WO2017039382A1 - 인간 유래 페리틴 모노머 단편 및 이를 이용한 융합폴리펩티드 - Google Patents

인간 유래 페리틴 모노머 단편 및 이를 이용한 융합폴리펩티드 Download PDF

Info

Publication number
WO2017039382A1
WO2017039382A1 PCT/KR2016/009844 KR2016009844W WO2017039382A1 WO 2017039382 A1 WO2017039382 A1 WO 2017039382A1 KR 2016009844 W KR2016009844 W KR 2016009844W WO 2017039382 A1 WO2017039382 A1 WO 2017039382A1
Authority
WO
WIPO (PCT)
Prior art keywords
terminus
protein
fusion polypeptide
peptide
fused
Prior art date
Application number
PCT/KR2016/009844
Other languages
English (en)
French (fr)
Inventor
김소연
김광섭
서준영
김인산
Original Assignee
경북대학교 산학협력단
한국과학기술연구원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 경북대학교 산학협력단, 한국과학기술연구원 filed Critical 경북대학교 산학협력단
Priority to US15/756,988 priority Critical patent/US10781238B2/en
Publication of WO2017039382A1 publication Critical patent/WO2017039382A1/ko

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00—Preparations for testing in vivo
    • A61K49/001—Preparation for luminescence or biological staining
    • A61K49/0013—Luminescence
    • A61K49/0017—Fluorescence in vivo
    • A61K49/0019—Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules
    • A61K49/0045—Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules the fluorescent agent being a peptide or protein used for imaging or diagnosis in vivo
    • A61K49/0047—Green fluorescent protein [GFP]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00—Preparations for testing in vivo
    • A61K49/001—Preparation for luminescence or biological staining
    • A61K49/0013—Luminescence
    • A61K49/0017—Fluorescence in vivo
    • A61K49/005—Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
    • A61K49/0056—Peptides, proteins, polyamino acids
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43595—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from coelenteratae, e.g. medusae
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/79—Transferrins, e.g. lactoferrins, ovotransferrins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/95—Fusion polypeptide containing a motif/fusion for degradation (ubiquitin fusions, PEST sequence)

