WO2016185016A1 - Novel polypeptides - Google Patents
Novel polypeptides Download PDFInfo
- Publication number
- WO2016185016A1 WO2016185016A1 PCT/EP2016/061420 EP2016061420W WO2016185016A1 WO 2016185016 A1 WO2016185016 A1 WO 2016185016A1 EP 2016061420 W EP2016061420 W EP 2016061420W WO 2016185016 A1 WO2016185016 A1 WO 2016185016A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- seq
- antibody
- polypeptide
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70532—B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/624—Disulfide-stabilized antibody (dsFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
Definitions
- T cell targets include OX40, CTLA-4 and CD137, in particular human OX40, CTLA-4 and CD137.
- Cancer is a leading cause of premature deaths in the developed world.
- Immunotherapy of cancer aims to mount an effective immune response against tumour cells. This may be achieved by, for example, breaking tolerance against tumour antigen, augmenting antitumor immune responses, and stimulating local cytokine responses at the tumor site.
- the key effector cell of a long lasting anti-tumor immune response is the activated tumor specific effector T cell. Potent expansion of activated effector T cells can redirect the immune response towards the tumor.
- regulatory T cells (Treg) play a role in inhibiting the anti-tumor immunity. Depleting, inhibiting, reverting or inactivating Tregs may therefore provide anti-tumor effects and revert the immune suppression in the tumor microenvironment.
- NK cells play an important role in tumor immunology by attacking tumor cells with down-regulated human leukocyte antigen (HLA) expression and by inducing antibody dependent cellular cytotoxicity (ADCC). Stimulation of NK cells may thus also reduce tumor growth.
- HLA human leukocyte antigen
- ADCC antibody dependent cellular cytotoxicity
- OX40 (otherwise known as CD134 or TNFRSF4) is a member of the TNFR family that is expressed mainly on activated T cells (mostly CD4+ effector T cells, but also CD8+ effector T-cells and regulatory T cells (Tregs)). In mice the expression is constitutive on Tregs, but not in humans. OX40 expression typically occurs within 24 hours of activation (T cell receptor engagement) and peaks after 48-72 hours. OX40 stimulation is important for the survival and proliferation of activated T cells.
- the only known ligand for OX40 is OX40L, which is mainly expressed on antigen presenting cells, such as dendritic cells and B cells, typically following their activation.
- OX40-mediated T cell activation is the induction of a TH1 effector T cell activation profile and a reduction in the activity and/or numbers of Treg cells e.g. via ADCC or ADCP. Overall these effects may contribute to anti-tumor immunity.
- OX40 is overexpressed on regulatory T cells in many solid tumors, such as melanoma, lung cancer and renal cancer.
- OX40 agonist treatment of tumor models in mice has been shown to result in anti-tumor effects and cure of several different cancer forms, including melanoma, glioma, sarcoma, prostate, colon and renal cancers.
- CD137 (4-1 BB, TNFRSF9) is also a member of the TNFR family. Activation of CD137 is dependent on receptor oligomerization. CD137 is expressed on activated CD4+ and CD8+ T cells, Treg, DC, monocytes, mast cells and eosinophils. CD137 activation plays an important role in CD8+ T cell activation and survival. It sustains and augments, rather than initiates effector functions and preferentially supports TH1 cytokine production.
- CD137 stimulation initially results in activation and later in activation-induced cell death, which may explain why CD137 agonistic antibodies have shown therapeutic effect in tumor immunity as well as in autoimmunity.
- CD137 also suppresses Treg function.
- CD137 is upregulated on NK cells activated by cytokines or CD 6. Activation of CD137 on NK cells has been shown to increase ADCC activity of NK cells in both murine and human cells. Further, CD137 is expressed on antigen presenting cells, such as dendritic cells and macrophages, and stimulation of CD137 on these cell types may induce immune activation that can result in tumor directed immunity.
- CD137 agonistic antibody has also been shown to activate endothelial cells in the tumor environment, leading to upregulation of ICAM-1 and VCAM-1 and improved T cell recruitment.
- agonistic CD137 antibodies Two CD137 antibodies are in clinical development.
- Urelumab (BMS-66513) is a fully human lgG4 antibody developed by Bristol-Myers Squibb.
- phase I and II studies in various indications are currently ongoing.
- a Phase II study with Urelumab as a second line therapy in metastatic melanoma was terminated in 2009 due to fatal hepatoxicity.
- the other CD137 mAb in clinical development is PF-05082566, a fully human lgG2 antibody developed by Pfizer. It is currently in phase I development in lymphoma and various solid cancers and preliminary data suggest that it is well tolerated but with only modest antitumor effects.
