247.pdf> [retrieved on 20160802] *
AROIAN R. ET AL.: "Pore-Forming Toxins and Cellular Non-Immune Defenses (CNIDs", CURRENT OPINION IN MICROBIOLOGY, vol. 10, 2007, pages 57 - 61, XP005884635
BAKER, D. J. ET AL.: "Clearance of p16lnk4a-positive senescent cells delays ageing-associated disorders", NATURE, vol. 479, 2011, pages 232 - 236, XP055074325, DOI: doi:10.1038/nature10600
BAKER, D.J. ET AL.: "Clearance of p16lnk4a-positive senescent cells delays ageing-associated disorders", NATURE, vol. 479, 2011, pages 232 - 236, XP055074325, DOI: doi:10.1038/nature10600
BHAT, R. ET AL.: "Astrocyte Senescence as a Component of Alzheimer's Disease", PLOS ONE, vol. 7, no. 9, September 2012 (2012-09-01), pages E45069,1 - 10
BIERHAUS A: "AGEs and their interaction with AGE-receptors in vascular disease and diabetes mellitus. I. The AGE concept", CARDIOVASC RES, vol. 37, no. 3, 1998, pages 586 - 600
BLAHD, W., SARCOPENIA WITH AGING, 3 August 2014 (2014-08-03), Retrieved from the Internet <URL:www.webmd.com/healthy-aging/sarcopenia-with-aging>
CHEN, K. S. ET AL.: "Monoclonal antibody therapy for malignant glioma", GLIOMA: IMMUNOTHERAPEUTIC APPROACHES, 2012, pages 121 - 141
CHINTA, S. J. ET AL.: "Environmental stress, ageing and glial cell senescence: a novel mechanistic link to Parkinson's disease?", J INTERN MED, vol. 273, 2013, pages 429 - 436
CML (N-EPSILON-(CARBOXYMETHYL)LYSINE) ASSAYS AND REAGENTS, 15 December 2014 (2014-12-15), Retrieved from the Internet <URL:www.cellbiolabs.com/cml-assays>
CML-BSA PRODUCT DATA SHEET, 2010, Retrieved from the Internet <URL:www.cellbiolabs.com/sites/default/files/STA-314-cml-bsa.pdf>
CRUZ-JENTOFT, A. J. ET AL.: "Sarcopenia: European consensus on definition and diagnosis", AGE AND AGEING, vol. 39, 13 April 2010 (2010-04-13), pages 412 - 423, XP009167538, DOI: doi:10.1093/ageing/afq034
DARREN J. BAKER ET AL: "Clearance of p16Ink4a-positive senescent cells delays ageing-associated disorders", NATURE, vol. 479, no. 7372, 1 November 2011 (2011-11-01), pages 232 - 236, XP055074325, ISSN: 0028-0836, DOI: 10.1038/nature10600 *
DAS, M. M.; SVENDSEN, C. N.: "Astrocytes show reduced support of motor neurons with aging that is accelerated in a rodent model of ALS", NEUROBIOLOGY OF AGING, vol. 36, 2015, pages 1130 - 1139
DE GENST, E. ET AL.: "Antibody repertoire development in camelids", DEVELOPMENTAL & COMPARATIVE IMMUNOLOGY, vol. 30, 11 July 2005 (2005-07-11), pages 187 - 198, XP025088320, DOI: doi:10.1016/j.dci.2005.06.010
DE GROOT, K. ET AL.: "Vascular Endothelial Damage and Repair in Antineutrophil Cytoplasmic Antibody-Associated Vasculitis", ARTHRITIS AND RHEUMATISM, vol. 56, no. 11, 2007, pages 3847,3847
DI, G-H. ET AL.: "IL-6 Secreted from Senescent Mesenchymal Stem Cells Promotes Proliferation and migration of Breast Cancer Cells", PLOS ONE, vol. 9, no. 11, 2014, pages E113572
DOBSON, D.M.: "The structural basis of protein folding and its links with human disease", PHIL. TRANS. R. SOC. LOND. B, vol. 356, 2001, pages 133 - 145
DUNN J A ET AL: "AGE-DEPENDENT ACCUMULATION OF NE-CARBOXYMETHYL)LYSINE AND NE-(CARBOXYMETHYL)HYDROXYLYSINE IN HUMAN SKIN COLLAGEN", BIOCHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 30, 5 February 1991 (1991-02-05), pages 1205 - 1210, XP000615906, ISSN: 0006-2960, DOI: 10.1021/BI00219A007 *
FEIGE, M. J. ET AL.: "The structural analysis of shark IgNAR antibodies reveals evolutionary principles of immunoglobulins", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 111, no. 22, 3 June 2014 (2014-06-03), pages 8155 - 8160, XP055123270, DOI: doi:10.1073/pnas.1321502111