Definitions

  • the present invention is an alias for a human-derived ferritin monomer fragment and a fusion polypeptide using the same, and more specifically, a ferritin monomer fragment in which a part of the fourth loop and a fifth helix of the human-derived ferritin are removed, and the ferritin monomer fragment.
  • the present invention relates to a fusion polypeptide in which a polypeptide or a protein is fused to an N-terminus or C-terminus of.
  • Cage proteins are proteins that can form macromolecules of tens to hundreds of times the molecular weight of a monolith by the precise self-assembly of low molecular weight monoliths.
  • the virus capsid protein, ferritin, heat shock protein, and Dps protein correspond to each other.
  • Each unit of the cage has a very regular and precise interaction with neighboring units, and the inside of the cage is It is an empty structure. The inside and the outside is sequestered by the same properties as the container (container) of the cage protein, it is frequently used in medicine as a drug carrier.
  • Ferritin is a protein in the cell that stores and releases iron. Ferritin generally forms a hollow spherical cage form in vivo. The cage consists of 24 subuni ts, which are divided into heavy and light chains according to their structure.
  • the inventors of the present invention have prepared a fusion peptide in which a polypeptide targeting a specific receptor is fused to the N-terminus of a human-derived ferritin monomer to provide a target-oriented protein cage (Korean Patent Application No. 10-2013-0166241). ), A fusion peptide fused with a polypeptide targeting a specific receptor to the fourth loop and / or N-terminus of a human-derived ferritin monomer, resulting in a target-oriented protein cage with significantly improved binding af inity to the receptor. (Korean Patent Application No. 10-2014-0015142).
  • the present inventors prepared a ferrite monomer fragment (sFt) in which a part of the fourth loop and the fifth helix (hel ix) of the human-derived ferritin monomer were removed, and the ferritin monomer fragment was C-terminally. Even if the polypeptide or protein of high molecular weight is fused, the ferritin monomer fragment can be self-assembled (sel f-assembly) to form a ferritin cage, and compared to the wild type ferritin monomer, the three-dimensional masking effect is significantly alleviated. To discover and complete the present invention It became.
  • an object of the present invention is to provide a human-derived ferritin monomer fragment having an amino acid sequence represented by SEQ ID NO: 2.
  • Another object of the present invention is to provide a fusion polypeptide in which a polypeptide or protein is fused to the C-terminus, N-terminus, or C-terminus and N-terminus of the human-derived ferritin monomer fragment.
  • Another object of the present invention is to provide a polynucleotide encoding the human-derived ferritin monomer fragment.
  • Another object of the present invention is to provide an expression vector containing the polynucleotide.
  • Another object of the present invention is to provide a transformant transformed with the expression vector.
  • Another object of the present invention is to provide a protein cage comprising the fusion polypeptide.
  • Another object of the present invention is a drug delivery system comprising a fusion polypeptide fused to the ferritin monomer fragment C-terminal, N-terminal, or C-terminal and N-terminal ligand peptide capable of binding to the antibody or cell receptor To provide.
  • Another object of the present invention is a pharmaceutical composition for treating cancer, comprising a fusion polypeptide wherein the ferritin monomer fragment C-terminus, N-terminus, or C-terminus and N-terminus is fused to a cytotoxic peptide or protein as an active ingredient. To provide.
  • Another object of the present invention is to provide a pharmaceutical composition for treating cancer consisting of a fusion polypeptide fused to the ferritin monomer fragment C-terminal, N-terminal, or C-terminal and N-terminal cytotoxic peptide or protein. will be.
  • Another object of the present invention is the ferritin monomer fragment C-terminus, N-terminus, or It is to provide a pharmaceutical composition for treating cancer consisting essentially of a fusion polypeptide fused to the C- and N- terminal cytotoxic peptide or protein.
  • Another object of the present invention is to provide a biological imaging system comprising a fusion polypeptide fused to the ferritin monomer fragment C-terminus, N-terminus, or C-terminus and N-terminus.
  • Another object of the present invention is the use of a fusion polypeptide in which a cytotoxic peptide or a cytotoxic protein is fused to the ferritin monomer fragment C-terminus, N-terminus, or C-terminus and N-terminus for the preparation of a therapeutic agent for cancer.
  • Another object of the present invention is to provide an effective amount of a composition comprising a fusion polypeptide fused to the ferritin monomer fragment C-terminal, N-terminal, or C-terminal and N-terminal cytotoxic peptide or cytotoxic protein as an active ingredient It is to provide a method for treating cancer, characterized in that the administration to an individual in need thereof.
  • Another object of the present invention is an individual in need of an effective amount of the composition consisting of the fusion polypeptide fused to the ferritin monomer fragment C-terminal, N-terminal, or C-terminal and N-terminal cytotoxic peptide or protein. It is to provide a method for treating cancer, characterized in that administered to.
  • another object of the present invention is to provide an effective amount of the composition consisting essentially of the ferritin monomer fragment C-terminal, N-terminal, or fusion polypeptide fused to the C-terminal and N-terminal cytotoxic peptide or protein It is to provide a method for treating cancer, characterized in that administered to an individual.
  • the present invention provides a human-derived ferritin monomer fragment having an amino acid sequence represented by SEQ ID NO: 2.
  • the present invention provides a fusion polypeptide in which a polypeptide or a protein is fused to the C-terminus, N-terminus, or C-terminus and N-terminus of the human-derived ferritin monomer fragment.
  • the present invention provides a polynucleotide encoding the human-derived ferritin monomer fragment.
  • the present invention provides an expression vector comprising the polynucleotide.
  • the present invention provides a transformant transformed with the expression vector.
  • the present invention provides a protein cage comprising the fusion polypeptide.
  • the present invention is the ferritin monomer fragment
  • a drug delivery system comprising a fusion polypeptide fused to a C-terminus, an N-terminus, or a ligand peptide capable of binding an antibody or cell receptor to the C-terminus and N-terminus.
  • the present invention is a cancer comprising the fusion polypeptide fused to the ferritin monomer fragment C-terminal, N-terminal, or C-terminal and N-terminal cytotoxic peptide or protein as an active ingredient
  • a therapeutic pharmaceutical composition is provided.
  • ferritin monomer fragment C-terminal, N-terminal, or C-terminal and N-terminal pharmaceutical composition for cancer treatment consisting of a fusion polypeptide fused with a cytotoxic peptide or protein
  • a composition consisting of a fusion polypeptide fused with a cytotoxic peptide or protein
  • the ferritin monomer fragment C-terminal, N-terminal, or C-terminal and N-terminal for the treatment of cancer consisting essentially of a fusion polypeptide fused with a cytotoxic peptide or protein It provides a pharmaceutical composition.
  • the present invention provides a biological imaging system comprising a fusion polypeptide fused to the ferritin monomer fragment C-terminal, N-terminal, or C-terminal and N-terminal fluorescent protein.
  • a fusion polypeptide wherein the ferritin monomer fragment C-terminus, N-terminus, or C-terminus and N-terminus is fused to a cytotoxic peptide or cytotoxic protein.
  • the ferritin monomer fragment C-terminus, N-terminus, or C-terminus and N-terminus of the fusion polynucleotide fused with a cytotoxic peptide or cytotoxic protein is an effective ingredient.
  • the present invention provides a method for treating cancer, which comprises administering to a subject in need thereof an effective amount of a composition comprising the same.
  • an effective amount of the composition comprising a fusion polypeptide in which the ferritin monomer fragment C-terminus, N-terminus, or C-terminus and N-terminus is fused to a cytotoxic peptide or protein. It provides a method for treating cancer, characterized in that to administer to a subject in need thereof.
  • the ferritin monomer fragment (: _ terminal, N-terminal, or C-terminal and N-terminal of the composition consisting essentially of a fusion polypeptide fused to a cytotoxic peptide or protein
  • a method for treating cancer comprising administering to a subject in need thereof an effective amount of the present invention, which will now be described in detail:
  • the present invention provides a human derived ferritin monomer having an amino acid sequence represented by SEQ ID NO: 2. Provide fragments.
  • SEQ ID NO: 2 Human-derived ferritin heavy chain monomer fragment
  • the present inventors have also produced human-derived ferritin heavy chain monomer fragments as well as the human-derived ferritin heavy chain monomer fragments and mutated amino acid sequences to increase solubility of wild-type ferritin light chain monomer fragments. Gave.
  • the amino acid sequence of the human-derived ferritin light chain monomer fragment with improved solubility is as follows:
  • Ferritin (ferritin) protein is an intracellular protein that stores and releases iron.
  • Ferritin generally forms a hollow spherical cage in vivo, and the cage consists of 24 ferritin monomers. The ferritin monomers are classified into heavy and light chains according to their structure. do.
  • the ferritin monomers of the present invention may be all irrespective of the structure of the ferritin monomer, preferably a ferritin heavy chain, and more preferably a polypeptide consisting of an amino acid sequence represented by SEQ ID NO: 1. .
  • the amino acid sequence represented by SEQ ID NO: 1 is a heavy chain of human derived ferritin protein.
  • the structure of the ferritin monomer is a form in which five alpha helix structures are sequentially connected, and an amorphous polypeptide portion connecting polypeptides of each alpha helix structure is called a loop.
  • the human-derived ferritin monomer fragment having an amino acid sequence represented by SEQ ID NO: 2 is composed of 1 to 161th amino acids of a human-derived ferritin heavy chain monomer having an amino acid sequence represented by SEQ ID NO: 1, which is a ferritin heavy chain monomer.
  • the portion of the fourth loop and the fifth helix of s are removed to form a shortened ferritin monomer fragment (sFt).
  • the amino acid sequence represented by SEQ ID NO: 1 is as follows:
  • SEQ ID NO: 1 human-derived ferritin heavy chain monomer, GenBank: AAA35832.1
  • MTTASTSQVR QNYHQDSEAA INRQINLELY ASYVYLSMSY YFDRDDVALK NFAKYFLHQS HEEREHAEKL MKLQNQRGGR IFLQDIKKPD CDDWESGLNA MECALHLEKN VNQSLLELHK LATDKNDPHL CDFIETHYLN EQVKAI ELG DHVTNLRKMG APESGLAEYL FDKHTLGDSD human-derived ferritin having the amino acid sequence shown in SEQ ID NO: 2 NES
  • the monomer fragment is a modified form in which some polypeptides are removed from wild-type ferritin monomers, but the intrinsic characteristic of the ferritin that forms the protein cage by sel f-assembly remains intact, while the steric hindrance is significantly alleviated and fused to the C terminus.
  • the present invention also provides a fusion polypeptide in which the polypeptide or protein is fused to the C-terminus, N-terminus or C-terminus and N-terminus of the human-derived ferritin monomer fragment.
  • the high molecular weight polypeptide or protein is fused to the C-terminus of the wild type ferritin monomer, it may affect the self-assembly of ferritin and fail to form a ferritin cage.
  • the polypeptide or protein fused to the N-terminus by exposing the C-terminus to the three-dimensional polypeptide or protein exhibits a steric effect.
  • the problem may be that the physiological activity of the white matter is inhibited or the polypeptide is not released smoothly in the desired tissue or organ.
  • the present inventors prepared a fusion polypeptide using a short ferritin (sFt) monomer having an amino acid sequence represented by SEQ ID NO: 2 and a wild-type ferritin (wFt), and each characteristic. Was compared.
  • the sFt-GFP and wFt-GFP fusion peptides were prepared by fusion of GFP, a relatively high molecular weight protein, at the C-terminus of sFt and wFt, respectively.
  • the sFt-GFP and wFt-GFP were well expressed in both, and both formed well cages, but sFt-GFP was expressed three times more than wFt-GFP, indicating that the protein expression was very good. I could confirm it.
  • sFt-GFP was found to be more easily cleaved by MMP-2 compared to wFt-GFP (Examples 1 and 3) and attached to the N-terminus of sFt-GFP by NTA-agarose beads It can be seen that the synthesized histidine tag is separated much more efficiently than the histidine tag attached to the N-terminus of wFt-GFP. (Example 1 and FIG. 4).
  • the fusion peptide in which the large molecule GFP is bound to the C-terminus of wFt is very densely spaced, so that the linker site cut to MMP-2 is not easily exposed and adheres to the N-terminus.
  • the six histidine tags could be considered to be quite hidden in three dimensions.
  • sFt from which the fourth and fifth helix of the wild-type ferritin monomer was removed although the large molecule GFP was bound to the C-terminus, it was easily cleaved by MMP-2. From the fact that the histidine tag attached to the terminal is easily separated, it can be seen that the spatial structure is significantly exposed compared to wFt.
  • Peptides or proteins that can be fused to the C- terminus and / or the N- terminal fragment of human-derived ferritin monomer is not particularly limited, and appropriate to achieve the desired purpose with self 'knowledge on the barrel in the art You can choose to.
  • Non-limiting examples thereof include antibodies that can recognize specific proteins expressed in tissues or organs, ligand peptides that can specifically bind to specific receptors in the body, protein drugs, enzymes, cytotoxic polypeptides, cytotoxic proteins Or fluorescent proteins.
  • the drug can be effectively delivered to a desired tissue or organ.
  • the antibody may be a polyclonal antibody, a monoclonal antibody, a chimeric antibody, a humanized antibody, a Fv-fragment, a Fab-fragment, an F (ab ') 2 -fragment and a scFv fragment.
  • the antibodies are not only in the form of whole antibodies, but also include functional fragments of antibody molecules.
  • Full antibodies have two full length light chains and two full length heavy chains Each light chain is connected by heavy and disulfide bonds.
  • Functional fragments of antibody molecules refer to fragments having antigen binding functions and include Fab, F (ab '), F (ab') 2, Fv and scFv.
  • the kind of the antibody is not particularly limited, and any antibody known to recognize antigens expressed in tissues or organs exhibiting a specific pathological condition may be included in the art.
  • the ligand peptide refers to a peptide capable of delivering a fusion polypeptide of the present invention to a target cell by specifically binding to a receptor of a target cell after being fused with a ferritin monomer fragment.
  • the ligand peptide may be any ligand capable of specifically binding to a hormone receptor, a cytokine receptor, a growth factor receptor, or the like, which mediates a pathological condition.
  • the ligand includes a receptor-mediated endocytosis that can occur by binding to a target cell receptor.
  • the receptor may be any receptor present on a cell where receptor-mediated endocytosis may occur
  • the ligand peptide may be any ligand that can specifically bind to the receptor.
  • the protein drug may be albumin, insulin, erythropoiet in, insulin growth factor, platelet-derived growth factor, modified growth factor alpha, modified growth factor beta, bone protein, and combinations thereof, but is not limited thereto.
  • protein drugs are generally useful for the treatment of various diseases, but the short half-life and low absorption rate in vivo have a limit in producing a therapeutic effect. Because of this low body absorption rate, most of the injections are administered, and even half-life in vivo is short as 2 ⁇ 4 hours.
  • macromolecular drugs such as protein preparations
  • biodegradable synthetic polymers such as polylactic acid and polyglycolic acid are used to prepare micro / nanoparticles using water in oil emulsion. PEGylat ions using polyethylene glycol or complexes between polymeric materials using reactions between anions and cations were used.
  • the hydrophobicity of the polymer material may cause degeneration of protein drugs.
  • student The acid generated causes the pH to drop and promote denaturation and aggregation of the drug. Therefore, there is a need for a drug carrier that can maintain a stable blood concentration in the body for a certain period of time while maintaining the physiological activity of the protein drug, the ferritin monomer fragment of the present invention as a useful drug carrier that can solve the problems of the protein drug Can be used.
  • the cytotoxic polypeptide or cytotoxic protein is a concept including a drug that is fused to the ferritin monomer fragment of the present invention to induce the death of cancer cells to exhibit an anticancer effect.
  • the cytotoxic protein is trastuzumab, rituximab, bevacizumab, cetuximab, USAomib, erlotinib, Gefitinib, imatinib mesylate, sunitinib, L-asparaginase, tritorelin acetate, megestate
  • Examples include, but are not limited to, megestrol acetate, flutamide, bicalutamide, goserelin, cytochrome c, and p53 protein.
  • non-limiting examples of the cytotoxic peptide ( ⁇ ) —apoptotic peptides include KLAKLAKKLAKLAK, KGGGQVGRQLAI IGDDINR (Bak BH3 peptide), LQHRAEVQIARKLQCIADQFHRLHKBmf BH3 peptide) and the YGREL® SDEFH3 group consisting of DDEFBDS It may be selected from, but are not limited to, those skilled in the art will be familiar with peptides exhibiting cytotoxicity, including those not specifically set forth herein.
  • the fluorescent protein refers to a material that generates light by physical condition change or chemical treatment.
  • the fluorescent protein is a fluorescent protein such as green fluorescent protein (GFP), yellow fluorescent protein (YFP), red fluorescent protein (RFP), or a photoprotein ) Or luciferase, but is not limited thereto and may include all fluorescent materials used in the art.
  • GFP green fluorescent protein
  • YFP yellow fluorescent protein
  • RFP red fluorescent protein
  • a photoprotein photoprotein
  • apoptosis inducing peptide consisting of the amino acid sequence of SEQ ID NO: 3 at the N-terminus of the ferritin monomer fragment (pro-apoptotic peptide), and a green fluorescent protein at the C-terminus (Green f luorescent) protein and GFP) fusion polypeptides were prepared to evaluate their physiological activity.
  • the apoptosis inducing peptide of SEQ ID NO: 3 fused to the N-terminus of the ferritin monomer fragment comprises an amino acid sequence (CGKRK) capable of binding to the p32 receptor overexpressed on the surface of the cancer cell, the fusion polypeptide
  • CNKRK amino acid sequence
  • the fusion polypeptides were smoothly uptaken into cells through the p32 receptor of cancer cells, and green fluorescence fused at the C-terminus was observed in the cytoplasm of the cells, and as a result, the cell death was confirmed to induce cell death ( Example 5),
  • the present invention also provides a fusion polypeptide, wherein the peptide or protein is fused via a linker to the C-terminus and / or N-terminus of the human-derived ferritin monomer fragment.
  • the linker is for attaching a polypeptide or protein to a specific portion of the C-terminus or N-terminus of the ferritin monomer fragment, and may be composed of one to several amino acids.
  • the linker may be a linker including an amino acid sequence, which may be a substrate of a protein cleavage enzyme. That is, the linker is cleaved by protein cleavage enzymes, and the fused polypeptide or protein can be released from the ferritin monomer fragment to exhibit physiological activity in the desired tissue or organ.
  • linker is not particularly limited, but metalloproteinases such as urokinase, pro-urokinase, plasmin, plasminogen, TGFP, staphylokinase, thrombin, factor IXa, factor Xa or interstitial collagenase ( MMP), gelatinase or stromelysin
  • metalloproteinases such as urokinase, pro-urokinase, plasmin, plasminogen, TGFP, staphylokinase, thrombin, factor IXa, factor Xa or interstitial collagenase ( MMP), gelatinase or stromelysin
  • a peptide linker comprising a cleavage site for, wherein in one embodiment of the invention the linker comprises a checker having an amino acid sequence represented by SEQ ID NO: 5 comprising an amino acid sequence that can be cleaved by MMP-2 To evaluate their activity.
  • a smoothed polytide or protein capable of exhibiting physiological activity at a desired site can be obtained.
  • the linker having an amino acid sequence that can be cleaved by MMP-2 at the C-terminus or C-terminus and N-terminus of the ferritin monomer fragment having the amino acid sequence represented by SEQ ID NO: 2
  • the fusion polypeptide is a ferritin
  • SEQ ID NO: 6 Apoptosis-inducing peptide-ferritin monomer fragment-linker-GFP fused polypeptide
  • the fusion polypeptide of the present invention may additionally attach a labeling material used in a known detection method, preferably consisting of 1 to 10 histidines (Hist idine). Peptide fragments, His-tags can be used. The histidine residue is one of the tags most used as a tag required for the purification of the recombinant protein after expression, and has high specificity (speci f ici ty) and should have the least influence on the structure of the desired protein.
  • Hist idine may be composed of 1 to 10 peptides in a row. Since the size is small and does not affect the original protein structure, there is a convenience in that the recombinant protein does not need to be cut separately. .
  • the tag can be created at either the N-terminus or C-terminus of the target protein depending on the type of vector, and its orientation can be determined by influencing the structure of the protein.
  • the peptide or protein fused to the ferritin monomer fragment in the present invention may preferably be characterized in that it does not interfere with the binding between the fusion polypeptide or the fusion polypeptide and human-derived ferritin monomer.
  • the fusion polypeptides of the present invention can be used alone without binding between the fusion polypeptides or between the fusion polypeptides and other ferritin monomers, but the dimers and trimers may be formed by binding between the fusion polypeptides or the fusion polypeptides and other ferritin monomers, such as ferritin. Or a monomer may form a cage protein to exhibit a new function or further enhance binding specificity with other substances.
  • the polypeptide or protein of the present invention may be used between the fusion polypeptide or between the fusion polypeptide and a human. It is preferred not to interfere with the binding between the derived parine monomers.
  • a fusion polypeptide (KLAK-sFt-GFP) fused with a GFP protein having the amino acid sequence represented by SEQ ID NO: 4 at the C-terminus was observed to form cage proteinol (Example 3).
  • the GFP protein having a large molecular weight was fused at the C-terminus, the fusion polypeptide was confirmed to form a cage.
  • the amino acid sequence of SEQ ID NO: 3 and 4 is as follows:
  • SEQ ID NO: 3 apoptosis inducing peptide, pro— apoptot i c pept ide
  • VDVSKGEELFTGWP I LVELDGDVNGHKFSVSGEGEGDATYGKLTLKF I CTTGKLPVPWPTLVTTLTYGVQ CFSRYPDHMQHDFFKSAMPEGWQERTIFFKDIXiNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILQQHKNIKKQIXNQKIN
  • the fusion polypeptide of the present invention is not limited thereto, but may be inserted into a conventional vector designed to express an external gene, and can be mass-produced by genetic engineering.
  • the vector may be appropriately selected or newly produced according to the type and characteristics of the host cell for producing a protein.
  • the method of transforming the vector into a host cell and a method of producing a recombinant protein from the transformant can be easily carried out by conventional methods.
  • the selection, production, transformation, and expression of recombinant proteins, such as those described above, can be easily carried out by those skilled in the art, and some modifications in the conventional methods are included in the present invention. do.
  • the present invention provides a polynucleotide encoding the ferritin monomer fragment.
  • the invention also provides an apoptosis inducing peptide and C- at the N-terminus of the ferritin monomer fragment. It provides a polynucleotide encoding a fusion polypeptide fused to the terminal GFP protein.
  • the polynucleotide of the present invention may be any base sequence as long as it encodes the ferritin monomer fragment or fusion polypeptide of the present invention.
  • the polynucleotide encoding the ferritin monomer fragment may be represented by the nucleotide sequence of SEQ ID NO: 8
  • the polynucleotide encoding the fusion polypeptide may be represented by the nucleotide sequence of SEQ ID NO: 9 or 10. .
  • the polynucleotide sequence of SEQ ID NO: 8 to 10 is as follows:
  • SEQ ID NO: 8 (a nucleic acid sequence encoding a human-derived ferritin heavy chain monomer fragment having the amino acid sequence represented by SEQ ID NO: 2)
  • the present invention provides an expression vector comprising the polynucleotide of the present invention.
  • the expression vector of the present invention is characterized in that it comprises the polynucleotide of the present invention, and the types thereof are plasmid vector, cosmid vector, bacteriophage vector and bar. Viral vectors and the like, but is not limited thereto.
  • the expression vector of the present invention may be a conventional expression vector, which is a signal for membrane targeting or secretion in addition to expression control sequences such as promoters, operators, initiation codons, termination codons, polyadenylation signals and enhancers (promoters). It includes a sequence or leader sequence and can be prepared in various ways depending on the purpose.
  • the promoter of the expression vector may be const itive or inducible.
  • the vector also includes a selection marker for selecting a host cell containing the vector and, in the case of a replicable vector, a replication source.
  • the present invention provides a transformant transformed with the expression vector of the present invention.
  • the transformant of the present invention is characterized by being transformed with the expression vector of the present invention. Transformation with the expression vector can be carried out by transformation techniques known to those skilled in the art. Preferably, microprojectile bombardment, electroporat ion, calcium phosphate (CaP0 4 ) precipitation, calcium chloride (CaCl 2 ) precipitation,
  • PEG-mediated fusion PEG-mediated fusion
  • microinjection microinject ion
  • liposome-mediated method l iposome-mediated method
  • the transformants are Escherichia coli, Bacillus subtilis (Baci 1 lus subt il is), Streptomyces, Pseudomonas, Proteus mirabi l is, Staphylococcus, Agrobacterium tumefaciens It may be, but is not limited to such.
  • the present invention provides a protein cage containing the ferritin monomer fragment or fusion polypeptide of the present invention.
  • the present invention also provides a protein cage consisting of the ferritin monomer fragment or fusion polypeptide of the present invention. '
  • the present invention also provides a protein cage consisting essentially of the ferritin monomer fragment or fusion polypeptide of the present invention.