- T cell receptor CTLA-4 serves as a negative regulator of T cell activation, and is upregulated on the T-cell surface following initial activation.
- the ligands of the CTLA-4 receptor which are expressed by antigen presenting cells are the B7 proteins.
- the corresponding ligand receptor pair that is responsible for the upregulation of T cell activation is CD28 - B7.
- CD28 constitutes a costimulatory pathway, and follows upon the activation of T cells, through the T cell receptor recognizing antigenic peptide presented by the MHC complex.
- T cells By blocking the CTLA-4 interaction to the B7-1 and, or B7-2 ligands, one of the normal check points of the immune response may be removed.
- the net result is enhanced activity of effector T cells which may contribute to anti-tumour immunity. As with OX40, this may be due to direct activation of the effector T cells but may also be due to a reduction in the activity and/or numbers of Treg cells, e.g. via ADCC or ADCP.
- CTLA-4 blockade generates anti-tumor effects, but administration of anti-CTLA-4 antibodies has been associated with toxic side-effects.
- CTLA-4 is overexpressed on regulatory T cells in many solid tumors, such as melanoma lung cancer and renal cancer.
- a first aspect of the invention provides a bispecific polypeptide comprising a first binding domain, designated B1 , which is capable of specifically binding to a first T cell target, and a second binding domain, designated B2, which is capable of specifically binding to a second T cell target, wherein the first and second T cell targets are different targets.
- bispecific antibodies targeting two different T cell targets have the potential to specifically activate the immune system in locations were both targets are over expressed.
- CTLA-4 and OX40 are overexpressed on regulatory T cells (Treg) in the tumor microenvironment, whereas their expression on effector T cells is lower.
- the bispecific antibodies of the invention have the potential to selectively target regulatory T cells in the tumor microenvironment.
- Targeting Treg cells in the tumor microenvironment with a bispecific antibody of the invention also has the potential to deplete or reverse the immune suppressive function of the Tregs.
- This effect could be mediated by ADCC or ADCP induction via the Fc part of the bispecific antibody of the invention (for example, see Furness ei a/., 2014 Trends Immunol 35(7):290-8; the disclosures of which are incorporated herein by reference) or by signaling induced via OX40 and/or CTLA-4 and/or by blocking the CTLA-4 signaling pathway (for example, see Walker, 2014, Nature Reviews 11( 2):852-63; the disclosures of which are incorporated herein by reference).
- the bispecific antibodies of the invention On effector T cells, on the other hands, have the potential to induce activation and increased function both via OX40 stimulation and through CTLA-4 checkpoint blockade.
- the immune activation is higher than the combination of the monospecific antibodies.
- the bispecific polypeptide is capable of binding specifically to:
- polypeptide is used herein in its broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs, or other peptidomimetics.
- polypeptide thus includes short peptide sequences and also longer polypeptides and proteins.
- amino acid refers to either natural and/or unnatural or synthetic amino acids, including both D or L optical isomers, and amino acid analogs and peptidomimetics.
- bispecific as used herein means the polypeptide is capable of specifically binding at least two target entities.
- first and/or second binding domains may be selected from the group consisting of: antibodies or antigen-binding fragments thereof.
- the bispecific polypeptide of the invention may comprise:
- polypeptide is a bispecific antibody.
- antibody refers to molecules that contain an antigen binding site, e.g. immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules that contain an antigen binding site.
- Immunoglobulin molecules can be of any type ⁇ e.g. IgG, IgE, IgM, IgD, IgA and IgY), class (e.g. lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2) or a subclass of immunoglobulin molecule.
- Antibodies include, but are not limited to, synthetic antibodies, monoclonal antibodies, single domain antibodies, single chain antibodies, recombinantly produced antibodies, multi-specific antibodies (including bi-specific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, scFvs (e.g. including mono-specific and bi-specific, etc.), Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), anti-idiotypic (anti-Id) antibodies, and epitope-binding fragments of any of the above.
- synthetic antibodies monoclonal antibodies, single domain antibodies, single chain antibodies, recombinantly produced antibodies, multi-specific antibodies (including bi-specific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, scFvs (e.g. including mono-specific and bi-specific, etc.), Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), anti-idiotyp
- antibody “directed to” or “directed against are used interchangeably herein and refer to an antibody that is constructed to direct its binding specificity(ies) at a certain target/marker/epitope/antigen, i.e. an antibody that immunospecifically binds to a target/marker/epitope/antigen.
- the expression antibodies “selective for” a certain target/marker/epitope may be used, having the same definition as “directed to” or “directed against'.