FIELDING, R. A. ET AL.: "Sarcopenia: an undiagnosed condition in older adults. Current consensus definition: prevalence, etiology, and consequences", JOURNAL OF THE AMERICAN MEDICAL DIRECTORS ASSOCIATION, vol. 12, no. 4, May 2011 (2011-05-01), pages 249 - 256
FLANARY, B. E. ET AL.: "Evidence That Aging And Amyloid Promote Microglial Cell Senescence", REJUVENATION RESEARCH, vol. 10, no. 1, March 2007 (2007-03-01), pages 61 - 74
GAO, S. H. ET AL.: "Monoclonal antibody humanness score and its applications", BMC BIOTECHNOLOGY, vol. 13, 5 July 2013 (2013-07-05), pages 55, XP021156542, DOI: doi:10.1186/1472-6750-13-55
GRIFFIN, L.M. ET AL.: "Analysis of heavy and light chain sequences of conventional camelid antibodies from Camelus dromedarius and Camelus bactrianus species", JOURNAL OF IMMUNOLOGICAL METHODS, vol. 405, 18 January 2014 (2014-01-18), pages 35 - 46
HAMERS-CASTERMAN, C. ET AL.: "Naturally occurring antibodies devoid of light chains", NATURE, vol. 363, 3 June 1993 (1993-06-03), pages 446 - 448, XP002535892, DOI: doi:10.1038/363446a0
J. NI ET AL: "Plasma Protein Pentosidine and Carboxymethyllysine, Biomarkers for Age-related Macular Degeneration", MOLECULAR & CELLULAR PROTEOMICS, vol. 8, no. 8, 1 August 2009 (2009-08-01), US, pages 1921 - 1933, XP055292726, ISSN: 1535-9476, DOI: 10.1074/mcp.M900127-MCP200 *
JANA HADRABOVA ET AL.: "Chicken immunoglobulins for prophylaxis: Effect of inhaled antibodies on inflammatory parameters in rat airways", JOURNAL OF APPLIED BIOMEDICINE, 5 May 2014 (2014-05-05)
K. M. LAPAK ET AL: "The Molecular Balancing Act of p16INK4a in Cancer and Aging", MOLECULAR CANCER RESEARCH, vol. 12, no. 2, 1 February 2014 (2014-02-01), US, pages 167 - 183, XP055291091, ISSN: 1541-7786, DOI: 10.1158/1541-7786.MCR-13-0350 *
KAJSTURA, J. ET AL.: "Myocite Turnover in the Aging Human Heart", CIRC. RES., vol. 107, no. 11, 2010, pages 1374 - 86
KATCHER, H. L.: "Studies that shed new light on aging", BIOCHEMISTRY (MOSCOW), vol. 78, no. 9, 2013, pages 1061 - 1070, XP035358815, DOI: doi:10.1134/S0006297913090137
KATO, S. ET AL.: "Advanced glycation endproduct-modified superoxide dismutase-1 (SODI)-positive inclusions are common to familial amyotrophic lateral sclerosis patients with SOD1 gene mutations and transgenic mice expressing human SOD1 with a G85R mutation", ACTA NEUROPATHOL, vol. 100, 2000, pages 490 - 505
KEYHOLE LIMPET HEMOCYANIN, 18 April 2014 (2014-04-18), Retrieved from the Internet <URL:en.wikipedia.org/wiki/Keyhole_limpet_hemocyanin>
KING, O.D. ET AL.: "The tip of the iceberg: RNA-binding proteins with prion-like domains in neurodegenerative disease", BRAIN RES., vol. 1462, 2012, pages 61 - 80, XP028521741, DOI: doi:10.1016/j.brainres.2012.01.016
KIRSTEIN, M. ET AL.: "Receptor-specific Induction of Insulin-like Growth Factor I in Human Monocytes by Advanced Glycosylation End Product-modified Proteins", J. CLIN. INVEST., vol. 90, no. 439, 1992, pages 439 - 440
LINDSEY JB ET AL.: "Receptor For Advanced Glycation End-Products (RAGE) and soluble RAGE (sRAGE): Cardiovascular Implications", DIABETES VASCULAR DISEASE RESEARCH, vol. 6, no. 1, 2009, pages 7 - 14
LIU, D. ET AL.: "Senescent Human Fibroblasts Increase the Early Growth of Xenograft Tumors via Matrix Metalloproteinase Secretion", CANCER RES, vol. 67, 2007, pages 3117 - 3126
LUESSI, F. ET AL.: "Neurodegeneration in multiple sclerosis: novel treatment strategies", EXPERT REV. NEUROTHER., vol. 9, 2012, pages 1061 - 1077, XP055337068, DOI: doi:10.1586/ern.12.59