  • the present invention also provides a ferritin protein containing the ferritin monomer fragment or fusion polypeptide of the present invention.
  • the present invention also provides a ferritin proteinol consisting of the ferritin monomer fragment or fusion polypeptide of the present invention.
  • the present invention is also essential as the ferritin monomer fragment or fusion polypeptide of the present invention.
  • ferritin protein that is composed of Protein cages are formed by precise self-assembly of low molecular weight monoliths and are cages of spaced proteins. These include viral caps id protein, ferritin, heat shock protein and Dps protein.
  • the protein cage of the present invention is characterized in that the ferritin monomer fragment or fusion polypeptide of the present invention comprises a monolith (monomer, monomer) constituting the protein cage.
  • the protein cage of the present invention may be composed of only the ferritin monomer fragment or fusion polypeptide of the present invention, or in combination with the ferritin monomer fragment or fusion polypeptide of the present invention and other ferritin protein monomers.
  • the term “sel f-assembly” refers to a property in which certain molecules form their own nanostructures by themselves without any external stimulus or artificial induction.
  • the ferritin protein of the present invention is produced by the binding of ferritin protein monomers and is generally in the form of a spherical cage in vivo.
  • the ferritin protein of the present invention may be a complex protein in which the ferritin monomer fragment or the fusion polypeptide of the present invention is regularly arranged as a unit, and more preferably, the 24 ferritin monomer fragment or the fusion polypeptide of the present invention is three-dimensionally regular. It may be formed through the arrangement.
  • the present invention is a fusion in which a ferritin monomer fragment having an amino acid sequence represented by SEQ ID NO: 2 is fused to a C-terminus, an N-terminus, or to a C-terminus and a N-terminus, a ligand template capable of binding to an antibody or a cellular receptor.
  • a drug delivery system comprising a polytemated product.
  • the present invention also provides a drug delivery system, characterized in that the fusion polypeptide has an amino acid sequence represented by SEQ ID NO: 6 or SEQ ID NO: 7.
  • Drug delivery system of the present invention is characterized in that it comprises the fusion polyimide of the present invention as an active ingredient.
  • the drug delivery system of the present invention is characterized in that the fusion polypeptide of the present invention is composed of an active ingredient.
  • the drug delivery system of the present invention is characterized in that consisting essentially of the fusion polypeptide of the present invention as an active ingredient.
  • the drug may be, for example, a drug having a therapeutic or prophylactic activity for a specific disease or a diagnostic drug.
  • the specific disease may be any disease that can be treated or prevented by drugs.
  • the specific disease may be cancer, allergy, arteriosclerosis or asthma.
  • the drug may be any known substance such as a chemical synthetic compound, a protein therapeutic agent, or a nucleic acid.
  • the drug may be a nucleic acid such as a chemical synthetic compound for treating cancer, allergy, arteriosclerosis or asthma, a protein therapeutic agent, or siRNA.
  • the fusion polypeptides of the present invention may form a protein cage and may contain a drug inside the formed protein cage.
  • the fusion polypeptide of the present invention can specifically bind to a molecule, cell or tissue that is exposed to the active polypeptide outside when the protein cage is formed, the drug to selectively deliver the drug to the molecule, cell or tissue Can be used as a delivery system.
  • the fusion polypeptide of the present invention may be used in which the drug is directly or indirectly linked to the ferritin monomer fragment. It can be used as a drug delivery system that is delivered in combination.
  • the drug delivery system of the present invention can target a variety of cells, tissues, diseases according to the type of polypeptide fragment fused to the fusion polypeptide of the present invention.
  • the inventors of the present invention provides a polypeptide of SEQ ID NO: 3 comprising an amino acid sequence (CGKRK) capable of binding to the p32 receptor, a protein overexpressed on the surface of cancer cells N-terminal After fusion to, the intracellular uptake of the fusion polypeptide was observed.
  • CGKRK amino acid sequence
  • the present invention also provides an effective ingredient for a fusion polytepide in which a cytotoxic peptide or protein is fused to the C-terminus, N-terminus, or C-terminus and N-terminus of a ferritin monomer fragment having the amino acid sequence represented by SEQ ID NO: 2. It provides a pharmaceutical composition for treating cancer comprising a.
  • the present invention also provides a pharmaceutical composition, characterized in that the fusion polypeptide is a fusion polypeptide having an amino acid sequence represented by SEQ ID NO: 6 or SEQ ID NO: 7.
  • a fusion peptide in which apoptosis inducing peptide (pro-apoptot ic peptide) is fused to a ferritin monomer fragment was produced to evaluate cytotoxicity against cancer cells.
  • the fusion polypeptide of the present invention was concentration-dependent. It was confirmed that induction of apoptosis of cancer cells (Example 6).
  • the pharmaceutical composition according to the present invention may contain the fusion polypeptide alone or may be formulated in a suitable form together with a pharmaceutically acceptable carrier, and may further contain an excipient or a diluent.
  • a pharmaceutically acceptable carrier may further include, for example, carriers for oral administration or carriers for parenteral administration. Carriers for oral administration may include lactose, starch, cellulose derivatives, magnesium stearate, stearic acid, and the like. In addition, it may include various drug delivery materials used for oral administration to the peptide formulation.
  • carriers for parenteral administration may include water, suitable oils, saline, aqueous glucose, glycols, and the like, and may further include stabilizers and preservatives.
  • Suitable stabilizers include antioxidants such as sodium hydrogen sulfite, sodium sulfite or ascorbic acid.
  • Suitable preservatives include benzalkonium chloride, methyl- or propyl-paraben and chlorobutanol.
  • the pharmaceutical composition of the present invention may further include a lubricant, a wetting agent, a sweetener, a flavoring agent, an emulsifier, a suspension agent, and the like in addition to the above components.
  • composition of the present invention may be administered to any mammal, including humans. For example, it can be administered orally or parenterally.
  • Parenteral administration methods include, but are not limited to, intravenous, intramuscular, intraarterial, intramedullary, intradural, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical, sublingual or rectal administration.
  • the pharmaceutical composition of the present invention may be formulated into a preparation for oral or parenteral administration according to the route of administration as described above.
  • compositions of the present invention are formulated using powders, granules, tablets, pills, sugar tablets, capsules, liquids, gels, syrups, slurries, suspensions, etc. using methods known in the art.
  • oral formulations can be obtained by tablets or dragees by combining the active ingredient with a solid brother and then grinding it, adding suitable auxiliaries and processing it into a granular mixture.
  • suitable excipients include sugars and corn starch, wheat starch, rice starch and potato starch, including lactose, textrose, sucrose, sorbet, mannitol, xilitle, erysri and malty.
  • Layer presuppositions such as saloses, gelatin, polyvinylpyridone, and the like, including starch, cellulose, methyl cellulose, sodium carboxymethyl cellulose and hydroxypropyl methyl-cellulose.
  • crosslinked polyvinylpyridone, agar, alginic acid or sodium alginate may be added as a disintegrant.
  • the pharmaceutical composition of the present invention may further include anticoagulants, lubricants, wetting agents, fragrances, emulsifiers and preservatives.
  • Formulations for parenteral administration may be formulated by methods known in the art in the form of injections, creams, lotions, external ointments, oils, humectants, gels, aerosols and nasal inhalants. These formulations are described in Remington's Pharmaceutical Science, 19th ed., Mack Publishing Company, East on, PA, 1995, a prescription generally known in all pharmaceutical chemistries.
  • the total effective amount of the composition of the present invention can be administered to a patient in a single dose, and divided treatment room for long term administration in a multiple iple dose. Administration by a fract ionated treatment protocol.
  • the pharmaceutical composition of the present invention may vary the content of the active ingredient depending on the extent of the disease.
  • the preferred total dose of the pharmaceutical composition of the present invention may be about 0.01 to 10,000 mg, most preferably 0.01 mg to 500 mg per kg of patient body weight per day.
  • the dosage of the pharmaceutical composition is effective for the patient in consideration of various factors such as the age, weight, health condition, sex, severity of the disease, diet and excretion rate, as well as the formulation method, route of administration and frequency of treatment. Since the amount is determined, one of ordinary skill in the art will be able to determine the appropriate effective dosage of the composition of the present invention.
  • the pharmaceutical composition according to the present invention is not particularly limited to its formulation, route of administration and method of administration as long as the effect of the present invention is shown.
  • the present invention provides a bio-imaging system comprising a fusion polypeptide in which a ferritin monomer fragment having an amino acid sequence of SEQ ID NO: 2 is C-terminus, N-terminus, or C-terminus and N-terminus.
  • the present invention also provides a biological imaging system, characterized in that the fusion polypeptide has an amino acid sequence represented by SEQ ID NO: 6 or SEQ ID NO: 7.
  • the fusion polypeptide fused to a ferritin monomer fragment according to the present invention may be utilized as a bioimaging system, and the system may be measured in vivo by measuring intracellular fluorescence using a flow cytometer (FACS) or a confocal microscope. It may be to convey an image.
  • FACS flow cytometer
  • a polypeptide of SEQ ID NO: 3 having an amino acid sequence capable of binding to a p32 receptor, a protein overexpressed on the surface of cancer cells is fused to ferritin monomer N-terminus, and a green fluorescent protein (green f luorescent protein, After GFP) was fused to the C-terminus, FACS, fluorescence microscopy and confocal microscopy Z-stack analysis were performed. As a result, it was confirmed that green fluorescence was strongly expressed in cancer cells, and it was found that the fusion polypeptide of the present invention could provide a biological imaging system that could be usefully used for diagnosis of diseases (Example 5).
  • the fusion polypeptide of the present invention may freely contain drugs for treating diseases in the ferritin cage, at the N-terminus or C-terminus, and at the same time at the N_terminus or C-terminus.
  • drugs for treating diseases in the ferritin cage at the N-terminus or C-terminus, and at the same time at the N_terminus or C-terminus.
  • the present invention provides a cytotoxic peptide or cytotoxic protein at the C-terminus, N-terminus, or C-terminus and N-terminus of a ferritin monomer fragment having an amino acid sequence represented by SEQ ID NO: 2 for the preparation of a cancer therapeutic agent.
  • fused polypeptides are provided.
  • the present invention comprises a fermentin monomer fragment having the amino acid sequence represented by SEQ ID NO: 2 C-terminal, N-terminal, or C-terminal and N-terminal fusion polypeptide fused to a cytotoxic peptide or cytotoxic protein as an active ingredient
  • the present invention provides a method for treating cancer, comprising administering an effective amount of the composition to a subject in need thereof.
  • the present invention is a fermentin monomer fragment having the amino acid sequence represented by SEQ ID NO: 2 C-terminal, N-terminal, or C ⁇ terminal and N-terminal fusion polypeptide fused to a cytotoxic peptide or cytotoxic protein as an active ingredient It provides a method for the treatment of cancer, comprising administering to a subject in need thereof an effective amount of a composition consisting of:
  • the present invention is a fermentin monomer fragment having an amino acid sequence represented by SEQ ID NO: 2 C-terminal, N-terminal, or C-terminal and N-terminal fusion polypeptide fused to a cytotoxic peptide or cytotoxic protein as an active ingredient
  • the present invention provides a method for treating cancer, comprising administering to a subject in need thereof an effective amount of a composition consisting essentially of.
  • the term 'effective amount' of the present invention when administered to an individual, refers to an amount that exhibits an effect of improving, treating, preventing, detecting, or diagnosing cancer.
  • the term 'individual' refers to an animal, preferably a mammal, particularly a human. It may be an animal, or may be a cell, tissue, organ or the like derived from an animal. The subject may be a patient in need of treatment.
  • treatment' of the present invention refers generically to ameliorating cancer or symptoms of cancer, which may include treating, substantially preventing, or ameliorating the disease, as long as it originates from cancer. It includes but is not limited to alleviating, healing or preventing branch symptoms or most symptoms.
  • the term 'compri sing' of the present invention is used in the same way as 'containing' or 'with features', and in the composition or method, additional component elements or method steps not mentioned are mentioned. Do not exclude The term 'consisting of' means to exclude additional elements, steps or components, etc., unless otherwise noted.
  • the term 'essent ial ly consisting of' means within the scope of a composition or method to include the substance or step described and the substance or step which does not substantially affect its basic properties. do.
  • the fusion polypeptide in which the polypeptide or protein is fused to the N-terminus and / or C-terminus of the human-derived ferritin monomer fragment having the amino acid sequence represented by SEQ ID NO: 2 has excellent production efficiency and self-assembly. It is possible to form a protein cage by encapsulating an active substance therein, and due to its three-dimensional structure, it has little steric effect and thus shows excellent physiological activity of the polypeptide or protein fused to the N-terminus or C-terminus. In this regard, it is effective in the diagnosis or treatment of diseases.
  • FIG. 1 is a schematic diagram of a ferritin cage consisting of wild-type ferritin monomer, V-helix-free short ferritin monomer, and each ferritin monomer.
  • FIG. 2A shows a schematic diagram of a fusion peptide (sFt-GFP) G-linked to the C-terminus of a short ferritin monomer and a fusion peptide (wFt-GFP) G-linked to the C-terminus of a wild type ferritin monomer. .
  • sFt-GFP fusion peptide
  • wFt-GFP fusion peptide
  • FIG. 2B is the result of observation by TEM imaging whether sFt-GFP and wFt-GFP form a cage.
  • FIG. 3 is a result of sFt-GFP and wFt-GFP incubated with MMP-2 at 37 ° C. for 1 hour and observed through SDS-PAGE analysis (FT: ferrit in). Purified fractions of sFt-GFP and wFt-GFP were analyzed for SDS-PAGE minutes with molecular weight markers.
  • GFP shows a schematic diagram of the fragment and the cage formed by the fragment.
  • 6A shows the results of observing TEP imaging whether wild type ferritin, short ferritin, sFt-GFP fusion peptide and KLAK-sFt-GFP fusion peptide form a cage.
  • FIG. 6B shows the results of SEC analysis of cages formed with short ferritin, sFt-GFP fusion peptide and KLAK-sFt—GFP fusion peptide.
  • Figure 7A shows a fusion peptide (type I) that binds GFP through a linker having an amino acid sequence that can be cleaved by MMP-2 at the C-terminus of sFt and MMP-2 at the C-terminus and N-terminus of sFt. It is a figure which shows the schematic diagram of the fusion peptide (type II) which respectively combined GFP and apoptosis inducing peptide through the linker which has the amino acid sequence which can be cleaved by.
  • Figure 7B is the result of observing the cleaved product loaded on the SDS PAGE gel after MMP-2 treatment of type I and type II fusion peptide.
  • 8 shows the results of observing intracellular uptake of fusion peptides after treatment with sFt-GFP fusion peptides and KLAK-sFt-GFP fusion peptides in cell lines (A: MDA-MB-231 cell line (cancer target peptide receptor (p32)). ) FACS analysis of expressing cells, left panel) and HL-60 cell line (control cells not expressing p32, right panel), B: fluorescence microscopy results, C: confocal microscopy Z-stack analysis).
  • Recombinant plasmids expressing Double Chambered Nano Cage were constructed using a modified PET28 vector (Novagen).
  • the modified PET28 vector contains additional restriction enzyme positions of Spel between Kcoln and Nhel and EcoRI / Sall between Ncol / Ndel.
  • the gene encoding the short-ferrit in (sFt) heavy chain (1-161 amino acid) was obtained by PCR using cDNA of human ferritin heavy chain (Sino Biological Inc.). nano 2013, 7, (9), 7462-7471., etc.) were inserted at the Ndel and BamHl positions for bacterial-expression.
  • Oligonucleotides encoding CGKRK (KLAKLAK) 2 were synthesized, Kpnl and
  • the signal enhanced Green Fluorescent Protein (SEGFP) gene was prepared by PCR and inserted between Spel and Xhol.
  • the synthesized flowable linker (GSGGGSG) was inserted between BamHI and EcoRI, and the MMP-2 cleavage sequence (GPLGLAGGGSG) was synthesized and then inserted between EcoRI and Spel.
  • the sequence finally produced a linker with the sequence of GSGGGSGEFGPLGLAGGGSGTS between GFP and the ferritin monomer.
  • the GPLGLAG sequence was synthesized and inserted between Nhel and Ndel.
  • the sFt-GFP fusion peptide was prepared according to the same cloning method as above except for inserting CGKRK (KLAKLAK) 2 .
  • Protein Expression and Purification Proteins are: co // BL2KDE3) cells were overexpressed. Cells were grown at 37 ° C. in LB medium, and expression was induced using IPTG ImM when the 0D600 value reached 0.5. The cells were then collected by centrifugation, and pellets were collected using lysis buffer (20 mM Tr is-HCl pH 8.0, 100 mM NaCl, ImM EDTA, 1% Tri tonX— 100, ImM PMSF, 0.5 mM DTT). Destroyed and broken together with the ultrasonic processor. The expressed protein obtained from the cell lysate was purified using NTA agarose beads according to the previously reported method (J. Analyt ical chemi stry 2011, 83, (15), 5834-5843).
  • MMP-2 Cleavage of KLAK-sFt-GFP DCND by Recombinant MMP-2
  • MMP-2 was purchased from R & D systems (Minneapol is, MN, USA) and used for cleavage testing according to the manufacturer's instructions. MMP-2 was initially activated by incubation at 37 ° C for 1 hour with APMA (p-am i nopheny 1 mer curic acetate; ImM, Sigma, Saint Louis, M0, USA).
  • APMA p-am i nopheny 1 mer curic acetate
  • Activated MMP-2 0, 25, 50, 100 ng was added to 20 DCNC to final volume TCBN buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 10 mM CaCl 2 and 0.05% Grij-35) 40 ⁇ l was allowed to return. After incubation at 37 ° C for 1 hour, DCNC alone or DCNC reacted with MMP-2 were loaded on 12% SDS-PAGE. 5.
  • TCBN buffer 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 10 mM CaCl 2 and 0.05% Grij-35
  • the nuclei were stained with DAPI and the slides were analyzed using fluorescence microscopy.To observe the distribution of nanoparticles in the cytoplasm, confocal A microscope (Carl Zeiss, Oberkochen, Germany) was used and the cells were stained with lectin and z_ sectional imaging.
  • Cytotoxicity of KLAK-sFt-GFP DCNC was assessed using the MDA-MB-231 cell line. Cells were seeded in 96-well plates and incubated for 24 hours. The culture medium was then replaced with fresh DMEM medium containing KLAK-sFt-GFP DCNCC 0.5-4 ⁇ ). As a control, 4 ⁇ sFt-GFP was added to the medium. After a total of 48 hours of incubation, cell survival was assessed via MTT assay.
  • Apoptosis was induced by FACS using Annexin V-Alexa Fluor 647 (Invitrogen) and propidium iodide (PI).
  • Short Ferritin (sFt) Monomers It has been verified whether ferritin, whose surface is varied with peptides, chemicals and proteins, can form cage structures. Two locations were frequently chosen to expose the ligand to the surface of the cage, a short loop between the N-terminus of the ferritin monomer and the helixes IV and V. The curved helix V, located inside the cage, protrudes out of the cage when a large protein fragment is bound to the C-terminus of ferritin. The present inventors have developed a method to develop a nano-prototype that exhibits dual functionality. Short ferritin (sFt) monomers were made by removing the fifth helix of the ritin monomers (Fig. 1), and their properties were compared with wild-type ferritin (wFt).
  • sFt-GFP and wFt-GFP fusion peptides were prepared by fusion of GFP, a relatively large peptide, at the C-terminal ends of sFt and wFt (FIG. 2A).
  • the formation of cages in all of the fusion peptides was confirmed by TEM (transmi ssion electro microscopy) (FIG. 2B).
  • sFt-GFP and wFt-GFP are both E. Although well expressed in col i and both formed cages well, sFt-GFP was expressed three times more than wFt-GFP, indicating that the protein expression was very good. In addition, sFt-GFP was found to be more easily cleaved by MMP-2 compared to wFt-GFP (FIG. 3), and histidine tags attached to the N—terminus of sFt—GFP by NTA-agarose beads. It can be seen that the separation is much more efficient than the histidine tag attached to the N-terminus of wFt-GFP (Fig. 4).
  • the fusion peptide GFP-bound giant molecule at the C-terminus of wFt is highly structurally spaced, so that the linker site cleaved by MMP-2 is not easily exposed and adheres to the N-terminus.
  • the six histidine tags were considered to be fairly steep in three dimensions.
  • MMP-2 in the case of sFt from which the V-helix was removed from the wild-type ferritin monomer, it was easily cleaved by MMP-2 even though GFP, a huge molecule, was bound to the C-terminus, and the histidine tag attached to the N-terminus was From the fact that it is easily separated, it can be seen that the spatial structure is significantly exposed compared to wFt.
  • sFt can be used as a double carrier of peptides and / or proteins, and is easily cleaved by enzymes and fused at the target site. It was found that the release of the peptide was easy, and therefore, the inventors of the present invention used CGKRK (KLAKLAK) 2 , a pro-apoptot ic peptide, at the N-terminus of sFt, and the C-terminus of sFt.
  • a fusion peptide (KLAK-sFt-GFP) fused to GFP linked to a linker containing a sequence capable of cleavage by MMP-2 was prepared (Fig. 5).
  • the KLAK-sFt-GFP fusion peptide was found to form a cage of a constant size well with the wFt, sFt and sFt-GFP fusion peptides. It was also confirmed that the KLAK-sFt-GFP fusion peptide and the sFt-GFP fusion peptide were larger in shape than the wFl: and sFt.
  • the purpose of this study was to determine whether linkers linking peptides fused to KLAK-sFt-GFP fusion peptides could be exposed to enzymes and cleaved by enzymes.
  • the type I fusion peptide fused GFP through a linker having a sequence that could be cleaved by MMP-2 at the C-terminus of sFt, and the type II fusion peptide was at the C-terminus and N-terminus of sFT.
  • the same linker was linked to fused the GFP and apoptosis inducing peptide, respectively (FIG. 7A).
  • the two kinds of fusion peptides were treated with MMP-2 and loaded on an SDS PAGE gel to observe the results. The results are shown in FIG. 7B.
  • the fused peptide or protein may be released by binding a linker having an amino acid sequence capable of being degraded by a specific enzyme to the C-terminus and / or N_terminus of sFt to fuse the peptide or protein.
  • KLAK-sFt-GFP Job Peptides The p32 receptor, a protein overexpressed on the surface of certain cancer cells, recognizes a CGKRK peptide fused to the N-terminus of the KLAK-sFt-GFP fusion peptide. It can uptake into the cytoplasm. Thus, the binding of KLAK-sFt-GFP fusion peptides to cells and intracellular uptake were observed.
  • MDA-MB— 231 cells and HL-60 cells that do not express p32 were treated with KLAK-sFt-GFP fusion peptide or sFt-GFP fusion peptide and incubated at 37 ° C for 1 hour, followed by FACS cells. The expression of fluorescence was analyzed.
  • FIG. 8A The results are shown in FIG. 8A.
  • the cell group treated with the KLAK-sFt-GFP fusion peptide containing the CGKRK peptide at the N-terminus fluorescence was observed in the cells in a concentration-dependent manner, whereas only GFP was present at the C-terminus of sFt.
  • the cell group treated with the fused sFt-GFP peptide it was confirmed that the fusion peptide was transmitted into the cell by nonspecific pinocytosi s so that only very low fluorescence was observed.
  • fusion peptides were transported into cells nonspecifically and only very low fluorescence was observed, regardless of the concentrations treated with KLAK-sFt-GFP DCNC, as in the control and sFt-GFP peptide groups. It confirmed that it became.
  • the MDA-MB-231 cells were treated with KLAK-sFt-GFP fusion peptide or sFt-GFP fusion peptide and incubated at 37 ° C. for 1 hour, and then fluorescence microscopy was observed for intracellular uptake of the fusion peptide. The results are shown in FIG. 8B. As shown in FIG.
  • Fig. 9A it was observed that the cell survival rate was reduced depending on the concentration by treatment with the KLAK-sFt-GFP fusion peptide. However, the survival rate was not significantly suppressed due to excessive division of cells while incubated for 48 hours, and another experiment was further performed. That is, the cells were treated with the KLAK-sFt-GFP fusion peptide, and the cells were annealed V and propidium iodide (PI) stained to evaluate the survival rate of the cells through FACS.
  • PI propidium iodide
  • KLAK-sFt-GFP Treatment with KLAK-sFt-GFP did not affect tumor growth compared to other groups, but as shown in FIG. 10, the site of apoptosi s was increased in the tumor. Although the amount of KLAK-sFt-GFP DCNC administered in mice was not sufficient to inhibit tumor growth, it was confirmed that KLAK-sFt-GFP DCNC promotes cell death in tumors. In conclusion, it could be seen that the fusion peptide of the present invention fused with an apoptosis inducing peptide induced cell death after uptake into the cell.
  • Fusion polypeptides in which polypeptides or proteins are fused to the N-terminus and / or C-terminus of a human-derived ferritin monomer fragment having the amino acid sequence represented by SEQ ID NO: 2 have excellent production efficiency, and the protein cage is self-assembled. It is possible to encapsulate the active substance inside, and the three-dimensional structural characteristics have little steric effect so that the physiological activity of the polypeptide or protein fused at the N-terminus or C-terminus is excellent. It is highly effective for development and therefore highly industrially available.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Toxicology (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pathology (AREA)
  • Radiology & Medical Imaging (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 인간 유래 페리틴 모노머 단편 및 이를 이용한 융합폴리펩티드에 관한 발명으로, 보다 상세하게는 인간 유래 페리틴의 4번째 루프의 일부분 및 다섯 번째 헬릭스 (helix)가 제거된 페리틴 모노머 단편 및 상기 페리틴 모노머 단편의 N-말단 또는 C-말단에 폴리펩티드 또는 단백질을 융합한 융합폴리펩티드에 관한 발 명이다. 상기 융합폴리펩티드는 그 생산 효율이 매우 우수하며, 자가조립에 의해 단 백질 케이지를 형성하여 내부에 유효물질의 봉입이 가능하고, 3차원적 구조 특성상 입체 가리움 효과가 적어 N-말단 또는 C-말단에 융합된 폴리펩티드 또는 단백질의 생리학적 활성이 우수하게 나타나 질병의 진단 또는 치료제 개발에 효과적이다.