- a bi-specific antibody directed to (selective for) two different targets/ markers/epitopes/antigens binds immunospecifically to both targets/markers/epitopes/ antigens. If an antibody is directed to a certain target antigen, such as CD137, it is thus assumed that said antibody could be directed to any suitable epitope present on said target antigen structure.
- antibody fragment is a portion of an antibody such as F(ab').sub.2, F(ab).sub.2, Fab', Fab, Fv, scFv and the like. Regardless of structure, an antibody fragment binds with the same antigen that is recognized by the intact antibody. For example, an anti-OX4 antibody fragment binds to OX40.
- antibody fragment also includes isolated fragments consisting of the variable regions, such as the "Fv” fragments consisting of the variable regions of the heavy and light chains and recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker ("scFv proteins"). As used herein, the term “antibody fragment” does not include portions of antibodies without antigen binding activity, such as Fc fragments or single amino acid residues.
- ScFv are particularly preferred for inclusion in the bispecific antibodies of the invention.
- bispecific antibodies of the invention are provided:
- binding domain B1 and/or binding domain B2 is an intact IgG antibody (or, together, form an intact IgG antibody);
- binding domain B1 and/or binding domain B2 is an Fv fragment (e.g. an scFv);
- binding domain B1 and/or binding domain B2 is a Fab fragment; and/or (d) binding domain B1 and/or binding domain B2 is a single domain antibody (e.g. domain antibodies and nanobodies).
- bispecific polypeptides of the invention may be of several different structural formats (for example, see Chan & Carter, 2016, Nature Reviews Immunology 10, 301-316, the disclosures of which are incorporated herein by reference).
- the bispecific antibody is selected from the groups consisting of:
- bivalent bispecific antibodies such as IgG-scFv bispecific antibodies (for example, wherein B1 is an intact IgG and B2 is an scFv attached to B1 at the N-terminus of a light chain and/or at the C-terminus of a light chain and/or at the N-terminus of a heavy chain and/or at the C-terminus of a heavy chain of the IgG, or vice versa);
- bispecific antibodies such as a DuoBody ® (Genmab AS, Copenhagen, Denmark) or 'knob-in-hole' bispecific antibody (for example, an scFv-KIH, scFv-KIH r , a BiTE-KIH or a BiTE- KIH r (see Xu et a/., 2015, mAbs 7(1 ):231-242);
- scFv2-Fc bispecific antibodies such as ADAPTIRTM bispecific antibodies from
- DART-based bispecific antibodies for example, DART 2 -Fc, DART 2 -Fc or DART
- the bispecific antibody may be an IgG-scFv antibody.
- the IgG-scFv antibody may be in either VH-VL or VL-VH orientation.
- the scFv may be stabilised by a S-S bridge between VH and VL.
- binding domain B1 and binding domain B2 are fused directly to each other.
- binding domain B1 and binding domain B2 are joined via a polypeptide linker.
- a polypeptide linker may be a short linker peptide between about 10 to about 25 amino acids.
- the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa.
- Exemplary linkers include a peptide of amino acid sequence as shown in any one of SEQ ID NOs. 47 to 50, or 144.
- the peptide of sequence GGGGSGGGGSGGGGS (SEQ ID NO: 144) is particularly preferred.
- the same linkers may be used to join the anti-OX40 part of a bispecific antibody of the invention to the anti-CD137 part.
- the bispecific polypeptides of the invention may be manufactured by any known suitable method used in the art.
- Methods of preparing bi-specific antibodies of the present invention include BiTE (Micromet), DART (MacroGenics), Fcab and Mab 2 (F-star), Fc- engineered IgGI (Xencor) or DuoBody (based on Fab arm exchange, Genmab).
- Examples of other platforms useful for preparing bi-specific antibodies include but are not limited to those described in WO 2008/119353 (Genmab), WO 2011/131746 (Genmab) and reported by van der Neut- Kolfschoten et al. (2007, Science 317(5844): 1554-7).
- the bispecific antibody may comprise a human Fc region, or a variant of a said region, where the region is an lgG1 , lgG2, lgG3 or lgG4 region, preferably an lgG1 or lgG4 region.
- the constant (Fc) regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- the Fc region is preferably a human Fc region, or a variant of a said region.
- the Fc region may be an lgG1 , lgG2, lgG3 or lgG4 region, preferably an lgG1 or lgG4 region.
- a variant of an Fc region typically binds to Fc receptors, such as FcgammaR and/or neonatal Fc receptor (FcRn) with altered affinity providing for improved function and/or half-life of the polypeptide.