MAASS, D. R. ET AL.: "Alpaca (Lama pacos) as a convenient source of recombinant camelid heavy chain antibodies (VHHs", JOURNAL OF IMMUNOLOGICAL METHODS, vol. 324, no. 1-2, 31 July 2007 (2007-07-31), pages 13 - 25, XP022138109, DOI: doi:10.1016/j.jim.2007.04.008
MAHTAB U. AHMED ET AL: "N [epsilon] -(Carboxyethyl)lysine, a product of the chemical modification of proteins by methylglyoxal, increases with age in human lens proteins", BIOCHEMICAL JOURNAL, vol. 324, no. 2, 1 June 1997 (1997-06-01), GB, pages 565 - 570, XP055292796, ISSN: 0264-6021, DOI: 10.1042/bj3240565 *
MANESSO, E. ET AL.: "Dynamics of ?-Cell Turnover: Evidence for (3-Cell Turnover and Regeneration from Sources of (3-Cells other than ?-cell Replication in the HIP Rat", AM. J. PHYSIOL. ENDOCRINOL. METAB., vol. 297, 2009, pages E323,E324
MERA, K. ET AL.: "An autoantibody against NE-(carboxyethyl)lysine (CEL): Possible involvement in the removal of CEL-modified proteins by macrophages", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 407, 12 March 2011 (2011-03-12), pages 420 - 425
MEUTER A. ET AL.: "Markers of cellular senescence are elevated in murine blastocysts cultured in vitro: molecular consequences of culture in atmospheric oxygen", J ASSIST REPROD GENET., 10 August 2014 (2014-08-10)
MURPHY, J. F.: "Trends in cancer immunotherapy", CLINICAL MEDICAL INSIGHTS: ONCOLOGY, vol. 14, no. 4, 2010, pages 67 - 80
MUYLDERMANS, S. ET AL.: "Sequence and structure of V domain from naturally occurring camel heavy chain immunoglobulins lacking light chains", PROTEIN ENGINEERING, vol. 7, no. 9, 1994, pages 1129 - 1135
NAYLOR R M ET AL: "Senescent cells: a novel therapeutic target for aging and age-related diseases", CLINICAL PHARMACOLOGY AND THERAPEUTICS, NATURE PUBLISHING GROUP, US, vol. 93, no. 1, 1 January 2013 (2013-01-01), pages 105 - 116, XP002710105, ISSN: 0009-9236, [retrieved on 20121205], DOI: 10.1038/CLPT.2012.193 *
NAYLOR, R. M. ET AL.: "Senescent cells: a novel therapeutic target for aging and age-related diseases", CLINICAL PHARMACOLOGY & THERAPEUTICS, vol. 93, no. 1, 5 December 2012 (2012-12-05), pages 105 - 116, XP002710105, DOI: doi:10.1038/clpt.2012.193
NGUYEN, V.K. ET AL.: "Camel heavy-chain antibodies: diverse germline V H and specific mechanisms enlarge the antigen-binding repertoire", THE EUROPEAN MOLECULAR BIOLOGY ORGANIZATION JOURNAL, vol. 19, no. 5, 2000, pages 921 - 930, XP002194418, DOI: doi:10.1093/emboj/19.5.921
PATEL, M. ET AL.: "Sequence of the dog immunoglobulin alpha and epsilon constant region genes", IMMUNOGENETICS, vol. 41, 1995, pages 282 - 286, XP002037155, DOI: doi:10.1007/BF00172152
PRADAT, P.-F. ET AL.: "Abnormalities of satellite cells function in amyotrophic lateral sclerosis", AMYOTROPHIC LATERAL SCLEROSIS, vol. 12, 2011, pages 264 - 271
R. YAMANAKA;: "Glioma: Immunotherapeutic Approaches", 2012, LANDES BIOSCIENCE AND SPRINGER SCIENCE+BUSINESS MEDIA, article CHEN, K.S. ET AL.: "MONOCLONAL ANTIBODY THERAPY FOR MALIGNANT GLIOMA (chapter 10 )", pages: 132 - 141
REDDY, S. ET AL.: "NE-(carboxymethyl)lysine is a dominant advanced glycation end product (AGE) antigen in tissue proteins", BIOCHEMISTRY, vol. 34, 1 August 1995 (1995-08-01), pages 10872 - 10878, XP002088366, DOI: doi:10.1021/bi00034a021
ROLL, P. ET AL.: "Anti-CD20 Therapy in Patients with Rheumatoid Arthritis", ARTHRITIS & RHEUMATISM, vol. 58, no. 6, 2008, pages 1566 - 1575, XP055030411, DOI: doi:10.1002/art.23473
ROLLAND, Y. ET AL.: "Sarcopenia: its assessment, etiology, pathogenesis, consequences and future perspectives", J. NUTR. HEALTH AGING, vol. 12, no. 7, 2008, pages 433 - 450