Description

【명세서】
【발명의 명칭】
인간 유래 페리틴 모노머 단편 및 이를 이용한 융합폴리펩티드 【기술분야】
본 발명은 인간 유래 페리틴 모노머 단편 및 이를 이용한 융합폴리펩티드에 관한 별명으로， 보다 상세하게는 인간 유래 페리틴의 4번째 루프의 일부분 및 다섯 번째 헬릭스 (hel ix)가 제거된 페리틴 모노머 단편 및 상기 페리틴 모노머 단편의 N-말단 또는 C-말단에 폴리펩티드 또는 단백질을 융합한 융합폴리펩티드에 관한 발 명이다.
【배경기술】
본 출원은 2015년 9월 2일에 출원된 대한민국 특허출원 제 10-2015-0124467호 를 우선권으로 주장하고， 상기 명세서 전체는 본 출원의 참고문헌이다. 케이지 (cage) 단백질은 저분자량 단일체들의 정밀한 자가조립 성질에 의하여 단일체 분자량의 수십에서 수백 배의 거대분자를 형성할 수 있는 단백질이다. 자연 계에서 바이러스 capsid 단백질， 페리틴， heat shock protein, Dps 단백질이 이에 해당되며 케이지 (cage)를 구성하는 각각의 단일체들은 인접 단일체들과 매우 규칙 적이고 정밀한 상호작용을 이루고 있고 케이지 (cage)의 내부는 비어있는 구조이다. 상기와 같은 케이지 단백질의 용기 (container)와 같은 성질에 의해 내부와 외부가 격리되는 특징을 가지고 있어， 약물 전달체로 의학분야에서 활용 빈도가 높다. 케이지 단백질 웅용 물질 수송 분야는 바이러스성 수송체 (vi ral vector)와 비 바이러스성 수송체 (non-viral vector)에 대한 연구가 활발하게 진행되고 있다. 현재까지 바이러스성 수송체로는 아데노바이러스 (adenovirus) 등이 많이 연구되고 있고 비 바이―러스성 수송체로는 페리틴， heat shock protein 등에 관하여 연구되고 있다. 그러나 기존의 바이러스성 수송체일 경우에는 바이러스 자체가 소유하는 유 전자에 의한 체내 안전성 문제가 제기되어 왔다. 페리틴은 단백질은 세포내 단백질의 일종으로 철을 저장하고， 방출하는 역할 을 한다. 페리틴은 일반적으로 생체 내에서 속이 빈 구형의 케이지 (cage) 형태를 하고 있으며, 상기 케이지는 24개의 subuni t으로 구성되며， subuni t은 그 구조에 따라 heavy chain과 l ight chain으로 구분된다. 본 발명자들은 선행연구를 통해 인간 유래 페리틴 모노머의 N-말단에 특정 수용체를 타겟팅하는 폴리펩티드를 융합한 융합펩타이드를 제작하여, 표적 지향적 단백질 케이지를 제공한 바 있으며 (한국 특허출원 10-2013-0166241호)， 인간 유래 페리틴 모노머의 4번째 루프 ( loop) 및 /또는 N-말단에 특정 수용체를 타겟팅하는 폴 리펩티드를 융합한 융합펩타이드를 제작하예 수용체에 대한 binding af f inity가 월등히 향상된 표적 지향적 단백질 케이지를 제공한 바 있다 (한국 특허출원 10- 2014-0015142호) . 그러나， 상기 페리틴 모노머의 4번째 루프에 폴리펩티드를 융합할 때에는， 인간 유래 야생형 페리틴에 존재하는 다섯 번째 헬릭스로 인한 입체적 장애가 발생 하여, 융합할 수 있는 폴리펩티드의 크기에 제약이 발생한다는 한계점이 있었고， 인간 유래 페리틴의 C-말단에 분자량이 큰 폴리펩티드 또는 단백질을 융합할 경우 에는 입체적인 장애로 인해 단백질 케이지가 형성되지 않거나， 융합된 폴리펩티드 또는 단백질로 인한 가리움 효과가 발생하여 목적하는 생리학적 활성을 나타내지 못하는 문제점이 나타난다는 것을 알게 되었다. 따라서， 상기한 문제점들을 해결하여 페리틴 모노머의 N-말단 뿐만 아니라 C一말단에 분자량이 큰 펩티드 또는 단백질을 융합하더라도 케이지 형성에 문제가 없고， 구조적으로 가리움 효과가 완화된 약물전달 플랫품의 개발이 필요한 상황이 다.
【발명의 상세한 설명】
【기술적 과제】
이에， 본 발명자들은 인간 유래 페리틴 모노머의 4번째 루프의 일부분 및 다 섯 번째 헬릭스 (hel ix)가 제거된 페리틴 모노머 단편 (short ferr i t in, sFt )을 제작 하였고， 상기 페리틴 모노머 단편은 C-말단에 분자량이 큰 폴리펩티드 또는 단백질 을 융합한다 하더라도 페리틴 모노머 단편의 자가조립 (sel f-assembly)이 가능하여 페리틴 케이지를 형성하며, 야생형의 페리틴 모노머와 비교하여 입체적인 가리움 효과가 상당히 완화되는 등 다양한 이점이 있다는 것을 발견하고 본 발명을 완성하 게 되었다. 따라서， 본 발명의 목적은 서열번호 2로 표시되는 아미노산 서열을 갖는 인 간유래 페리틴 모노머 단편을 제공하는 것이다. 본 발명의 다른 목적은 상기 인간 유래 페리틴 모노머 단편의 C-말단， N-말 단， 또는 C-말단 및 N-말단에 폴리펩티드 또는 단백질이 융합된 융합폴리펩티드를 제공하는 것이다. 본 발명의 다른 목적은상기 인간유래 페리틴 모노머 단편을 암호화하는 폴 리뉴클레오티드를 제공하는 것이다. 본 발명의 다른 목적은 상기 폴리뉴클레오티드를 포함하는 발현백터를 제공 하는 것이다. 본 발명의 다른 목적은 상기 발현백터로 형질전환된 형질전환체를 제공하는 것이다. 본 발명의 다른 목적은상기 융합폴리펩티드를 포함하는 단백질 케이지를 제 공하는 것이다. 본 발명의 다른 목적은 상기 페리틴 모노머 단편 C-말단, N-말단， 또는 C-말 단 및 N-말단에 항체 또는 세포 수용체와 결합할 수 있는 리간드 펩티드가 융합된 융합폴리펩티드를 포함하는 약물전달시스템을 제공하는 것이다. 본 발명의 다른목적은 상기 페리틴 모노머 단편 C-말단， N-말단, 또는 C-말 단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합폴리펩티드를 유효성분 으로 포함하는 암 치료용 약학적 조성물을 제공하는 것이다.
또한본 발명의 다른 목적은 상기 페리틴 모노머 단편 C-말단， N-말단, 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합폴리펩티드로 구성 되는 암 치료용 약학적 조성물을 제공하는 것이다.
또한본 발명의 다른 목적은상기 페리틴 모노머 단편 C-말단， N-말단, 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합폴리펩티드로 필수 적으로 구성되는 암 치료용 약학적 조성물을 제공하는 것이다. 본 발명의 다른 목적은 상기 페리틴 모노머 단편 C-말단, N-말단, 또는 C-말 단 및 N-말단에 형광 단백질이 융합된 융합폴리펩티드를 포함하는 생체 이미징 시 스템을 제공하는 것이다. 본 발명의 다른 목적은 암 치료용 제제를 제조하기 위한 상기 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 세포독성 단 백질이 융합된 융합폴리펩티드의 용도를 제공하는 것이다. 본 발명의 다른 목적은 상기 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말 단 및 N-말단에 세포독성 펩티드 또는 세포독성 단백질이 융합된 융합폴리펩티드를 유효성분으로 포함하는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 치료 방법올 제공하는 것이다.
또한 본 발명의 다른 목적은 상기 페리틴 모노머 단편 C-말단, N-말단， 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합폴리펩티드로 구성 되는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 치료 방법을 제공하는 것이다.
또한 본 발명의 다른 목적은 상기 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합폴리펩티드로 필수 적으로 구성되는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징 으로 하는 암 치료 방법을 제공하는 것이다.
【기술적 해결방법】
상기 본 발명의 목적을 달성하기 위하여， 본 발명은 서열번호 2로 표시되는 아미노산 서열을 갖는 인간 유래 페리틴 모노머 단편을 제공한다. 본 발명의 다른 목적을 달성하기 위하여 본 발명은 상기 인간 유래 페리틴 모노머 단편의 C-말단， N-말단， 또는 C-말단 및 N-말단에 폴리펩티드 또는 단백질 이 융합된 융합폴리펩티드를 제공한다. 본 발명의 다른 목적을 달성하기 위하여 본 발명은 상기 인간 유래 페리틴 모노머 단편을 암호화하는 폴리뉴클레오티드를 제공한다. 본 발명의 다른 목적을 달성하기 위하여 본 발명은 상기 폴리뉴클레오티드를 포함하는 발현백터를 제공한다. 본 발명의 다른 목적을 달성하기 위하여 본 발명은 상기 발현백터로 형질전 환된 형질전환체를 제공한다. 본 발명의 다른 목적을 달성하기 위하여 본 발명은 상기 융합폴리펩티드를 포함하는 단백질 케이지를 제공한다. 본 발명의 다른 목적을 달성하기 위하여 본 발명은 상기 페리틴 모노머 단편
C-말단， N-말단， 또는 C-말단 및 N-말단에 항체 또는 세포 수용체와 결합할 수 있 는 리간드 펩티드가 융합된 융합폴리펩티드를 포함하는 약물전달시스템을 제공한 다. 본 발명의 다른 목적을 달성하기 위하여 본 발명은 상기 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합폴리펩티드를 유효성분으로 포함하는 암 치료용 약학적 조성물을 제공한다. 또한 본 발명의 다른 목적을 달성하기 위하여 상기 페리틴 모노머 단편 C-말 단， N-말단, 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합 폴리펩티드로 구성되는 암 치료용 약학적 조성물을 제공한다.
또한 본 발명의 다른 목적을 달성하기 위하여 상기 페리틴 모노머 단편 C-말 단， N-말단, 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합 폴리펩티드로 필수적으로 구성되는 암 치료용 약학적 조성물을 제공한다. 본 발명의 다른 목적을 달성하기 위하여 본 발명은 상기 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 형광 단백질이 융합된 융합폴리펩티드를 포함하는 생체 이미징 시스템을 제공한다. 본 발명의 다른 목적을 달성하기 위하여 암 치료용 제제를 제조하기 위한 제 1항의 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 세포독성 펩 티드 또는 세포독성 단백질이 융합된 융합폴리펩티드의 용도를 제공한다. 본 발명의 다른 목적을 달성하기 위하여 제 1항의 페리틴 모노머 단편 C-말 단， N-말단, 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 세포독성 단백질이 융 합된 융합폴리템티드를 유효성분으로 포함하는 조성물의 유효량을 이를 필요로 하 는 개체에 투여하는 것올 특징으로 하는 암 치료 방법을 제공한다.
또한 본 발명의 다른 목적을 달성하기 위하여 상기 페리틴 모노머 단편 C-말 단， N-말단， 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합 폴리펩타드로 구성되는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 치료 방법을 제공한다.
또한 본 발명의 다른 목적을 달성하기 위하여 상기 페리틴 모노머 단편 (：_말 단, N-말단， 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합 폴리펩티드로 필수적으로 구성되는 조성물의 유효량을 이를 필요로 하는 개체에 투 여하는 것을 특징으로 하는 암 치료 방법을 제공한다. 이하에서 본 발명을 상세히 설명한다. 본 발명은 하기 서열번호 2로 표시되는 아미노산 서열을 갖는 인간 유래 페 리틴 모노머 단편을 제공한다.
서열번호 2 (인간유래 페리틴 heavy chain모노머 단편) :
MTTASTSQVR QNYHQDSEM INRQINLELY ASYVYLSMSY YFDRDDVALK NFAKYFLHQS
HEEREHAEKL MKLQNQRGGR IFLQDIKKPD CDDWESGLNA MECALHLEKN VNQSLLELHK LATDKNDPHL
CDFIETHYLN EQVKAI ELG DHVTNLRKMG A 또한， 본 발명자들은 상기 인간유래 페리틴 heavy chain모노머 단편과 더불 어 인간유래 페리틴 l ight chain 모노머 단편도 제작하였고, 야생형 페리틴 l ight chain 모노머 단편의 용해도를 증가시키기 위해 아미노산 서열에 돌연변이를 주었 다. 용해도가 개선된 인간유래 페리틴 l ight chain 모노머 단편의 아미노산 서열은 다음과 같다:
MSSQIRQNYS TDVEAAVNSL VNLYLQASYT YLSLGFYFDR DDVALEGVSH FFRELAEEKR EGYERLLKMQ NQRGGRIFLQ DIKKPAEDEW GKTPDAMKAA MALEKKLNQA LLDLHALGSA RTDPHLCDFL ETHFLDEEVK LIKKMGDHLT NLHRLGG 페리틴 (ferrit in) 단백질은 세포내 단백질의 일종으로 철을 저장하고， 방출 하는 역할을 한다. 페리틴은 일반적으로 생체 내에서 속이 빈 구형의 케이지 (cage) 형태를 하고 있으며， 상기 케이지는 24개의 페리틴 모노머 (monomer)로 구성되며， 상기 페리틴 모노머는 그 구조에 따라 heavy chain과 l ight chain으로 구분된다. 본 발명의 페리틴 모노머는 페리틴 모노머의 구조에 상관없이 모두 가능하 며， 바람직하게는 페리틴 헤비 체인 (heavy chain) 일 수 있으며， 더욱 바람직하게 는 서열번호 1로 표시되는 아미노산 서열로 이루어진 폴리펩티드 일 수 있다. 서열 번호 1로 표시되는 아미노산 서열은 인간유래 페리틴 (ferrit in) 단백질의 heavy chain이다. 페리틴 모노머의 구조는 5개의 알파헬릭스 (alpha hel ix) 구조가 순차적으로 연결된 형태이며， 각각의 알파헬릭스 구조의 폴리펩티드를 연결하는 비정형 폴리펩 티드 부분을 루프 ( loop)라고 한다. 본 발명에서 서열번호 2로 표시되는 아미노산 서열올 갖는 인간 유래 페리틴 모노머 단편은 서열번호 1로 표시되는 아미노산 서열을 갖는 인간 유래 페리틴 heavy chain 모노머의 1 내지 161번째 아미노산으로 이루어진 것이며， 이는 페리틴 heavy chain 모노머의 네 번째 루프의 일부분 및 다섯 번째 헬릭스가 제거되어 짧 아진 형태의 페리틴 모노머 단편 (short ferr i t in, sFt )이라고 할 수 있다. 상기 서 열번호 1로 표시되는 아미노산서열은 다음과 같다:
서열번호 1 (인간유래 페리틴 heavy chain모노머， GenBank: AAA35832.1) MTTASTSQVR QNYHQDSEAA INRQINLELY ASYVYLSMSY YFDRDDVALK NFAKYFLHQS HEEREHAEKL MKLQNQRGGR IFLQDIKKPD CDDWESGLNA MECALHLEKN VNQSLLELHK LATDKNDPHL CDFIETHYLN EQVKAI ELG DHVTNLRKMG APESGLAEYL FDKHTLGDSD NES 서열번호 2로 표시되는 아미노산 서열을 갖는 인간 유래 페리틴 모노머 단편 은 야생형 페리틴 모노머에서 일부 폴리펩타이드가 제거되어 변형된 형태이지만， 자가조립 (sel f-assembly )에 의해 단백질 케이지를 형성하는 페리틴 고유의 특징은 그대로 나타내면서， 입체적인 장애가 상당히 완화되어 C 말단에 융합할 수 있는 펩 티드 또는 단백질의 크기에 대한 제약이 해소되었다는 점에서 중요한 의미를 갖는 약물 전달 플랫품이 될 수 있다. 한편， 이와 같은 장점을 나타내는 페리틴 모노머 단편은 종래 기술에서는 보고된 바 없는 본원 발명 특유의 기술적 특징이라 할 수 있다. 본 발명은 또한 상기 인간 유래 페리틴 모노머 단편의 C-말단， N-말단 또는 C-말단 및 N-말단에 폴리펩티드 또는 단백질이 융합된 융합폴리펩티드를 제공한다. 야생형의 페리틴 모노머의 C-말단에 분자량이 큰 폴리펩티드 또는 단백질을 융합할 경우， 페리틴의 자가조립에 영향을 주어 페리틴 케이지를 형성하지 못하는 문제가 발생할 수 있다. 뿐만 아니라， 야생형 페리틴 모노머의 C-말단 및 N-말단 모두에 폴리펩티드 또는 단백질을 융합할 경우， C-말단에 융합된 폴리펩티드 또는 단백질이 입체적으로 가리움 효과를 발휘하여 N-말단에 융합된 폴리펩티드 또는 단 백질의 생리학적 활성을 저해하거나， 목적하는 체내 조직 또는 장기에서 폴리펩티 드의 방출이 원활하게 이루어지지 않는 문제점이 나타날 수 있다.
그러나， 서열번호 2로 표시되는 아미노산 서열을 갖는 짧은 페리틴 모노머 단편을 이용한 융합펩티드의 경우， 페리틴 모노머 단편의 C-말단에 분자량이 큰 단 백질을 융합한다고 하더라도 상기한 문제점들이 상당부분 완화되거나 완전히 해결 될 수 있어 야생형의 페리틴 모노머를 이용한 융합단백질이 나타내지 못하는 생리 학적 이점을 나타낼 수 있다. 즉， 본 발명의 일실시예에 따르면， 본 발명자들은 서열번호 2로 표시되는 아 미노산 서열을 갖는 짧은 페리틴 (sFt ) 모노머와 야생형의 페리틴 (wFt )을 이용하여 융합플리펩티드를 제작하고 각각의 특성을 비교하였다.
sFt 및 wFt 각각의 C-말단에 비교적 분자량이 큰 단백질인 GFP를 융합하여 sFt-GFP 및 wFt-GFP 융합 펩티드를 제작하였다. 상기 sFt-GFP 및 wFt-GFP는 모두 에서 잘 발현이 되었고, 양자 모두 cage를 잘 형성하였지만， sFt-GFP가 wFt- GFP와 비교해 세 배 정도 더 많이 발현이 되어, 그 단백질 발현이 매우 우수하다는 것을 확인할 수 있었다. 뿐만 아니라， sFt-GFP는 wFt-GFP와 비교해 MMP-2에 의해 더 쉽게 절단이 되는 것으로 확인되었고 (실시예 1 및 도 3)， NTA-아가로스 비드에 의해 sFt-GFP의 N-말단에 부착된 히스티딘 tag가 wFt-GFP의 N-말단에 부착된 히스 티딘 tag에 비해 훨씬 더 효율적으로 분리가 되는 것으로 되는 것을 확인할 수 있 었다 (실시예 1 및 도 4) .
상기한 결과를 통해， wFt의 C-말단에 거대한 분자인 GFP가 결합된 융합 펩티 드는 공간 구조적으로 매우 밀집되어 MMP-2에 꾀해 절단되는 링커 부위가 쉽게 노 출이 되지 않으며, N-말단에 부착된 6개의 히스티딘 tag가 입체적으로 상당히 가리 워져 있을 것으로 판단할 수 있었다. 이에 반해， 야생형 페리틴 모노머에서 네 번 째 루프의 일부분 및 다섯 번째 헬릭스가 제거된 sFt의 경우， C-말단에 거대한 분 자인 GFP가 결합되어 있음에도 블구하고 MMP-2에 의해 쉽게 절단이 되었으며 , N-말 단에 부착된 히스티딘 tag가 용이하게 분리가 되는 것이 미루어 보아， wFt에 비해 공간 구조적으로 상당히 노출이 되어 있다는 것을 알 수 있었다. 상기와 같은 sFt의 특성을 이용하면， ( i ) wFt에 융합된 융합폴리펩티드와 비 교하여 동일한 조건 하에서 훨씬 더 높은 수율로 융합폴리펩티드를 생산할 수 있으 며， ( Π ) 체내 목적하는 부위에서 N-말단 또는 C-말단에 융합된 폴리펩티드를 효소 적으로 절단하여 용이하게 방출할 수 있어 약물 등을 효과적으로 전달할 수 있으 며， ( i i i ) N-말단 및 C-말단 모두에 폴리펩티드 또는 단백질을 융합한다고 하더라 도 상호간에 가리움 효과가 낮아， 원하는 생리학적 활성을 효율적으로 나타낼 수 있는 융합폴리템티드를 제작할 수 있다. 인간 유래 페리틴 모노머 단편의 C-말단 및 /또는 N-말단에 융합할 수 있는 펩티드 또는 단백질은 특별히 제한되지 않으며， 본 발명이 속하는 기술분야에서 통 상의 지식을 '가진 자가 원하는 목적을 달성하기 위하여 적절하게 선택할 수 있다. 이의 비제한적인 예시로는， 조직 또는 기관에서 발현하고 있는 특정 단백질을 인식 할 수 있는 항체， 체내 특정 수용체와 특이적으로 결합할 수 있는 리간드 펩티드， 단백질 약물， 효소， 세포독성 폴리펩티드， 세포독성 단백질 또는 형광 단백질을 들 수 있다. 본 발명에서 페리틴 모노머 단편에 특정 병리조직에서 발현하는 항원을 인식 할 수 있는 항체를 융합함으로써， 약물을 목적하는 조직 또는 장기에 효과적으로 전달할 수 있다. 상기 항체는 폴리클로날 항체， 모노클로날 항체, 키메라 항체， 인 간화된 항체， Fv-단편， Fab-단편， F(ab' )2-단편 및 scFv 단편일 수 있다. 또한， 상 기 항체는 전체 항체 (whole) 형태일 뿐만 아니라 항체 분자의 기능적인 단편을 포 함한다. 전체 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 항체 분자 의 기능적인 단편이란 항원 결합 기능을 보유하고 있는 단편을 뜻하며 Fab, F(ab' ) , F(ab' )2 , Fv 및 scFv등을 포함한다.