- the biological function and/ or the half-life may be either increased or a decreased relative to the half-life of a polypeptide comprising a native Fc region.
- Examples of such biological functions which may be modulated by the presence of a variant Fc region include antibody dependent cell cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), complement-dependent cytotoxicity (CDC), and/or apoptosis.
- ADCC antibody dependent cell cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- CDC complement-dependent cytotoxicity
- An exemplary heavy chain constant region amino acid sequence which may be combined with any VH region sequence disclosed herein (to form a complete heavy chain) is the lgG1 heavy chain constant region sequence reproduced here:
- lgG4 constant region such as that reproduced here:
- This modified lgG4 sequence exhibits reduced FcRn binding and hence results in a reduced serum half-life relative to wild type lgG4. In addition, it exhibits stabilization of the core hinge of lgG4 making the lgG4 more stable, preventing Fab arm exchange.
- Another preferred constant region is a modified lgG4 constant region such as that reproduced here: ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSWTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLG GPSVFLFPPKPKDTLMISRTPEVTCVWDVSQEDPEVQFNWYVDGVEVHNAKTKPREE QFNSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPP SQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
- This modified lgG4 sequence results in stabilization of the core hinge of lgG4 making the lgG4 more stable, preventing Fab arm exchange
- lgG4 constant region such as that reproduced here:
- the antibody, or antigen binding fragment thereof has certain preferred binding characteristics and functional effects, which are explained in more detail below. Said antibody, or antigen binding fragment thereof, preferably retains these binding characteristics and functional effects when incorporated as part of a bispecific polypeptide of the invention.
- the antigen-binding fragment may be selected from the group consisting of: an Fv fragment (such as a single chain Fv fragment, or a disulphide-bonded Fv fragment), a Fab-like fragment (such as a Fab fragment; a Fab' fragment or a F(ab) 2 fragment) and domain antibodies.
- the bispecific polypeptide may be an lgG1 antibody with a non- immunoglobulin polypeptide (such as a CTLA-4 binding domain, e.g. CD86 or a mutated form thereof such as SEQ ID NO: 17; see below) fused to the C-terminal part of the kappa chain.
- a non- immunoglobulin polypeptide such as a CTLA-4 binding domain, e.g. CD86 or a mutated form thereof such as SEQ ID NO: 17; see below
- the bispecific polypeptide may be an lgG1 antibody with a scFv fragment fused to the C-terminal end of the heavy gamma 1 chain. In one embodiment the bispecific polypeptide may contain 2-4 scFv binding to two different targets.
- T cell target we include polypeptide receptors located in the cell membrane of CD3+ T cells in an activated or inactive state. Such membrane-bound receptors may be exposed extracellularly in order that they accessed by the bispecific polypeptides of the invention following administration.
- the T cell targets may be localised on the surface of a cell.
- localised on the surface of a cell it is meant that the T cell target is associated with the cell such that one or more region of the T cell target is present on the outer face of the cell surface.
- the T cell target may be inserted into the cell plasma membrane (i.e. orientated as a transmembrane protein) with one or more regions presented on the extracellular surface. This may occur in the course of expression of the T cell target by the cell.
- "localised on the surface of a cell” may mean “expressed on the surface of a cell.”
- the T cell target may be outside the cell with covalent and/or ionic interactions localising it to a specific region or regions of the cell surface.
- the first and/or second T cell target may be a checkpoint molecule.
- the first and/or second T cell target is a co-stimulatory or co- inhibitory molecule.
- co-stimulatory we include co-signalling molecules which are capable of promoting T cell activation.
- co-inhibitory we include co-signalling molecules which are capable of supressing T cell activation.
- at least one of the T cell targets may be a stimulatory checkpoint molecule (such as CD137, GITR, CD27, CD28, ICOS and OX40).
- the bispecific polypeptide of the invention is an agonist at a stimulatory checkpoint molecule.
- At least one of the T cell targets may be an inhibitory checkpoint molecule (such as CTLA-4, PD-1 , Tim3, Lag3, Tigit or VISTA).
- the bispecific polypeptide of the invention is an antagonist at an inhibitory checkpoint molecule.
- at least one of the T cell targets is a TNFR (tumor necrosis factor receptor) superfamily member.
- TNFR superfamily member we include cytokine receptors characterised by the ability to bind tumor necrosis factors (TNFs) via an extracellular cysteine-rich domain. Examples of TNFRs include OX40 and CD137.
- the first and/or second T cell target may be selected from the group consisting of: OX40, CTLA-4, CD137, CD40 and CD28.