SARCOPENIA, 14 November 2014 (2014-11-14), Retrieved from the Internet <URL:wikipedia.org/wiki/Sarcopenia>
SCHALKWIJK C G ET AL: "Increased accumulation of the glycoxidation product N<e>psilon-(carboxymethyl)lysine in hearts of diabetic patients: generation and characterisation of a monoclonal anti-CML antibody", BIOCHIMICA AND BIOPHYSICA ACTA. MOLECULAR AND CELL BIOLOGY OF LIPIDS, ELSEVIER, AMSTERDAM, NL, vol. 1636, no. 2-3, 22 March 2004 (2004-03-22), pages 82 - 89, XP004519877, ISSN: 1388-1981, DOI: 10.1016/J.BBALIP.2003.07.002 *
SIMON ASBJÖRN LARSEN ET AL: "Glucose metabolite glyoxal induces senescence in telomerase-immortalized human mesenchymal stem cells", CHEMISTRY CENTRAL JOURNAL, BIOMED CENTRAL LTD, LO, vol. 6, no. 1, 17 March 2012 (2012-03-17), pages 18, XP021124020, ISSN: 1752-153X, DOI: 10.1186/1752-153X-6-18 *
STRIETZEL, C.J. ET AL.: "In vitro functional characterization of feline IgGs", VETERINARY IMMUNOLOGY AND IMMUNOPATHOLOGY, vol. 158, 2014, pages 214 - 223
TAKAMI, A.: "Treatment of primary central nervous system lymphoma with induction of complement-dependent cytotoxicity by intraventricular administration of autologous-serum-supplemented rituximab", CANCER SCI., vol. 97, January 2006 (2006-01-01), pages 80 - 83
TAKEDA, A. ET AL.: "Advanced glycation end products co-localize with astrocyes and microglial cells in Alzheimer's disease brain", ACTA NEUROPATHOLOGICA, vol. 95, 1998, pages 555 - 558
VIRELLA, G. ET AL.: "Autoimmune Response to Advanced Glycosylation End-Products of Human LDL", JOURNAL OF LIPID RESEARCH, vol. 44, 2003, pages 487 - 493
VLASSARA ET AL.: "High-affinity-receptor-mediated Uptake and Degradation of Glucose-modified Proteins: A Potential Mechanism for the Removal of Senescent Macromolecules", PROC. NATL. ACAD. SCI. USAI, vol. 82, 1985, pages 5588,5591
VLASSARA, H. ET AL.: "Advanced Glycosylation Endproducts on Erythrocyte Cell Surface Induce Receptor-Mediated Phagocytosis by Macrophages", J. EXP. MED., vol. 166, 1987, pages 539,545
VLASSARA, H. ET AL.: "High-affinity-receptor-mediated Uptake and Degradation of Glucose-modified Proteins: A Potential Mechanism for the Removal of Senescent Macromolecules", PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 5588,5591
WAGNER, B. ET AL.: "The complete map of the Ig heavy chain constant gene region reveals evidence for seven IgG isotypes and for IgD in the horse", THE JOURNAL OF IMMUNOLOGY, vol. 173, 2004, pages 3230 - 3242
WAUTIER J-L ET AL: "ADVANCED GLYCATION END PRODUCTS (AGES) ON THE SURFACE OF DIABETIC ERYTHROCYTES BIND TO THE VESSEL WALL VIA A SPECIFIC RECEPTOR INDUCING OXIDANT STRESS IN THE VASCULATURE: A LINK BETWEEN SURFACE-ASSOCIATED AGES AND DIABETIC COMPLICATIONS", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 91, 1 August 1994 (1994-08-01), pages 7742 - 7746, XP002036216, ISSN: 0027-8424, DOI: 10.1073/PNAS.91.16.7742 *
WESOLOWSKI, J. ET AL.: "Single domain antibodies: promising experimental and therapeutic tools in infection and immunity", MEDICAL MICROBIOLOGY AND IMMUNOLOGY, vol. 198, 16 June 2009 (2009-06-16), pages 157 - 174
WHAT IS SARCOPENIA?, 2014, Retrieved from the Internet <URL:www.iofbonehealth.org/what-sarcopenia>
WRIGHT, W. E.: "Myoblast Senescence in Muscular Dystrophy", EXP CELL RES, vol. 157, 1985, pages 343 - 354, XP024858006, DOI: doi:10.1016/0014-4827(85)90119-3
YAN, S.F. ET AL.: "Soluble RAGE: therapy & biomarker in unraveling the RAGE axis in chronic disease and aging", BIOCHEMICAL PHARMACOLOGY, vol. 79, no. 10, 15 May 2010 (2010-05-15), pages 1379 - 1386, XP026939420, DOI: doi:10.1016/j.bcp.2010.01.013