본 발명에서 상기 항체의 종류는 특별히 제한되지 않으며, 당업계에서 특정 병리상태를 나타내는 조직 또는 장기에서 발현하는 항원을 인식하는 것으로 알려져 있는 항체는 모두 포함이 될 수 있다. 본 발명에서 상기 리간드 펩티드는 페리틴 모노머 단편과 융합된 이후에 표 적 세포의 수용체에 특이적으로 결합하여 본 발명의 융합폴리펩티드를 표적 세포에 전달할 수 있는 펩티드를 의미한다. 즉， 상기 리간드 펩티드는 병리학적 상태를 매 개하는 호르몬 수용체， 사이토카인 수용체 또는 성장인자 수용체 등에 특이적으로 결합할 수 있는 어떠한 리간드라도 가능하다.
또한， 본 발명에서 상기 리간드는 표적 세포의 수용체와 결합하여 수용체-매 개 엔도시토시스 (receptor-mediated endocytosis)가 일어날 수 있는 것을 포함한 다. 따라서， 상기 수용체는 수용체 -매게 엔도시토시스가 일어날 수 있는 세포 상에 존재하는 어떠한 수용체라도 가능하며， 상기 리간드 펩티드는 상기 수용체에 특이 적으로 결합할 수 있는 어떠한 리간드라도 가능하다. 본 발명에서 상기 단백질 약물은 알부민， 인슐린， erythropoiet in, 인슐린 성장인자， 혈소판 유래 성장인자， 변형 성장인자 알파， 변형 성장인자 베타, 뼈형 성 단백질 및 이들의 흔합물일 수 있으나 이에 제한되는 것은 아니다.
한편, 일반적으로 단백질 약물은 다양한 질병의 치료에 유용하게 사용되지만 생체내 반감기가 짧고 흡수율이 낮아 치료효과를 내기에 한계를 갖는다. 이렇듯이 낮은 체내흡수율로 인하여 대부분 주사투여를 하며 주사투여시에도 생체내 반감기 가 2~4시간으로 짧아서 반복적인 약물투여가 필요하다. 단백질 제제 등과 같은 거 대분자 약물과 관련하여서는 폴리락티드산이나 폴리글리콜산등의 생분해성 합성고 분자로서 기름 속 물 에멀견 (water in oi l emulsion)으로 마이크로 /나노입자 등을 제조하여 사용하거나 폴리에틸렌 글리콘 (polyethylene glycol )을 이용한 PEGylat ion, 혹은 음이온과 양이온간의 반웅을 이용하여 고분자 재료간의 complex 를 이용하는 방법들이 사용되었다. 하지만 폴리락티드산이나 폴리락티드-글리콜상 공중합체를 이용하여 제조된 미세입자의 경우 고분자 재료의 소수성으로 인해 단백 질 약물의 변성이 유발되어지는 단점이 있으며 체내에서 폴리락티드산의 분해시 생 성되는 산으로 인해 pH가 떨어지고 약물의 변성과 응집을 촉진하게 된다. 이에 단 백질 약물의 생리학적 활성을 유지하면서 일정기간에 체내에서 안정적인 혈중농도 를 유지할 수 있는 약물전달체가 필요하며， 본 발명의 페리틴 모노머 단편은 상기 한 단백질 약물의 문제점을 해결할 수 있는 유용한 약물전달체로서 이용이 될 수 있다. 본 발명에서 상기 세포독성 폴리펩티드 또는 세포독성 단백질은 본 발명의 페리틴 모노머 단편에 융합되어 암세포의 사멸을 유도하여 항암효과를 나타내는 약 물을 포함하는 개념이다.
본 발명에서 상기 세포독성 단백질 (protein)로는 트라스트주맵 (trastuzumab), 리투시맵 (rituximab)， 베바시주맵 (bevacizumab)， 세투시맵 (cetuximab), 보테조밉 (bortezomib)， 엘로티닙 (erlotinib), 제피티닙 (gef itinib), 이매티닙 메실레이트 (imatinib mesylate), 수니티닙 (sunitinib)， L-아스파라지나제 (L-asparaginase), 트리틀레린 아세테이트 (triptorelin acetate), 메제스트를 아세 테이트 (megestrol acetate), 플루타미드 (f lutamide)， 비카루타마이드 (bicalutamide), 고세레린 (goserelin) , 시토크롬 씨 (cytochrome c), p53 단백질 등 을 예로 들 수 있으며， 이에 제한되는 것은 아니다.
본 발명에서 상기 세포독성 펩타이드 (ρπ)— apoptotic peptide)의 비제한적인 예시로는， KLAKLAKKLAKLAK, KGGGQVGRQLAI IGDDINR(Bak BH3 펩타이드)， LQHRAEVQIARKLQCIADQFHRLHKBmf BH3 펩타이드) 및 YGREL醒 SDEFVDS(Bad BH3 펩타이 드)로 이루어진 군에서 선택될 수 있으나 이에 제한되는 것은 아니며， 당업자는 본 명세서에 구체적으로 제시되지 않은 것을 비롯한 세포독성을 나타내는 펩타이드를 잘 알고 있을 것이다. 본 발명에서 상기 형광 단백질은 물리적 조건 변화, 화학적 처리에 의해 빛 을 발생하는 물질을 의미한다. 상기 형광 단백질은 녹색 형광 단백질 (green fluorescent protein, GFP), 황색 형광 단백질 (Yellow fluorescent protein, YFP), 적색형광단백질 (Red fluorescent protein, RFP)과 같은 형광 단백질 (fluorescent protein)이거나， 발광 단백질 (photoprotein) 또는 루시퍼라제 (lucif erase) 일 수 있으나， 이에 제한되는 것은 아니며 당업계에서 사용되는 형광물질은 모두 포함될 수 있다. 본 발명의 일실시예에서는， 페리틴 모노머 단편의 N-말단에 서열번호 3의 아 미노산 서열로 이루어진 세포사멸 유도 펩티드 (pro-apopt ot ic pept ide) , C-말단에 녹색 형광 단백질 (Green f luorescent protein, GFP)을 각각 융합한 융합폴리펩티드 를 제작하여 그 생리학적 활성을 평가하였다.
구체적으로， 페리틴 모노머 단편의 N-말단에 융합된 서열번호 3의 세포사멸 유도 펩티드는 암세포의 표면에서 과발현 되어 있는 p32 수용체에 결합할 수 있는 아미노산 서열 (CGKRK)를 포함하고 있으며， 상기 융합폴리펩티드를 암세포에 처리한 결과, 융합폴리펩티드가 암세포의 p32 수용체를 통해 세포내로 원활히 uptake 되어 C-말단에 융합된 녹색 형광이 세포의 세포질 내에서 관찰이 되었으며， 결과적으로 세포의 사멸을 유도하는 것을 확인하였다 (실시예 5) ,
즉， 서열번호 2로 표시되는 아미노산 서열을 갖는 짧은 페리틴 모노머 단편 의 C-말단에 분자량이 큰 단백질인 GFP를 융합한다 하더라도 N-말단에 융합된 풀리 펩티드의 생리학적 활성을 전혀 저해하지 않으며， N-말단 또는 C-말단에 융합된 폴 리펩티드 또는 단백질 각각의 생리학적 활성이 모두 정상적으로 발현된다는 것을 알 수 있었다. 본 발명은 또한, 상기 펩티드 또는 단백질은 인간 유래 페리틴 모노머 단편 의 C-말단 및 /또는 N-말단에 링커를 통해 융합된 것을 특징으로 하는 융합폴리펩티 드를 제공한다. 상기 링커는 폴리펩티드 또는 단백질을 페리틴 모노머 단편의 C-말단 또는 N-말단의 특정부위에 부착시키기 위한 것으로 , 1개 내지 수 개의 아미노산으로 이 루어질 수 있다. , 본 발명에서 상기 링커는 바람직하게는 단백질 절단 효소의 기질이 될 수 있 는 아미노산 서열을 포함하고 있는 링커일 수 있다. 즉， 단백질 절단 효소에 의해 링커가 절단되고， 융합된 폴리펩티드 또는 단백질이 페리틴 모노머 단편으로부터 유리되어 원하는 조직 또는 장기에서 생리학적 활성을 나타낼 수 있다. 상기 링커의 종류는 특별이 제한되지 않으나， 유로키나제, 프로-유로키나제， 플라스민， 플라스미노겐， TGFP , 스타필로키나제， 트롬빈， 인자 IXa, 인자 Xa 또는 간질 콜라게나제와 같은 메탈로프로테이나제 (MMP) , 젤라티나제 또는 스트로멜리신 에 대한 절단 부위를 포함하는 펩티드 링커가 특히 바람직하며， 본 발명의 일실시 예에서 상기 링커는 MMP-2에 의해 절단될 수 있는 아미노산 서열을 포함하는 서열 번호 5로 표시되는 아미노산 서열을 갖는 욍커를 사용하여 그 활성을 평가하였다. 상기 서열번호 5의 아미노산 서열은 다음과 같다:
서열번호 5 (링커)
GSGGGSGEFGPLGLAGGGSGTS 페리틴 모노머 단편의 N-말단 또는 C-말단에 상기한 효소들에 의해 분해될 수 있는 링커를 결합한 융합폴리펩티드를 제작함으로써， 목적하는 부위에서 생리학 적 활성을 나타낼 수 있는 폴리템티드 또는 단백질을 원활하게 방출하여 약물전달 체로서의 역할을 수행할 수 있다. 본 발명의 일실시예에서는, 서열번호 2로 표시되는 아미노산 서열을 갖는 페 리틴 모노머 단편의 C-말단 또는 C-말단 및 N-말단에 MMP-2에 의해 절단이 될 수 있는 아미노산 서열을 갖는 링커를 결합하여 세포사멸 유도 펩티드 (pro-apoptot ic pept ide) 또는 GFP를 융합한 융합폴리펩티드를 제작하였고 (서열번호 6 또는 서열번 호 7로 표시되는 아미노산 서열을 갖는 융합폴리펩티드) , 상기 융합폴리펩티드가 페리틴 케이지를 형성한 후， 링커들이 효소에 노출되어 절단이 될 수 있는지 여부 를 평가하였다 (실시예 4) . 그 결과， C-말단 또는 N-말단에 결합된 각각의 링커가 MMP-2에 의해 절단되어 생성된 산물들이 농도 의존적으로 관찰되었다. 상기 서열번호 6 및 7의 아미노산 서열은 다음과 같다:
서열번호 6 (세포사멸 유도 펩티드-페리틴 모노머 단편 -링커 -GFP가 융합된 융합폴리펩티드)
MC^TCGKRKKLAKLAKKLAKLAKGHMmSTSQWQNYHQDSEMINRQINLELYASY ^
VALKNFAKYFLHQSHEEREH KLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNW^
DKNDPHLCDF I ETHYLNEQVKA I KELGDHVTNLRKMGAGSGGGSGEFGPLGLAGGGSGTSVDVSKGEELFTGVVP I L VELDGDVNG SVSGEGEGDATYGKLTLKFICTTGKLPVPWFrLVT
VQERTIFFKDIXiNYKTl^EWEGDTLV IELKGIDFKEDGNILGHKLEY YNSHNWITADKQ^
NIEIXXiVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHM\^LEFVTMGITLG¾roELYK 서열번호 7 (세포사멸 유도 펩티드-링커-페리틴 모노머 단편 -링커 -GFP가 융 합된 융합폴리펩티드)
MC^TCGKRKKLAKLAKKLAKLAKASGPLGLAGHMmSTSQVRQNYHQDSEAA I NRQ I NLELYASYVYLSM SYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR I FLQD I KKPDCDDWESGLNAMECALHLEKNVNQSL LELHKLATDKNDPHLCDF I ETHYLNEQVKA I KELGDHVTNLRKMGAGSGGGSGEFGPLGLAGGGSGTSVDVSKGEEL
KSAMPEGWQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNW^
KA FK I RHN I EDGGVQLADHYQQNTP I GDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAG I TLGMDELYK 또한 본 발명의 융합폴리펩티드는 공지의 검출방법에 사용되는 표지물질등을 추가로 부착할 수 있는데， 바람직하게는 1개 내지 10개의 히스티딘 (Hist idine)으로 이루어진 펩타이드 단편 즉, His-태그를 사용할 수 있다. 상기에서 히스티딘 잔기는 재조합 단백질을 발현시킨 후 정제시 필요한 꼬리 표 (tag)로 가장 많이 이용되는 tag 중 하나로， 특이성 (speci f ici ty)이 높아야 하고 원하는 단백질의 구조에 영향을 최대한 적게 주어야 한다. 바람직하게는 Hist idine 이 1개 내지는 10개가 연속으로 오는 pept ide로 구성될 수 있는데, size가 작고 원 래의 protein 구조에 영향도 별로 주지 않기 때문에 재조합 단백질을 만든 후 따로 잘라주지 않아도 된다는 편의성이 있다. tag은 vector의 종류에 따라 target protein의 N-말단， C-말단 어느 쪽에도 만들 수 있고， 단백질의 구조의 영향을 주 는 것에 따라 그 방향을 결정할 수 있다. 한편， 본 발명에서 상기 페리틴 모노머 단편에 융합되는 펩티드 또는 단백질 은 바람직하게는 상기 융합폴리펩티드 간 또는 상기 융합폴리펩티드와 인간 유래 페리틴 모노머 간의 결합을 방해하지 않는 것을 특징으로 할 수 있다. 본 발명의 융합폴리펩티드는 상기 융합폴리펩티드 간 또는 융합폴리펩티드와 다른 페리틴 모노머 간의 결합 없이 단독으로 사용이 가능하나, 페리틴과 같이 융 합폴리펩티드 간 또는 융합폴리펩티드와 다른 페리틴 모노머 간의 결합을 통하여 다이머， 트라이머를 형성하거나， 또는 수개의 모노머가 케이지 단백질을 형성하여 새로운 기능을 나타내거나， 다른 물질과의 결합 특이성을 더욱 높일 수 있으므로， 본 발명의 폴리펩티드 또는 단백질은 상기 융합폴리펩티드간 또는 상기 융합폴리펩 티드와 인간 유래 패리틴 모노머 간의 결합을 방해하지 않는 것이 바람직하다. 본 발명의 일실시예에 따르면， 서열번호 2로 표시되는 아미노산 서열을 갖는 페리틴 모노머 단편의 N-말단에 서열번호 3으로 표시되는 아미노산 서열을 갖는 세 포사멸 유도 펩티드 (pro-apoptot ic pept ide) 및 C-말단에 서열번호 4로 표시되는 아미노산 서열을 갖는 GFP 단백질을 융합한 융합폴리펩티드 (KLAK-sFt-GFP)를 제작 하여 케이지 단백질올 형성하는지 여부를 관찰하였다 (실시예 3) . 그 결과, 분자량 이 큰 GFP 단백질이 C-말단에 융합되어 있음에도 불구하고, 상기 융합폴리펩티드는 케이지를 형성하는 것을 확인할 수 있었다. 상기 서열번호 3 및 4의 아미노산 서열은 다음과 같다:
서열번호 3 (세포사멸 유도 펩타이드， pro— apoptot i c pept ide)
CGKRKKLAKLAKKLAKLAK 서열번호 4 (GFP)
VDVSKGEELFTGWP I LVELDGDVNGHKFSVSGEGEGDATYGKLTLKF I CTTGKLPVPWPTLVTTLTYGVQ CFSRYPDHMQHDFFKSAMPEGWQERTIFFKDIXiNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGH^ SHNWITADKQKNGIKANFKIRMIEIX iVQLADHYQQNTPIGDGPVLLPDNHYLS^SALSKDPNE
VTAAGITLGMDELYK 본 발명의 융합폴리펩티드는 이에 한정되지 않지만 바람직하게는 외부 유전 자를 발현할 수 있는 용도로 제작된 통상의 백터에 발현 가능하도록 삽입하여， 유 전공학적인 방법으로 대량 생산할 수 있다. 상기 백터는 단백질을 생산하기 위한 숙주세포의 종류 및 특성에 따라 적절히 선택하거나， 신규로 제작할 수 있다. 상기 백터를 숙주세포에 형질전환하는 방법 및 형질전환체로부터 재조합 단백질을 생산 하는 방법은 통상의 방법으로 용이하게 실시 할 수 있다. 상기한 백터의 선택， 제 작， 형질전환 및 재조합 단백질의 발현 등의 방법은， 본원발명이 속하는 기술분야 의 당업자라면 용이하게 실시할 수 있으며， 통상의 방법에서 일부의 변형도 본원발 명에 포함된다. 한편 본 발명은 본 발명의 페리틴 모노머 단편올 암호화하는 폴리뉴클레오티 드를 제공한다.
본 발명은 또한 페리틴 모노머 단편의 N-말단에 세포사멸 유도 펩티드 및 C- 말단에 GFP 단백질이 융합된 융합폴리펩티드를 암호화하는 폴리뉴클레오티드를 제 공한다. 본 발명의 폴리뉴클레오티드는 본 발명의 페리틴 모노머 단편 또는 융합폴리 펩티드를 암호화하는 것이면 어떠한 염기서열의 것도 가능하다. 바람직하게는 페리 틴 모노머 단편을 암호화 하는 폴리뉴클레오티드는 서열번호 8의 염기서열로 표시 되는 것일 수 있으며， 상기 융합폴리펩티드를 암호화 하는 폴리뉴클레오티드는 서 열번호 9 또는 10의 염기서열로 표시되는 것일 수 있다. 상기 서열번호 8 내지 10의 폴리뉴클레오티드 서열은 다음과 같다:
서열번호 8 (서열번호 2로 표시되는 아미노산 서열을 갖는 인간유래 페리틴 heavy chain모노머 단편을 인코딩하는 핵산 서열)
ATGacgaccgcgtccacctcgcaggtgcgccagaactaccaccaggactcagaggccgccatcaaccgcca gat caacctggagctctacgcctcctacgt ttacctgtccatgtct tact act ttgaccgcgatgatgtggct ttga agaactttgccaaatactttcttcaccaatctcatgaggagagggaacatgctgagaaactgatgaagctgcagaac caacgaggtggccgaatcttccttcaggatatcaagaaaccagactgtgatgactgggagagcgggctgaatgcaat acccccat t tgtgtgact t cattgagacacat t acctgaatgagcaggtgaaagccatcaaagaattgggtgaccac gtgaccaact tgcgcaagatgggagcg 서열번호 9 (서열번호 6의 융합폴리펩티드를 인코딩하는 핵산 서열)
ATG(^OTACCTGCG{ MGCGCMGM( TCa:GMGCTCGCGMGMGCT∞
CCATATGacgaccgcgtccacctcgcaggtgcgccagaactaccaccaggactcagaggccgccatcaaccgccaga tcaacctggagctctacgcctcctacgtttacctgtccatgtct tact act t tgaccgcgatgatgtggct ttgaag aactttgccaaatactttcttcaccaatctcatgaggagagggaacatgctgagaaactgatgaagctgcagaacca acgaggtggccgaatcttccttcaggatatcaagaaaccagactgtgatgactgggagagcgggctgaatgcaatgg agtgtgcattacatttggaaaaaaatgtgaatcagtcactactggaactgcacaaactggccactgacaaaaatgac ccccat t tgtgtgact t cattgagacacat t acctgaatgagcaggtgaaagccat caaagaat tgggtgaccacgt gaccaacUgcgcaagatgggagcgGGATCCOTGGAGGATCTOTGMTTC^A^
CCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAG 서열번호 10 (서열번호 7의 융합폴리펩티드를 인코딩하는 핵산서열)
AT(XX OTACCTGCGGCAA( GCMGMGCTC( GMGCTCGCGMG^
TAGCGGACCGCTGGGACTAGCCGGACATATGacgaccgcgt ccacctcgcaggtgcgccagaactaccaccaggact cagaggccgccat caaccgccagat caacct ggagct ct acgcct cct acgt 11 acctgt ccatgt cttactacttt gaccgcgat gat gt ggc t ttgaagaact ttgccaaat actttctt caccaatctcatgaggagagggaacatgctga gaaactgatgaagctgcagaaccaacgaggtggccgaatct tcct tcaggatatcaagaaaccagactgtgatgact gggagagcgggctgaatgcaatggagtgtgcattacatttggaaaaaaatgtgaatcagtcactactggaactgcac
Figure imgf000019_0001
Figure imgf000019_0002
ACATGGTCCTOTGGAGTTCGTGACC( CGCC ( TCACTCTCG 한편 본 발명은 본 발명의 폴리뉴클레오티드를 포함하는 발현백터를 제공한 다.
본 발명의 발현백터는 본 발명의 폴리뉴클레오티드를 포함하는 것을 특징으 로 하며， 그 종류는 플라스미드 백터， 코즈미드 백터, 박테리오파아지 백터 및 바 이러스 백터 등을 포함하나 이에 제한되지 않는다. 본 발명의 발현백터는 통상의 발현백터일 수 있으며, 발현백터는 프로모터， 오퍼레이터， 개시코돈, 종결코돈, 폴 리아데닐화 시그널 및 인핸서 (촉진유전자) 같은 발현 조절 서열 외에도 막 표적화 또는 분비를 위한 시그널 서열 또는 리더 서열을 포함하며 목적에 따라 다양하게 제조될 수 있다. 상기 발현백터의 프로모터는 구성적 (const itut ive) 또는 유도성 ( inducible)일 수 있다. 또한 상기 백터는 백터를 함유하는 숙주 세포를 선택하기 위한 선택 마커를 포함하고， 복제 가능한 백터인 경우 복제기원을 포함한다. 한편 본 발명은 본 발명의 발현백터로 형질전환된 형질전환체를 제공한다. 본 발명의 형질전환체는 본 발명의 발현백터로 형질전환 된 것을 특징으로 한다. 상기 발현백터로 형질전환하는 것은 당업자에게 공지된 형질전환기술에 의해 수행될 수 있다. 바람직하게는 미세사출법 (microproject i le bombardment ) , 전기층 격유전자전달법 (electroporat ion) , 인산 칼슘 (CaP04) 침전, 염화칼슘 (CaCl2) 침전，
PEG-매개 융합법 (PEG-mediated fusion)， 미세주입법 (microinject ion) 및 리포좀 매 개법 ( l iposome-mediated method)을 이용할 수 있으며, 상기 형질전환체는 대장균 (Escherichia col i ) , 바실러스 서브틸리스 (Baci 1 lus subt i l is) , 스트렙토마이세스 (Streptomyces) , 슈도모나스 (Pseudomonas)， 프로테우스 미라빌리스 (Proteus mirabi l is) , 스타필로코쿠스 (Staphylococcus)， 아그로박테리움 투메파시엔스 (Agrobacterium tumefaciens)일 수 있으나, 이로 제한되는 것은 아니다. 한편 본 발명은 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드를 포함 하는 단백질 케이지를 제공한다.
또한 본 발명은 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드로 구성 되는 단백질 케이지를 제공한다. '
또한 본 발명은 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드로 필수 적으로 구성되는 단백질 케이지를 제공한다. 또한 본 발명은 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드를 포 φ 하는 페리틴 단백질을 제공한다.
또한 본 발명은 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드로 구성 되는 페리틴 단백질올 제공한다.
또한 본 발명은 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드로 필수 적으로 구성되는 페리틴 단백질을 제공한다. 단백질 케이지 (Protein cage)는 저분자량 단일체들의 정밀한 자가조립 성질 에 의하여 형성되며， 내부에 공간을 가지는 단백질로 된 케이지이다. 바이러스 caps id 단백질， 페리틴， heat shock protein, Dps 단백질이 이에 해당된다. 본 발 명의 단백질 케이지는 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드를 상기 단백질 케이지를 구성하는 단일체 (모노머, monomer)로 포함하는 것을 특징으로 한 다. 본 발명의 단백질 케이지는 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티 드만으로， 또는 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드 및 다른 페리 틴 단백질 모노머와의 조합으로 구성될 수 있다. 본 발명에서 사용되는 용어인 "자가조립 (sel f-assembly)" 란 어떤 분자들이 외부의 특별한 자극이나 인위적인 유도없이， 스스로 알아서 특정한 나노구조를 형 성하는 성질을 의미한다. 본 발명의 페리틴 단백질은 페리틴 단백질 모노머의 결합에 의해 만들어지는 것으로 일반적으로 생체 내에서 구형의 케이지 형태를 하고 있다.
본 발명의 페리틴 단백질은 본 발명의 페리틴 모노머 단편 또는 융합폴리펩 티드가 단위체로서 규칙적으로 배열된 복합 단백질일 수 있으며， 더 바람직하게는 본 발명의 페리틴 모노머 단편 또는 융합폴리펩티드 24개가 3차원적으로 규칙적으 로 배열을 통해 형성된 것일 수 있다. 본 발명은 서열번호 2로 표시되는 아미노산 서열을 갖는 페리틴 모노머 단편 C-말단， N-말단, 또는 C-말단 및 N-말단에 항체 또는 세포 수용체와 결합할 수 있 는 리간드 템티드가 융합된 융합폴리템티드를 포함하는 약물전달시스템을 제공한 다. 본 발명은 또한, 상기 융합폴리펩티드는 서열번호 6 또는 서열번호 7로 표시 되는 아미노산 서열을 갖는 것을 특징으로 하는 약물전달시스템을 제공한다. 본 발명의 약물전달시스템은 본 발명의 융합폴리템티드를 유효성분으로 포함 하는 것을 특징으로 한다. 또한 본 발명의 약물전달시스템은 본 발명의 융합폴리펩티드를 유효성분으로 구성되는 것을 특징으로 한다.
또한 본 발명의 약물전달시스템은 본 발명의 융합폴리템티드를 유효성분으로 필수적으로 구성되는 것을 특징으로 한다. 상기 약물은 예를 들어 특정 질병꾀 치료 또는 예방 활성이 있는 약물 또는 진단용 약물일 수 있다. 상기 특정 질병은 약물에 의한 치료 또는 예방이 가능한 어떠한 질병도 가능하다. 바람직하게는 상기 특정 질병은 암， 알레르기， 동맥경화 또는 천식 일 수 있다. 상기 약물은 화학적 합성 화합물, 단백질 치료제， 핵산 등 알려진 어떠한 종류의 물질도 가능하며， 바람직하게는 암, 알레르기， 동맥경화 또 는 천식 치료용 화학적 합성 화합물， 단백질 치료제， siRNA 등의 핵산 일 수 있다. 본 발명의 융합폴리펩티드는 단백질 케이지를 형성할 수 있으며， 약물을 형 성된 단백질 케이지 내부에 포함할 수 있다. 또한 본 발명의 융합폴리펩티드는 단 백질 케이지 형성시 활성폴리펩티드를 외부로 노출시켜 이와 결합하는 분자， 세포 또는 조직과 특이적으로 결합할 수 있으므로， 약물을 상기 분자， 세포 또는 조직에 선택적으로 전달하는 약물전달시스템으로 사용할 수 있다. 또한 본 발명의 페리틴 모노머 단편의 N말단 및 /또는 C말단에 약리학적 활성 을 나타내는 약물이 결합할 수 있으므로， 이 경우 본 발명의 융합폴리펩티드는 약 물이 페리틴 모노머 단편에 직접적으로 또는 링커를 통해 간접적으로 결합되어 전 달되는 약물전달시스템으로 사용될 수 있다.
본 발명의 약물전달시스템은 본 발명의 융합폴리펩티드에 융합되는 폴리펩티 드단편의 종류에 따라 다양한 세포， 조직， 질병을 표적할 수 있다. 본 발명의 일실시예에 따르면， 본 발명자들은 암세포의 표면에 과발현되어 있는 단백질인 p32 수용체에 결합할 수 있는 아미노산 서열 (CGKRK)을 포함하는 서 열번호 3의 폴리펩티드를 페리틴 모노머 단편의 N-말단에 융합한 후， 융합폴리펩티 드의 세포 내 uptake 여부를 관찰하였다. FACS 분석, 형광현미경 분석 및 공초점 현미경 Z-stack 분석을 통해 확인한 결과， 본 발명의 융합폴리펩티드가 암세포 내 부로 uptake 되어 있음을 확인하여 본 발명의 융합폴리펩티드가 표적 세포로 약물 을 전달하기 위한 플랫품으로 유용하게 사용될 수 있음을 확인할 수 있었다 (실시예 5) . 본 발명은 또한 서열번호 2로 표시되는 아미노산 서열을 갖는 페리틴 모노머 단편의 C-말단， N-말단， 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 단백질이 융합된 융합폴리¾티드를 유효성분으로 포함하는 암 치료용 약학적 조성물을 제공 한다. 본 발명은 또한 상기 융합폴리펩티드는 서열번호 6 또는 서열번호 7로 표시 되는 아미노산 서열을 갖는 융합폴리펩티드인 것을 특징으로 하는 약학적 조성물올 제공한다. 본 발명의 일실시예에서는, 페리틴 모노머 단편에 세포사멸 유도 펩티드 (pro-apoptot ic pept ide)가 융합된 융합펩티드를 제작하여 암세포에 대한 세포독성 을 평가한 결과, 본 발명의 융합폴리펩티드가 농도 의존적으로 암세포의 세포사멸 을 유도하는 것으로 확인되었다 (실시예 6) . 본 발명에 따른 약학적 조성물은 상기 융합폴리펩티드를 단독으로 함유하거 나 약학적으로 허용되는 담체와 함께 적합한 형태로 제형화 될 수 있으며， 부형제 또는 회석제를 추가로 함유할 수 있다. 상기에서 '약학적으로 허용되는'이란 생리 학적으로 허용되고 인간에게 투여될 때， 통상적으로 위장 장애， 현기증 등과 같은 알레르기 반응 또는 이와 유사한 반웅을 일으키지 않는 비독성의 조성물을 말한다. 약학적으로 허용되는 담체로는 예컨대, 경구 투여용 담체 또는 비경구 투여 용 담체를 추가로 포함할 수 있다. 경구 투여용 담체는 락토스， 전분， 셀를로스 유 도체， 마그네슘 스테아레이트， 스테아르산 등을 포함할 수 있다. 아울러， 펩티드 제제에 대한 경구투여용으로 사용되는 다양한 약물전달물질을 포함할 수 있다. 또 한, 비경구 투여용 담체는 물， 적합한 오일， 식염수, 수성 글루코오스 및 글리콜 등을 포함할 수 있으며, 안정화제 및 보존제를 추가로 포함할 수 있다. 적합한 안 정화제로는 아황산수소나트륨, 아황산나트륨 또는 아스코르 브산과 같은 항산화제 가 있다. 적합한 보존제로는 벤즈알코늄 클로라이드， 메틸 -또는 프로필-파라벤 및 클로로부탄올이 있다. 본 발명의 약학적 조성물은 상기 성분들 이외에 윤활제， 습 윤제, 감미제, 향미제, 유화제， 현택제 등을 추가로 포함할 수 있다. 그 밖의 약학 적으로 허용되는 담체 및 제제는 다음의 문헌에 기재되어 있는 것을 참고로 할 수 있다 (Remington ' s Pharmaceut ical Sciences , 19th ed. , Mack Publ ishing Company , East on, PA, 1995) . 본 발명의 조성물은 인간을 비롯한 포유동물에 어떠한 방법으로도 투여할 수 있다. 예를 들면, 경구 또는 비경구적으로 투여할 수 있다. 비경구적인 투여방법으 로는 이에 한정되지는 않으나, 정맥내， 근육내， 동맥내， 골수내, 경막내， 심장내， 경피， 피하, 복강내, 비강내， 장관, 국소， 설하 또는 직장내 투여일 수 있다. 본 발명의 약학적 조성물은 상술한 바와 같은 투여 경로에 따라 경구 투여용 또는 비경구 투여용 제제로 제형화 할 수 있다.
경구 투여용 제제의 경우에 본 발명의 조성물은 분말， 과립， 정제， 환제， 당 의정제， 캡슐제, 액제， 겔제， 시럽제， 슬러리제， 현탁액 등으로 당업계에 공지된 방법을 이용하여 제형화될 수 있다. 예를 들어， 경구용 제제는 활성성분을 고체 부 형제와 배합한 다음 이를 분쇄하고 적합한 보조제를 첨가한 후 과립 흔합물로 가공 함으로써 정제 또는 당의정제를 수득할 수 있다. 적합한 부형제의 예로는 락토즈， 텍스트로즈, 수크로즈， 솔비틀， 만니틀, 자일리틀, 에리스리를 및 말티를 등을 포 함하는 당류와 옥수수 전분， 밀 전분， 쌀 전분 및 감자 전분 등을 포함하는 전분 류， 셀를로즈，메틸 셀를로즈, 나트륨 카르복시메틸셀를로오즈 및 하이드록시프로필 메틸-셀를로즈 등을 포함하는 샐를로즈류， 젤라틴， 폴리비닐피를리돈 등과 같은 층 전제가 포함될 수 있다. 또한， 경우에 따라 가교결합 폴리비닐피를리돈， 한천， 알 긴산 또는 나트륨 알기네이트 등을 붕해제로 첨가할 수 있다. 나아가， 본 발명의 약학적 조성물은 항웅집제, 윤활제， 습윤제， 향료， 유화제 및 방부제 등을 추가로 포함할 수 있다.
비경구 투여용 제제의 경우에는 주사제, 크림제， 로션제， 외용연고제， 오일 제, 보습제, 겔제， 에어로졸 및 비강 흡입제의 형태로 당업계에 공지된 방법으로 제형화할 수 있다. 이들 제형은 모든 제약 화학에 일반적으로 공지된 처방서인 문 헌 (Remington' s Pharmaceut ical Science, 19th ed. , Mack Publ ishing Company , East on, PA, 1995)에 기재되어 있다. 본 발명의 조성물의 총 유효량은 단일 투여량 (single dose)으로 환자에게 투여될 수 있으며, 다중 투여량 (mult iple dose)으로 장기간 투여되는 분할 치료 방 법 ( fract ionated treatment protocol )에 의해 투여될 수 있다. 본 발명의 약학적 조성물은 질환의 정도에 따라 유효성분의 함량을 달리할 수 있다. 바람직하게 본 발명의 약학적 조성물의 바람직한 전체 용량은 1일당 환자 체중 1kg 당 약 0.01 내지 10, 000mg, 가장 바람직하게는 0. 1 mg 내지 500 mg일 수 있다. 그러나 상기 약 학적 조성물의 용량은 제제화 방법， 투여 경로 및 치료 횟수뿐만 아니라 환자의 연 령， 체중， 건강 상태， 성별, 질환의 중증도， 식이 및 배설율등 다양한 요인들을 고 려하여 환자에 대한 유효 투여량이 결정되는 것이므로， 이러한 점을 고려할 때 당 분야의 통상적인 지식을 가진 자라면 본 발명의 조성물의 적절한 유효 투여량을 결 정할 수 있을 것이다. 본 발명에 따른 약학적 조성물은 본 발명의 효과를 보이는 한 그 제형, 투여 경로 및 투여 방법에 특별히 제한되지 아니한다. 본 발명은 서열번호 2의 아미노산 서열을 갖는 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 형광 단백질이 융합된 융합폴리펩티드를 포함하 는 생체 이미징 시스템을 제공한다. 본 발명은 또한 상기 융합폴리펩티드는 서열번호 6 또는 서열번호 7로 표시 되는 아미노산 서열을 갖는 것을 특징으로 하는 생체 이미징 시스템을 제공한다. 본 발명에 따른 페리틴 모노머 단편에 형광단백질이 융합된 융합폴리펩티드 는 생체 이미징 시스템으로 활용될 수 있으며, 상기 시스템은 유동세포분석기 (FACS) 또는 공초점현미경 등을 이용하여 세포 내 형광을 측정함으로써 생체 내 화 상을 전달하는 것일 수 있다.
본 발명의 일실시예에서는 암세포 표면에서 과발현되어 있는 단백질인 p32 수용체에 결합할 수 있는 아미노산 서열을 갖는 서열번호 3의 폴리펩티드를 페리틴 모노머 N—말단에 융합하고， 녹색형광단백질 (green f luorescent protein, GFP)을 C_ 말단에 융합한 후， FACS, 형광현미경 및 공초점 현미경 Z-stack 분석을 시행하였 다. 그 결과， 암세포 내에서 녹색 형광이 강하게 발현되는 것을 확인하여 본 발명 의 융합폴리펩티드가 질병의 진단에 유용하게 사용될 수 있는 생체 이미징 시스템 을 제공할 수 있다는 것을 알 수 있었다 (실시예 5) . 특히， 본 발명의 융합폴리펩티드는 페리틴 케이지 내부， N-말단 또는 C-말단 에 질병 치료용 약물들을 자유롭게 포함할 수 있고， 동시에 N_말단 또는 C-말단에 형광 단백질을 융합함으로써 질병의 진단과 동시에 치료에도 웅용할 수 있어 그 효 용성이 매우 우수하다. 본 발명은 암 치료용 제제를 제조하기 위한 서열번호 2로 표시되는 아미노산 서열올 갖는 페리틴 모노머 단편 C-말단， N-말단, 또는 C-말단 및 N-말단에 세포독 성 펩티드 또는 세포독성 단백질이 융합된 융합폴리펩티드의 용도를 제공한다. 본 발명은 서열번호 2로 표시되는 아미노산 서열을 갖는 페리틴 모노머 단편 C-말단， N-말단, 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 세포독성 단백질 이 융합된 융합폴리펩티드를 유효성분으로 포함하는 조성물의 유효량을 이를 필요 로 하는 개체에 투여하는 것을 특징으로 하는 암 치료 방법을 제공한다.
또한 본 발명은 서열번호 2로 표시되는 아미노산 서열올 갖는 페리틴 모노머 단편 C-말단, N-말단， 또는 Cᅳ말단 및 N-말단에 세포독성 펩티드 또는 세포독성 단 백질이 융합된 융합폴리펩티드를 유효성분으로 구성되는 조성물의 유효량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 치료 방법을 제공한다.
또한 본 발명은 서열번호 2로 표시되는 아미노산 서열을 갖는 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 세포독성 단 백질이 융합된 융합폴리펩티드를 유효성분으로 필수적으로 구성되는 조성물의 유효 량을 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 치료 방법을 제공 한다. 본 발명의 상기 '유효량' 이란 개체에게 투여하였을 때， 암의 개선， 치료， 예방， 검출 또는 진단 효과를 나타내는 양을 말하며， 상기 '개체' 란 동물， 바람직 하게는 포유동물， 특히 인간을 포함하는 동물일 수 있으며， 동물에서 유래한 세포， 조직， 기관 등일 수도 있다. 상기 개체는 치료가 필요한 환자 (pat ient ) 일 수 있 다.
본 발명의 상기 '치료' 는 암 또는 암의 증상을 개선시키는 것을 포괄적으 로 지칭하고， 이는 이러한 질환을 치유하거나， 실질적으로 예방하거나, 또는 상태 를 개선시키는 것을 포함할 수 있으며， 암으로부터 비롯된 한 가지 증상 또는 대부 분의 증상을 완화시키거나， 치유하거나 예방하는 것을 포함하나， 이에 제한되는 것 은 아니다. 본 발명의 용어 '〜을 포함하는 (compri sing)' 이란 '함유하는' 또는 '특징 으로 하는' 과 동일하게 사용되며， 조성물 또는 방법에 있어서, 언급되지 않은 추 가적인 성분 요소 또는 방법 단계 등을 배제하지 않는다. 용어 '〜로 구성되는 (consist ing of ) ' 이란 별도로 기재되지 않은 추가적인 요소, 단계 또는 성분 등을 제외하는 것을 의미한다. 용어 '필수적으로 구성되는 (essent ial ly consist ing of ) ' 이란 조성물 또는 방법의 범위에 있어서, 기재된 물질 또는 단계와 더불어 이의 기본적인 특성에 실질적으로 영향을 미치지 않는 물질 또는 단계 등을 포함하는 것 을 의미한다.
【유리한 효과】
이상 펴본 바와 같이 , 서열번호 2로 표시되는 아미노산 서열을 갖는 인간 유래 페리틴 모노머 단편의 N-말단 및 /또는 C-말단에 폴리펩티드 또는 단백질이 융 합된 융합폴리펩티드는 그 생산 효율이 매우 우수하며, 자가조립에 의해 단백질 케 이지를 형성하여 내부에 유효물질의 봉입이 가능하고， 3차원적 구조 특성상 입체 가리움 효과가 적어 N-말단 또는 C-말단에 융합된 폴리펩티드 또는 단백질의 생리 학적 활성이 우수하게 나타난다는 점에서 질병의 진단 또는 치료제 개발에 효과적 이다.
【도면의 간단한 설명】
도 1은 야생형의 페리틴 모노머, V 헬릭스가 제거된 짧은 페리틴 모노머 및 각각의 페리틴 모노머로 이루어진 페리틴 cage의 모식도를 나타낸 도면이다. 도 2A는 짧은 페리틴 모노머의 C-말단에 GFP가 결합된 융합 펩티드 (sFt-GFP) 및 야생형의 페리틴 모노머의 C-말단에 GFP가 결합된 융합 펩티드 (wFt-GFP)의 모식 도를 나타낸 도면이다.
도 2B는 sFt-GFP 및 wFt-GFP가 cage를 형성하는지 여부를 TEM 이미징으로 관 찰한 결과이다. 도 3은 sFt-GFP 및 wFt-GFP를 MMP-2와 1시간 동안 37°C에서 배양한 후 링커 가 절단되는 경향올 SDS-PAGE 분석을 통해 관찰한 결과이다 (FT: ferrit in) 도 4는 sFt-GFP 및 wFt-GFP의 정제 분획을 분자량 마커와 함께 SDS-PAGE 분 석을 통해 관찰한 결과이다 (uninduced: IPTG에 의한 단백질 발현유도 전 whole cel l suspension, induced:단백질 발현 유도 후 whole cel l suspension, sup: soluble cel l lysate (supernatant ) . ppt： eel 1 lysi s precipi tant NTA pur i f ied from sup : bound fract ion to NTA agarose beads from the soluble cel l lysate . NTA FT from sup: unbound f r act ion( f low through) to NTA agarose beads from the soluble cel l lysate) 도 5는 sFt의 N-말단에 세포사멸 유도 펩티드 (pro-apoptot ic pept ide) 및 C- 말단에 MMP-2에 의해 절단이 가능한 서열올 포함하고 있는 링커에 연결된 GFP를 융 합한 융합펩티드 (KLAK-sFt-GFP) 단편 및 상기 단편이 형성한 cage의 모식도를 나타 낸 도면이다. 도 6A는 야생형 페리틴， 짧은 페리틴， sFt-GFP 융합펩티드 및 KLAK-sFt-GFP 융합펩티드가 cage를 형성하는지 여부를 TEP 이미징으로 관찰한 결과이다.
도 6B는 짧은 페리틴, sFt-GFP 융합펩티드 및 KLAK-sFt— GFP 융합펩티드가 형 성한 cage를 SEC로 분석한 결과이다. 도 7A는 sFt의 C-말단에 MMP-2에 의해 절단될 수 있는 아미노산 서열을 갖고 있는 링커를 통해 GFP를 결합한 융합펩티드 (제 I형) 및 sFt의 C-말단 및 N-말단에 MMP-2에 의해 절단될 수 있는 아미노산 서열을 갖고 있는 링커를 통해 GFP 및 세포 사멸 유도 펩티드를 각각 결합한 융합펩티드 (제 I I형)의 모식도를 나타낸 도면이다. 도 7B는 제 I형 및 제 I I형 융합펩티드에 MMP-2를 처리한 후 절단된 산물을 SDS PAGE겔에 로딩하여 관찰한 결과이다. 도 8은 세포주에서 sFt-GFP 융합펩티드 및 KLAK-sFt-GFP 융합펩티드를 처리 한 후 융합펩티드의 세포 내 uptake 여부를 관찰한 결과이다 (A: MDA-MB-231 세포주 (암표적 펩타이드 수용체 (p32) 발현 세포， 왼쪽 패널)와 HL-60 세포주 (p32를 발현 하지 않는 대조군 세포， 오른쪽 패널)의 FACS 분석결과， B: 형광 현미경 관찰 결 과， C: 공초점 현미경 Z-stack 분석 결과) . , 도 9A는 KLAK-sFt-GFP 융합펩티드의 세포독성을 MTT assay를 통해 평가한 결 과이다, 도 9B는 KLAK-sFt-GFP 융합펩티드의 세포독성을 FACS를 이용하여 평가한 결 과이다. 도 10은 KLAK-sFt-GFP 융합펩티드의 생체 내 세포 사멸 활성을 평가한 것으 로, 공초점 현미경을 이용하여 동물실험을 통해 획득한 종양의 조직학적 검사를 실 시한 결과이다 (Nuclear： blue , apoptot ic region: red, Scale bar=40) .