Cited By (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11261241B2 (en) 2008-05-23 2022-03-01 Siwa Corporation Methods, compositions and apparatuses for facilitating regeneration
US10226531B2 (en) 2010-09-27 2019-03-12 Siwa Corporation Selective removal of age-modified cells for treatment of atherosclerosis
US10960234B2 (en) 2010-11-22 2021-03-30 Siwa Corporation Selective removal of cells having accumulated agents
US10584180B2 (en) 2014-09-19 2020-03-10 Siwa Corporation Anti-AGE antibodies for treating inflammation and auto-immune disorders
US9993535B2 (en) 2014-12-18 2018-06-12 Siwa Corporation Method and composition for treating sarcopenia
US11872269B2 (en) 2014-12-18 2024-01-16 Siwa Corporation Method and composition for treating sarcopenia
US10358502B2 (en) 2014-12-18 2019-07-23 Siwa Corporation Product and method for treating sarcopenia
US11873345B2 (en) 2014-12-18 2024-01-16 Siwa Corporation Product and method for treating sarcopenia
US11833202B2 (en) 2016-02-19 2023-12-05 Siwa Corporation Method and composition for treating cancer, killing metastatic cancer cells and preventing cancer metastasis using antibody to advanced glycation end products (AGE)
KR102536017B1 (ko) 2016-02-19 2023-05-24 시와 코퍼레이션 고급 당화 최종 산물(age)에 대한 항체를 사용하여 암을 치료하고, 전이성 암 세포를 사멸시키고, 암 전이를 예방하기 위한 방법 및 조성물
EP4067386A1 (en) * 2016-02-19 2022-10-05 Siwa Corporation Method and composition for treating cancer, killing metastatic cancer cells and preventing cancer metastasis using antibody to advanced glycation end products (age)
EP3677598A1 (en) * 2016-02-19 2020-07-08 Siwa Corporation Method and composition for treating cancer, killing metastatic cancer cells and preventing cancer metastasis using antibody to advanced glycation end products (age)
KR20180110090A (ko) * 2016-02-19 2018-10-08 시와 코퍼레이션 고급 당화 최종 산물(age)에 대한 항체를 사용하여 암을 치료하고, 전이성 암 세포를 사멸시키고, 암 전이를 예방하기 위한 방법 및 조성물
AU2017219749B2 (en) * 2016-02-19 2022-01-06 Siwa Corporation Method and composition for treating cancer, killing metastatic cancer cells and preventing cancer metastasis using antibody to advanced glycation end products (AGE)
WO2017143073A1 (en) * 2016-02-19 2017-08-24 Siwa Corporation Method and composition for treating cancer, killing metastatic cancer cells and preventing cancer metastasis using antibody to advanced glycation end products (age)
US11958900B2 (en) 2016-04-15 2024-04-16 Siwa Corporation Anti-age antibodies for treating neurodegenerative disorders
US11213585B2 (en) 2016-06-23 2022-01-04 Siwa Corporation Vaccines for use in treating various diseases and disorders
US10961321B1 (en) 2017-01-06 2021-03-30 Siwa Corporation Methods and compositions for treating pain associated with inflammation
US10995151B1 (en) 2017-01-06 2021-05-04 Siwa Corporation Methods and compositions for treating disease-related cachexia
US10925937B1 (en) 2017-01-06 2021-02-23 Siwa Corporation Vaccines for use in treating juvenile disorders associated with inflammation
US10858449B1 (en) 2017-01-06 2020-12-08 Siwa Corporation Methods and compositions for treating osteoarthritis
WO2018191718A1 (en) * 2017-04-13 2018-10-18 Siwa Corporation Humanized monoclonal advanced glycation end-product antibody
US11542324B2 (en) 2017-04-13 2023-01-03 Siwa Corporation Humanized monoclonal advanced glycation end-product antibody
US10919957B2 (en) 2017-04-13 2021-02-16 Siwa Corporation Humanized monoclonal advanced glycation end-product antibody
US20200150131A1 (en) * 2017-05-04 2020-05-14 Siwa Corporation Diagnostic advanced glycation end-product antibodies
CN110832327A (zh) * 2017-05-04 2020-02-21 Siwa有限公司 诊断性晚期糖基化终末产物抗体
WO2018204679A1 (en) * 2017-05-04 2018-11-08 Siwa Corporation Diagnostic advanced glycation end-product antibodies
US11518801B1 (en) 2017-12-22 2022-12-06 Siwa Corporation Methods and compositions for treating diabetes and diabetic complications
WO2019183282A1 (en) * 2018-03-21 2019-09-26 Mayo Foundation For Medical Education And Research Senolytic agents for the treatment of tauopathies
JP2021532114A (ja) * 2018-07-23 2021-11-25 シワ コーポレーション 放射線曝露及び化学物質曝露の慢性影響を治療するための方法及び組成物
WO2020023532A1 (en) * 2018-07-23 2020-01-30 Siwa Corporation Methods and compositions for treating chronic effects of radiation and chemical exposure
US20210253739A1 (en) * 2018-08-23 2021-08-19 Siwa Corporation Anticarboxymethyl lysine antibodies and ultrasound for removing age-modified cells
WO2023177390A1 (en) * 2022-03-14 2023-09-21 Siwa Corporation Humanized monoclonal advanced glycation end-product antibody for treating pancreatic cancer

Also Published As

Publication number Publication date
AU2016336959A1 (en) 2018-04-12
RU2766209C2 (ru) 2022-02-09
EP3362483A1 (en) 2018-08-22
MX2018004545A (es) 2018-08-01
RU2018110885A (ru) 2019-11-19
BR112018007422A2 (pt) 2018-10-30
IL258397A (en) 2018-05-31
KR20180056689A (ko) 2018-05-29
JP2018535953A (ja) 2018-12-06
CN108431044A (zh) 2018-08-21
RU2018110885A3 (ko) 2020-01-30
CA3000815C (en) 2022-11-01
MA42979A (fr) 2021-05-26
CA3000815A1 (en) 2017-04-20

Similar Documents

Publication Publication Date Title
US11873345B2 (en) Product and method for treating sarcopenia
CA3000815C (en) Anti-age antibodies and methods of use thereof
US10889634B2 (en) Anti-age antibodies and methods of use thereof
US11958900B2 (en) Anti-age antibodies for treating neurodegenerative disorders
AU2017219749B2 (en) Method and composition for treating cancer, killing metastatic cancer cells and preventing cancer metastasis using antibody to advanced glycation end products (AGE)
US20230295282A1 (en) Humanized monoclonal advanced glycation end-product antibody
US10858449B1 (en) Methods and compositions for treating osteoarthritis
US20210253737A1 (en) Methods and compositions for treating disease-related cachexia
WO2022093195A1 (en) Methods and compositions for treating osteoarthritis using anti-age antibodies or age antigens
WO2023177390A1 (en) Humanized monoclonal advanced glycation end-product antibody for treating pancreatic cancer
AU2018251183B2 (en) Humanized monoclonal advanced glycation end-product antibody
GRUBER Patent 3000815 Summary

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16731696

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3000815

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2018519727

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 2016336959

Country of ref document: AU

Date of ref document: 20160527

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2018/004545

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 15768425

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20187010762

Country of ref document: KR

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018007422

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2018110885

Country of ref document: RU

Ref document number: 2016731696

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 112018007422

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20180412