【발명의 실시를 위한 형태】
이하 본 발명을 상세히 설명한다.
단, 하기 실시예는 본 발명을 예시하는 것일 뿐， 본 발명의 내용이 하기 실 시예에 한정되는 것은 아니다.
<실험방법>
1. CGKRK(KLAKLAK)2 및 GFP가 짧은 페리틴 모노머 (short-ferrit in monomer) 에 융합된 융합 펩티드 (KLAK-sFt-GFP)의 제작
Double Chambered Nano Cage(DCNC)를 발현하는 재조합 플라스미드를 변형된 PET28 백터 (Novagen)를 이용하여 제작하였다. 효율적인 클로닝을 위해 변형된 PET28 백터는 Ncol/Ndel 사이에 Kpnl 및 Nhel , 그리고 EcoRI/Sall 사이에 Spel의 추가적인 제한효소 위치를 포함하고 있다. 짧은 페리틴 (short-ferrit in, sFt ) heavy chain( 1-161 amino acid)을 인코딩 하는 유전자는 인간 페리틴 heavy chain(Sino Biological Inc . )의 cDNA를 이용한 PCR을 통해 얻었으며， 종래 보고된 방법 (ACS nano 2013, 7， (9)， 7462-7471. 등)에 따라 박테리아-발현을 이용하기 위 해 Ndel 및 BamHl 위치에 삽입되었다.
CGKRK(KLAKLAK)2를 인코딩 하는 올리고뉴클레오티드가 합성되었고 Kpnl 및
Nhel 사이에 삽입되었다. seGFP( signal enhanced Green Fluorescent Protein) 유전 자는 PCR을 통해 준비 되었으며 Spel 및 Xhol 사이에 삽입되었다. 합성된 유동성 있는 링커 (GSGGGSG)는 BamHI 및 EcoRI 사이에 삽입되었고， MMP-2 절단 서열 (GPLGLAGGGSG)은 합성된 후 EcoRI 및 Spel 사이에 삽입되었다. 상기 서열은 최종적 으로 GFP와 페리틴 모노머 사이에 GSGGGSGEFGPLGLAGGGSGTS 의 서열을 갖는 링커를 생성하였다. N-말단 chamber와 페리틴 모노머 사이에 MMP2 절단 부위를 삽입하기 위해， GPLGLAG서열이 합성되었고, Nhel 및 Ndel 사이에 삽입되었다.
sFt-GFP 융합 펩티드는 CGKRK(KLAKLAK)2를 삽입하는 것을 제외하고는 상기와 동일한 클로닝 방법에 따라 제작되었다.
2. 단백질 발현 및 정제 단백질은 . co// BL2KDE3) 세포에서 과발현 되었다. 세포는 LB배지에서 37 °C에서 키운 후 0D600 값이 0.5에 도달하면 IPTG ImM을 이용하여 발현을 유도하였 다. 이 후 세포를 원심분리를 통해 모은 후， 펠렛을 lysis 버퍼 (20mM Tr is-HCl pH 8.0， lOOmM NaCl , ImM EDTA, 1% Tri tonX— 100， ImM PMSF, 0.5mM DTT)를 이용하여 세 포를 파괴하였고， 초음파 프로세서와 함께 파쇄하였다. 세포 lysate로부터 얻어진 발현된 단백질은 NTA 아가로스 비드를 이용하여 종래 보고된 방법 (J . Analyt ical chemi stry 2011 , 83， (15)， 5834-5843)에 따라 정제하였다.
3. KLAK-sFt-GFP DCNC의 확인 단백질 정제 이후에, 단백질은 size exclusion chromatography(SEC, Superdex 200 10/300 GL column)을 이용하여 분석하였다. 올리고머 상태는 용출 부 피와 표준 분자량과의 비교를 통해 판단하였다. 단백질 용출 프로파일은 280 nm에 서의 흡광도를 측정함으로써 관찰하였다. TEM 사진은 FEI TecnaKthe Korea Basic Science Inst itute , KBSI )를 사용하여 기록되었다.
4. 재조합된 MMP-2에 의한 KLAK-sFt-GFP DCND의 절단 재조합 MMP-2는 R&D systems(Minneapol is , MN, USA)에서 구매하여 사용하였고， 제 조자의 지시에 따란 절단 시험에 이용하였다. MMP-2는 처음에 APMA(p- am i nopheny 1 mer cur i c acetate ; ImM, Sigma, Saint Louis , M0, USA)와 함께 1시간 동안， 37°C에서 배양하여 활성화를 시켰다. 활성화된 MMP-2 0, 25， 50， 100 ng)을 20 의 DCNC에 첨가하여 최종 부피 TCBN 버퍼 (50 mM Tris-HCl , pH 7.5, 150 mM NaCl , 10 mM CaCl2 및 0.05% Grij-35) 40 μ 1가 되도톡 하였다. 1시간 동안 37°C에서 배양한 후， DCNC 단독 또는 MMP-2와 반웅시킨 DCNC를 12% SDS-PAGE에 로딩하였다. 5. 세포 결합 및 세포 내 uptake 평가 인간 유방암 세포주인 MDA-MB-231세포 (ATCC, Manassas , VA)를 DMEM(high glucose)에서 배양하였다. 세포 내 흡수를 분석하기 위하여 2 X 105 의 세포를 KLAK-sFt-GFP DCNC 또는 sFt—GFP와 함께 1시간 동안 37°C에서 배양하였다. 이 후 세포를 PBS로 세척하고， 다시 부유시킨 후， 세포 녹색 형광올 FACS Calibur cytometry(BD Biosciences, SanJose, CA, USA)를 이용하여 분석하였다. 현미경 분 석을 위하여， MDA-MB— 231 세포는 8개의 chamber culture slide에 1 x 1( 세포 /chamber 의 밀도로 시딩하였으며， 하룻밤 동안 부착할 수 있도톡 배양하였다. 세 포는 1.4 μΜ의 KLAK-sFt-GFP DCNC 또는 sFt-GFP와 함께 37°C에서 1시간 동안 배양 하였다. 핵은 DAPI로 염색하였고， 슬라이드를 형광 현미경을 이용하여 분석하였다. 세포질 내 나노파티클의 분포를 관찰하기 위해， 공초점 현미경 (Carl Zeiss, Oberkochen, Germany)을 이용하였고， 세포는 lectin으로 세포막을 염색하여 z_ sectional 이미징하였다.
6. KLAK-sFt-GFP DCNC 의 세포독성 평가
MDA-MB-231 세포주를 이용하여 KLAK-sFt-GFP DCNC의 세포독성을 평가하였다. 세포를 96-웰 플레이트에 시딩하고 24시간 동안 배양하였다. 이 후 배양 배지를 KLAK-sFt-GFP DCNCC0.5 내지 4μΜ)이 포함된 새로운 DMEM 배지로 교체하였다. 대조 군으로서， 4 μΜ sFt-GFP를 배지에 첨가하였다. 총 48시간의 배양 후에， 세포 생존 를을 MTT 어세이를 통해 평가하였다.
세포사멸 (apoptosis) 유발 여부는 아넥신 V-Alexa Fluor 647 (Invitrogen) 및 propidium iodide(PI)올 이용하여 FACS를 통해 평가하였다.
1 X 105 의 MDA-MB-231 세포를 0.35, 0.7 및 1.4 μΜ의 KLAK-sFt-GFP DCNC가 포함된 배지에서, 37°C에서 24시간 동안 배양하였다. 세포는 PBS와 binding buffer (10 mM Tris-HCl, H 7.4, 150 mM NaCl, 2 mM CaCl2)를 이용하여 3회 세척하 였다. 세척된 세포는 아넥신 V-Alexa Fluor 647 및 PI와 함께 37°C에서 20분간 배 양하였고， 즉시 FACS를 통해 분석하였다. 세포사멸 (apoptosis)의 대조군으로서， etoposide(50uM, Sigma)를 세포에 처리하여 관찰하였다. 7. 마우스 모델에서 KLAK-sFt-GFP DCNC의 세포사멸 효과 모든 동물실험은 기관의 지침에 따라 수행하였고 경북대학교 동물 관리 및 사용위원회 ( Inst itut ional Animal Care and Use Commi ttee, IACUC)의 지침에 따라 승인된 동물 실험 방법에 따라 실시하였다 (허가번호 KNU 2015-0017) . 동물의 고통 을 최소화하기 위해 노력했다. 6 내지 8 주령이고， 몸무게가 20±3g인 암컷 BALB/c 누드 마우스 (그룹당 4마리， 총 16마리)의 오른쪽 어깨에 MDA-MB-231 세포 (1 X 106)를 감염시켰다. 100mm3 종양이 관찰되었을 때， 30 u mol/L인 KLAK-sFt-GFP lOO y L를 하 루에 한번씩 일주일에 3번 정맥주사로 투여하였다. 비교를 위해 KLAK 펩티드 단독， sFt-GFP + KLAK 펩티드 또는 식염수를 같은 양으로 사용하였다. 4번 투여한 후 (9일 후)， 동물들올 C02로 안락사 시켰고， 동물에서 종양 조직을 제거했고, 4% 파라포름 알데하이드 (paraformaldehyde , PFA)로 밤새 고정시킨 뒤, 냉동 절편 (cryosect ioning)으로 동결시켰으며, 공초점 현미경 (Zeiss , Germany)로 면역 조직 화학적 ( immunohi stochemical ) 연구를 실시하였다. 제조사의 지침에 따라 TU EL( terminal deoxynucleot idyl transferaseᅳ mediated dUTP nick-end label ing) 염색법으로 종양 조직에서의 세포 사멸을 평가하였다.
<실험결과 (실시예) >
<실시예 1>
짧은 페리틴 (short ferrit in, sFt ) 모노머의 제작 및 이의 특성 펩티드， 화학물질 및 단백질들로 표면이 다양하게 변형된 페리틴이 cage 구 조를 형성할 수 있는지 여부가 검증되어 왔다. Cage의 표면에 리간드를 노출시키기 위해 두 가지의 위치가 빈번하게 선택되었으며， 이는 페리틴 모노머의 N-말단과 IV 번 및 V번 헬릭스 사이에 존재하는 짧은 루프 ( loop)이다. Cage의 내부에 위치하고 있는 구부러진 헬릭스 V는 페리틴의 C-말단에 큰 단백질 단편이 결합될 경우, cage 의 외부로 돌출이 된다. 본 발명자들은 이중 기능성을 나타내는 나노 프랫품을 개발하기 위해여， 페 리틴 모노머의 다섯 번째 헬릭스를 제거함으로써 짧은 페리틴 (sFt ) 모노머를 만들 었고 (도 1)， 야생형의 페리틴 (wFt )과 그 특성을 비교하였다.
즉, sFt과 wFt의 특성을 비교하기 위해 sFt 및 wFt 각각의 C-terminal 말단 에 비교적 크기가 큰 펩티드인 GFP를 융합하여 sFt-GFP 및 wFt-GFP 융합 펩티드를 제작하였고 (도 2A) , 상기 두 융합 펩티드 모두 cage를 잘 형성하는 것을 TEM( transmi ssion electro microscopy)를 통해 확인하였다 (도 2B) ·
상기 sFt-GFP 및 wFt-GFP는 모두 E . col i에서 잘 발현이 되었고, 양자 모두 cage를 잘 형성하였지만， sFt-GFP가 wFt-GFP와 비교해 세 배 정도 더 많이 발현이 되어, 그 단백질 발현이 매우 우수한 것을 확인할 수 있었다. 뿐만 아니라, sFt-GFP는 wFt-GFP와 비교해 MMP-2에 의해 더 쉽게 절단이 되 는 것으로 확인되었고 (도 3)， NTA-아가로스 비드에 의해 sFt— GFP의 N—말단에 부착 된 히스티딘 tag가 wFt-GFP의 N-말단에 부착된 히스티딘 tag에 비해 훨씬 더 효율 적으로 분리가 되는 것으로 되는 것을 확인할 수 있었다 (도 4) .
상기한 결과를 통해， wFt의 C-말단에 거대한 분자인 GFP가 결합된 융합 펩티 드는 공간 구조적으로 매우 밀집되어 MMP-2에 의해 절단되는 링커 부위가 쉽게 노 출이 되지 않으며, N-말단에 부착된 6개의 히스티딘 tag가 입체적으로 상당히 가리 워져 있을 것으로 판단할수 있었다. 이에 반해， 야생형 페리틴 모노머에서 V 헬릭 스가 제거된 sFt의 경우, C-말단에 거대한 분자인 GFP가 결합되어 있음에도 불구하 고 MMP-2에 의해 쉽게 절단이 되었으며 , N-말단에 부착된 히스티딘 tag가 용이하게 분리가 되는 것이 미루어 보아， wFt에 비해 공간 구조적으로 상당히 노출이 되어 있다는 것을 알수 있었다.
<실시예 2>
세포사멸 유도 펩티드 및 GFP가 sFt에 욥합된 욥합펩티드의 제작 상기한 실험 결과를 통해， sFt이 펩티드 및 /또는 단백질의 이중 전달체로서 사용이 가능할 뿐만 아니라， 효소에 의한 절단이 용이하여 목적 부위에서 융합된 펩티드의 방출이 용이하다는 것을 알았고, 이에, 본 발명의 발명자들은 sFt의 N-말 단에 세포사멸 유도 펩티드 (pro-apoptot i c pept ide)인 CGKRK(KLAKLAK)2를, 그리고 sFt의 C—말단에 MMP-2에 의해 절단이 될 수 있는 서열을 포함하고 있는 링커에 연 결된 GFP를 융합한 융합 펩티드 (KLAK-sFt-GFP)를 제작하였다 (도 5) . <실시예 3>
KLAK-sFt-GFP융합펩티드의 cage 형성 테스트
KLAK-sFt-GFP 융합펩티드가 cage를 잘 형성하는지 여부를 판단하기 위해 size-exclusion chromatography (SEC) 및 TEM( transmi ssion electron 'mi croscopy)를 통해 관찰하였다. 또한， cage 형성의 경향을 비교하기 위해 야생형의 페리틴 (wFt ) , sFt 및 sFt-GFP 융합펩티드의 cage 형성도 함께 관찰하였다. 이에 대한 결과를 도 6에 나타내었다.
도 6A에 나타낸 바와 같이， KLAK-sFt-GFP융합펩티드는 wFt , sFt 및 sFt-GFP 융합펩티드와 함께 일정한 크기의 cage를 잘 형성하는 것을 확인할 수 있었다. KLAK-sFt-GFP 융합펩티드 및 sFt-GFP 융합펩티드는 wFl：， sFt과 비교해 그 cage의 형태가 크다는 것도 함께 확인할 수 있었다..
도 6B에 나타낸 바와 같이, SEC 분석 결과 KLAK-sFt-GFP 융합펩티드 및 sFt— GFP 융합펩티드는 sFt과 비교해 보다 이른 시점에서 단백질의 방출이 나타났다는 점에서 cage의 크기가 sFT에 비해 더 크다는 것을 알 수 있었다. 상기한 결과를 통해， sFt의 N-말단 및 C-말단에 펩티드 또는 단백질을 융합 한다고 하더라도， cage를 형성하는데 아무런 문제가 없다는 것을 확인하였다.
<실시예 4>
효소에 의한 KLAK-sFt-GFP 융합펩티드 내 링커의 절단
KLAK-sFt-GFP 융합펩티드에 융합되어 있는 펩티드를 연결하고 있는 링커들이 효소에 노출이 될 수 있는지 및 효소에 의해 절단이 될 수 있는지 여부를 확인하고 자 하였다. 제 I형 융합펩티드는 sFt의 C-말단에 MMP-2에 의해 절단될 수 있는 서열 을 갖고 있는 링커를 통해 GFP를 융합하였고， 제 I I형 융합펩티드는 sFT의 C-말단 및 N-말단에 상기와 동일한 링커를 연결하여 GFP 및 세포사멸 유도 펩티드를 각각 융합하였다 (도 7A) . 상기한 두 종류의 융합펩티드에 MMP-2를 처리하고 SDS PAGE 겔 에 로딩하여 그 결과를 관찰하였다. 이에 대한 결과를 도 7B에 나타내었다.
도 7B에 나타낸 바와 같이， 제 I형 및 제 I I형 융합펩티드에서 각각의 링커가 절단되어 생성된 산물들이 농도 의존적으로 관찰되었다. 상기한 결과를 통해， 목적 하는 펩티드 또는 단백질을 링커를 이용하여 sFt의 C-말단 및 /또는 N-말단에 융합 할 경우， 링커가 효소에 노출되어 절단될 수 있다는 것을 알 수 있었다.
따라서， sFt의 C-말단 및 /또는 N_말단에 특정 효소에 의해 분해될 수 있는 아미노산 서열을 갖고 있는 링커를 결합하여 펩티드 또는 단백질을 융합함으로써， 융합된 펩티드 또는 단백질을 방출할 수 있을 것이다.
<실시예 5>
KLAK-sFt-GFP욥합펩티드의 세포와의 결합 및 세포 내 uptake 평가 특정 암세포의 표면에 과발현되어 있는 단백질인 p32 수용체는， KLAK-sFt- GFP 융합펩티드의 N-말단에 융합된 CGKRK 펩티드를 인식하고， 이를 세포질 내로 uptake할 수 있다. 이에, KLAK-sFt-GFP 융합펩티드의 세포와의 결합 및 세포 내 uptake 여부를 관찰하였다. 우선， MDA-MB— 231 세포와 p32를 발현하지 않는 HL-60세포에 KLAK-sFt-GFP 융 합펩티드 또는 sFt-GFP 융합펩티드를 처리하고 37°C에서 1시간 배양한 후 FACS를 이용하여 세포 내 형광의 발현 여부를 분석하였다.
이에 대한 결과를 도 8A에 나타내었다. 도 8A에 나타낸 바와 같이， N-말단에 CGKRK 펩티드가 포함되어 있는 KLAK-sFt-GFP 융합펩티드를 처리한 세포군에서는 농 도 의존적으로 세포 내에서 형광이 관찰된 반면, sFt의 C-말단에 GFP만을 융합한 sFt-GFP 펩티드를 처리한 세포군에서는 비특이적인 음세포작용 (pinocytosi s)에 의 해 융합펩티드가 세포 내로 아송되어 매우 낮은 형광만이 관찰되는 것을 확인하였 다. 또한， HL-60 세포에서는 대조군과 sFt-GFP 펩티드를 처리한 세포군과 같이， KLAK-sFt-GFP DCNC을 처리한 농도와 관계없이， 융합펩티드가 비특이적으로 세포 내 로 이송되고 매우 낮은 형광만이 관찰되는 것을 확인하였다. 또한， MDA-MB-231 세포에 KLAK-sFt-GFP 융합펩티드 또는 sFt-GFP 융합펩티드 를 처리하고 37°C에서 1시간 배양한 후 형광 현미경으로 융합펩티드의 세포 내 uptake 여부를 관찰하였다. 이에 대한 결과를 도 8B에 나타내었다. 도 8B에 나타낸 바와 같이， KLAK- sFt-GFP 융합펩티드를 처리한 세포군에서는 핵 (파란색)과 함께 녹색 형광이 관찰되 어， 세포질 내로 융합펩티드가 uptake 된 것을 확인할 수 있는 반면， sFt-GFP 융합 펩티드를 처리한 세포군에서는 세포의 핵만 관찰될 뿐 세포질 내에서 녹색 형광이 거의 관찰되지 않는 것을 확인하였다. 한편, KLAK-sFt-GFP 융합펩티드를 처리한 세포를 공초점 현미경 Z-stack 분 석을 통해 확인한 결과， 도 8C에 나타낸 바와 같이 빨간색으로 나타난 세포막 내부 에서 녹색 형광색이 위치하는 것으로 보아, 융합펩티드가 세포 내로 uptake 되었다 는 것을 다시 한번 확인할 수 있었다.
<실시예 6>
KLAK-sFt-GFP 융합펩티드의 세포독성 평가
MDA-MB-231 세포주에 KLAK-sFt-GFP 융합펩티드를 처리한 후 48시간을 배양하 고 세포 생존률을 MTT 어세이로 팡가하였다. 이에 대한 결과를 도 9A에 나타내었다.
도 9A에 나타낸 바와 같이， KLAK-sFt-GFP 융합펩티드를 처리에 의해 농도 의 존적으로 세포의 생존률이 감소하는 것을 관찰할 수 있었다. 다만， 48시간 동안 배 양하면서 세포의 과다한 분열로 인해 생존률이 크게 억제되지 않아 다른 또 다른 실험을 추가적으로 진행하였다. 즉， KLAK-sFt-GFP 융합펩티드를 세포에 처리한 후， 세포를 아넥신 V 및 propidium iodide(PI ) 염색하여 FACS를 통해 세포의 생존률을 평가하였다.
이에 대한 결과를 도 9B에 나타내었다. 세포에 KLAK-sFt-GFP 융합펩티드를 24시간 처리한 후 생존 세포는 70% 까지 감소하였다. 사멸한 세포의 대부분은 아넥 신 V만이 염색되었고， 이는 세포사멸 (apoptosi s)가 일찍 유도 되었다는 것을 의미 한다. 한편， KLAK-sFt-GFP 융합펩티드에 의해 유도된 세포사멸은， 양성 대조군으로 사용된 50 의 etoposide에 의해 유발된 세포사멸과 유사한 정도였다. 또한, 마우스 이종 모델을 사용하여 KLAK-sFt-GFP DCNC의 세포사멸 효과를 확인하기 위한 동물 실험을 실시하였다. 다음과 같이 4개의 그룹에 각각 식염수 (sal ine) , KLAK 펩티드 (KLAK) , sFt-GFP와 KLAK 펩티드 흔합 (sFt-GFP+KLAK)， KLAK- sFt-GFP(30 /L)를 정맥 주사법으로 투여하였다. 이에 대한 결과를 도 10에 나타내었다.
다른 그룹에 비하여 KLAK-sFt-GFP를 처리한 경우는 종양 성장에 영향을 미치 지 않았으나， 도 10에 나타난 바와 같이, 종양 내에서 세포 사멸 (apoptosi s)이 발 생하는 부위가 증가하였다. 마우스 내에 KLAK-sFt-GFP DCNC를 투여한 양이 종양의 성장을 억제하기에 층분하지 않았음에도 불구하고, KLAK-sFt-GFP DCNC는 종양 내에 서 세포 사멸을 촉진시키는 것을 확인할 수 있었다. 결론적으로， 세포사멸 유도 펩티드가 융합된 본 발명의 융합펩티드는 세포 내로 uptake된 이후에 세포의 사멸을 유발한다는 것을 알 수 있었다.
【산업상 이용가능성】
서열번호 2로 표시되는 아미노산 서열을 갖는 인간 유래 페리틴 모노머 단편 의 N-말단 및 /또는 C-말단에 폴리펩티드 또는 단백질이 융합된 융합폴리펩티드는 그 생산 효율이 매우 우수하며， 자가조립에 의해 단백질 케이지를 형성하여 내부에 유효물질의 봉입이 가능하고， 3차원적 구조 특성상 입체 가리움 효과가 적어 N-말 단 또는 C-말단에 융합된 폴리펩티드 또는 단백질의 생리학적 활성이 우수하게 나 타나 질병의 진단 또는 치료제 개발에 효과적이므로 산업상 이용가능성이 매우 높 다.

Claims

【청구의 범위】
【청구항 1】
서열번호 2로 표시되는 아미노산 서열을 갖는 인간 유래 페리틴 모노머 단 편.
【청구항 2】
제 1항의 인간 유래 페리틴 모노머 단편의 C-말단, N-말단， 또는 C-말단 및 N-말단에 펩티드 또는 단백질이 융합된 융합폴리펩티드.
【청구항 3】
게 2항에 있어서， 상기 펩티드 또는 단백질은 항체， 수용체와 결합할 수 있는 리간드 펩티드, 단백질 약물， 세포독성 폴리펩티드， 세포독성 단백질 및 형광 단백 질로 이루어진 군에서 선택된 어느 하나 이상인 것을 특징으로 하는 융합폴리펩티
【청구항 4】
저 12항에 있어서， 상기 펩티드 또는 단백질은 서열번호 3 또는 서열번호 4로 표시되는 아미노산 서열을 갖는 것을 특징으로 하는 융합폴리펩티드.
【청구항 5】
제 2항에 있어서， 상기 펩티드 또는 단백질은 인간 유래 페리틴 모노머 단편 의 C-말단 또는 N-말단에 링커를 통해 융합된 것을 특징으로 하는 융합폴리펩티드.
【청구항 6】
계 5항에 있어서, 상기 링커는 단백질 절단 효소의 기질이 될 수 있는 아미노 산서열을 포함하고 있는 것을 특징으로 하는 융합폴리펩티드.
【청구항 7】
제 6항에 있어서， 상기 단백질 절단 효소는 유로키나제 (urokinase) , 프로-유 로키나제 (pro-urokinase) , 플라스민 (plasmin)， 플라스미노겐 (plasminogen)， TGF]3 , 스타필로키나제 (staphylokinase) , 트롬빈 (thrombin) , 매트릭스 메탈로프로테이나제 (MP) 및 젤라티나제 (gel lat inase)로 이루어진 군에서 선택된 하나 이상인 것을 특 징으로 하는 용합폴리펩티드.
【청구항 8】
제 5항에 있어서， 상기 링커는 서열번호 5로 표시되는 아미노산 서열을 갖는 것을 특징으로 하는 융합폴리펩티드.
【청구항 9】
제 2항에 있어서, 상기 융합폴리펩티드는 서열번호 6 또는 서열번호 7로 표시 되는 아미노산서열을 갖는 것을 특징으로 하는 융합폴리펩티드.
【청구항 10]
제 2항에 있어서， 상기 펩티드 또는 단백질은 상기 융합폴리펩티드 간 또는 상기 융합폴리펩티드와 인간 유래 페리틴 모노머 간의 결합을 방해하지 않는 것을 특징으로 하는 융합폴리펩티드.
【청구항 111
제 1항의 인간 유래 페리틴 모노머 단편을 암호화하는 폴리뉴클레오티드.
【청구항 12】
제 11항의 폴리뉴클레오티드를 포함하는 발현백터.
【청구항 13]
제 12항의 발현백터로 형질전환된 형질전환체.
【청구항 14】
제 2항 내지 제 10항 중 어느 한 항의 융합폴리펩티드를 포함하는 단백질 케이
【청구항 15】
제 1항의 페리틴 모노머 단편 C-말단, N-말단, 또는 C-말단 및 N-말단에 항체 또는 세포 수용체와 결합할 수 있는 리간드 템티드가 융합된 융합폴리템티드를 포 함하는 약물전달시스템 .
【청구항 16】
제 15항에 있어서， 상기 융합폴리펩티드는 서열번호 6 또는 서열번호 7로 표 시되는 아미노산 서열을 갖는 것을 특징으로 하는 약물전달시스템.
【청구항 17】
제 1항의 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 세포 독성 펩티드 또는 세포독성 단백질이 융합된 융합폴리펩티드를 유효성분으로 포함 하는 암 치료용 약학적 조성물.
【청구항 18】
제 17항에 있어서, 상기 융합폴리펩티드는 서열번호 6 또는 서열번호 7로 표 시되는 아미노산 서열을 갖는 것을 특징으로 하는 약학적 조성물.
【청구항 19】
겨 U항의 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 형광 단백질이 융합된 융합폴리펩티드를 포함하는 생체 이미징 시스템.
【청구항 20】
제 19항에 있어서, 상기 융합폴리펩티드는 서열번호 6 또는 서열번호 7로 표 시되는 아미노산서열을 갖는 것을 특징으로 하는 생체 이미징 시스템.
【청구항 21]
암 치료용 제제를 제조하기 위한 제 1항의 페리틴 모노머 단편 C-말단, N-말 단, 또는 C-말단 및 N-말단에 세포독성 펩티드 또는 세포독성 단백질이 융합된 융 합폴리펩티드의 용도.
【청구항 22]
제 1항의 페리틴 모노머 단편 C-말단， N-말단， 또는 C-말단 및 N-말단에 세포 독성 펩티드 또는 세포독성 단백질이 융합된 융합폴리펩티드를 유효성분으로 포함 하는 조성물의 유효량올 이를 필요로 하는 개체에 투여하는 것을 특징으로 하는 암 치료 방법.
PCT/KR2016/009844 2015-09-02 2016-09-02 인간 유래 페리틴 모노머 단편 및 이를 이용한 융합폴리펩티드 WO2017039382A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/756,988 US10781238B2 (en) 2015-09-02 2016-09-02 Human-derived ferritin monomer fragment and fusion polypeptide using same

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20150124467 2015-09-02
KR10-2015-0124467 2015-09-02

Publications (1)

Publication Number Publication Date
WO2017039382A1 true WO2017039382A1 (ko) 2017-03-09

Family

ID=58187978

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2016/009844 WO2017039382A1 (ko) 2015-09-02 2016-09-02 인간 유래 페리틴 모노머 단편 및 이를 이용한 융합폴리펩티드

Country Status (3)

Country Link
US (1) US10781238B2 (ko)
KR (1) KR101888675B1 (ko)
WO (1) WO2017039382A1 (ko)

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101940626B1 (ko) * 2016-07-15 2019-04-10 한국과학기술연구원 반감기가 증가된 페리틴 나노케이지 및 그의 용도
KR20190105752A (ko) * 2018-03-06 2019-09-18 한국과학기술연구원 신규 항암 융합단백질 및 그의 용도
KR102352651B1 (ko) * 2018-03-06 2022-01-19 한국과학기술연구원 신규 항암 융합단백질 및 그의 용도
US20230348916A1 (en) * 2020-01-21 2023-11-02 The Research Foundation For Suny Expression and purification of recombinant human isoferritins using a novel expression system
KR102569463B1 (ko) * 2020-08-31 2023-08-23 경북대학교 산학협력단 Setd6의 set 도메인이 융합된 단백질을 포함하는 염증성 질환 예방 또는 치료용 조성물
KR102658825B1 (ko) * 2020-10-23 2024-04-19 경북대학교 산학협력단 Pd-l1 결합 펩타이드 1을 융합한 페리틴 나노케이지 및 이의 항암면역치료제로서의 용도
WO2022235061A1 (ko) * 2021-05-03 2022-11-10 (주)셀레메디 신규 단백질
JP2024517832A (ja) * 2021-05-03 2024-04-23 セレメディー カンパニー，リミテッド 肺癌の予防または治療用薬学組成物
WO2023154731A1 (en) * 2022-02-09 2023-08-17 The Regents Of The University Of California Ligand operable protein cages

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101189192B1 (ko) * 2010-06-24 2012-10-09 한국과학기술연구원 페리틴 및 ｇａｌａ 펩타이드의 융합 단백질, 이에 의해 구성된 케이지 단백질 및 이의 신규한 용도
KR20130062168A (ko) * 2011-12-02 2013-06-12 고려대학교 산학협력단 재조합 형광 단백질 나노입자
KR20140085371A (ko) * 2012-12-27 2014-07-07 경북대학교 산학협력단 인간 페리틴 유래 융합폴리펩티드
KR20140101319A (ko) * 2013-02-08 2014-08-19 경북대학교 산학협력단 인간 페리틴 유래 융합폴리펩티드
KR101477123B1 (ko) * 2011-10-12 2014-12-29 한국생명공학연구원 항체결합 펩타이드-페리틴 융합단백질 및 이의 용도

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2485363C (en) * 2002-05-10 2014-10-28 New Century Pharmaceuticals, Inc. Ferritin fusion proteins for use in vaccines and other applications

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101189192B1 (ko) * 2010-06-24 2012-10-09 한국과학기술연구원 페리틴 및 ｇａｌａ 펩타이드의 융합 단백질, 이에 의해 구성된 케이지 단백질 및 이의 신규한 용도
KR101477123B1 (ko) * 2011-10-12 2014-12-29 한국생명공학연구원 항체결합 펩타이드-페리틴 융합단백질 및 이의 용도
KR20130062168A (ko) * 2011-12-02 2013-06-12 고려대학교 산학협력단 재조합 형광 단백질 나노입자
KR20140085371A (ko) * 2012-12-27 2014-07-07 경북대학교 산학협력단 인간 페리틴 유래 융합폴리펩티드
KR20140101319A (ko) * 2013-02-08 2014-08-19 경북대학교 산학협력단 인간 페리틴 유래 융합폴리펩티드

Also Published As

Publication number Publication date
KR20170027683A (ko) 2017-03-10
US20180291072A1 (en) 2018-10-11
US10781238B2 (en) 2020-09-22
KR101888675B1 (ko) 2018-08-14

Similar Documents

Publication Publication Date Title
WO2017039382A1 (ko) 인간 유래 페리틴 모노머 단편 및 이를 이용한 융합폴리펩티드
JP6697028B2 (ja) 細胞透過性ペプチド、それを含んだコンジュゲート、及びそれを含んだ組成物
JP6708770B2 (ja) 細胞透過性ペプチド、それを含んだコンジュゲート、及びそれを含んだ組成物
US10053504B2 (en) SPARC binding ScFvs
JP5496220B2 (ja) アルブミン結合ペプチド介在性の疾患標的化
US11273206B2 (en) Targeting of pharmaceutical agents to pathologic areas using bifunctional fusion polypeptides
ES2361621T3 (es) Péptidos de lactoferrina útiles como péptidos de penetración celular.
US11643662B2 (en) Targeted protease compositions and uses related thereto
US20220041696A1 (en) Polypeptide targeting aptamers for characterization, capture, and clinical management of circulating tumor cells
KR101575194B1 (ko) 인간 페리틴 유래 융합폴리펩티드
KR102150419B1 (ko) Pd-l1에 결합하는 펩타이드 및 이의 용도
TWI602577B (zh) 雙重標靶融合蛋白
JP2022104932A (ja) ｄｓＲＮＡを標的化するためのキメラタンパク質
US20220177547A1 (en) Ferritin nanocage for multi-displaying trail trimer and cancer-targeting peptide and use thereof as anticancer agent
JP6925274B2 (ja) 治療
US20230374113A1 (en) Ferritin nanocage fused with pd-l1-binding peptide 1 and use thereof as anticancer immunotherapy agent
KR20190072485A (ko) Trail 수용체에 결합하는 펩타이드 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16842348

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15756988

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16842348

Country of ref document: EP

Kind code of ref document: A1