- the first and/or second T cell target may be selected from the group consisting of OX40, CTLA-4 and CD137.
- the bispecific antibodies of the invention may be capable of inducing antibody dependent cell cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), complement-dependent cytotoxicity (CDC), and/or apoptosis.
- the polypeptide is capable of inducing tumour immunity. This can be tested in vitro in T cell activation assays, e.g. by measuring. IL-2 and IFNy production.
- the antibody may modulate the activity of a cell expressing the T cell target, wherein said modulation is an increase or decrease in the activity of said cell.
- the cell is typically a T cell.
- the antibody may increase the activity of a CD4+ or CD8+ effector cell, or may decrease the activity of a regulatory T cell (Treg). In either case, the net effect of the antibody will be an increase in the activity of effector T cells, particularly CD4+ effector T cells.
- Methods for determining a change in the activity of effector T cells include, for example, measuring for an increase in the level of T cell IL-2 production or an increase in T cell proliferation in the presence of the antibody relative to the level of T cell IL-2 production and/or T cell proliferation in the presence of a control.
- Assays for cell proliferation and/or IL-2 production are well known and are exemplified in the Examples.
- Standard assays to evaluate the binding ability of ligands towards targets are well known in the art, including for example, ELISAs, Western blots, RIAs, and flow cytometry analysis.
- the binding kinetics (e.g., binding affinity) of the polypeptide also can be assessed by standard assays known in the art, such as by Surface Plasmon Resonance analysis (SPR).
- SPR Surface Plasmon Resonance analysis
- binding activity and "binding affinity” are intended to refer to the tendency of a polypeptide molecule to bind or not to bind to a target. Binding affinity may be quantified by determining the dissociation constant (Kd) for a polypeptide and its target. A lower Kd is indicative of a higher affinity for a target. Similarly, the specificity of binding of a polypeptide to its target may be defined in terms of the comparative dissociation constants (Kd) of the polypeptide for its target as compared to the dissociation constant with respect to the polypeptide and another, non-target molecule.
- Kd dissociation constant
- this dissociation constant can be determined directly by well-known methods, and can be computed even for complex mixtures by methods such as those, for example, set forth in Caceci ei a/. (Byte 9:340-362, 1984; the disclosures of which are incorporated herein by reference).
- the Kd may be established using a double-filter nitrocellulose filter binding assay such as that disclosed by Wong & Lohman (Proc. Natl. Acad. Sci. USA 90, 5428-5432, 1993).
- Other standard assays to evaluate the binding ability of ligands such as antibodies towards targets are known in the art, including for example, ELISAs, Western blots, RIAs, and flow cytometry analysis.
- the binding kinetics (e.g., binding affinity) of the antibody also can be assessed by standard assays known in the art, such as by BiacoreTM system analysis.
- a competitive binding assay can be conducted in which the binding of the antibody to the target is compared to the binding of the target by another, known ligand of that target, such as another antibody.
- the concentration at which 50% inhibition occurs is known as the Ki.
- the Ki is equivalent to Kd. The Ki value will never be less than the Kd, so measurement of Ki can conveniently be substituted to provide an upper limit for Kd.
- EC50 indicates the concentration at which a polypeptide achieves 50% of its maximum binding to a fixed quantity of target.
- IC50 indicates the concentration at which a polypeptide inhibits 50% of the maximum binding of a fixed quantity of competitor to a fixed quantity of target. In both cases, a lower level of EC50 or IC50 indicates a higher affinity for a target.
- the EC50 and IC50 values of a ligand for its target can both be determined by well-known methods, for example ELISA. Suitable assays to assess the EC50 and IC50 of polypeptides are set out in the Examples.
- a polypeptide of the invention is preferably capable of binding to its target with an affinity that is at least two-fold, 10-fold, 50-fold, 100-fold or greater than its affinity for binding to another non-target molecule.
- the polypeptide of the invention may be produced by any suitable means.
- all or part of the polypeptide may be expressed as a fusion protein by a cell comprising a nucleotide which encodes said polypeptide.
- parts B1 and B2 may be produced separately and then subsequently joined together. Joining may be achieved by any suitable means, for example using the chemical conjugation methods and linkers outlined above. Separate production of parts B1 and B2 may be achieved by any suitable means. For example by expression from separate nucleotides optionally in separate cells, as is explained in more detail below. Variants
- the bispecific polypeptides or constituent binding domains thereof may comprise a variant or a fragment of any of the specific amino acid sequences recited herein, provided that the polypeptide or binding domain retains binding to its target.
- the variant of an antibody or antigen binding fragment may retain the CDR sequences of the sequences recited herein.
- the anti-OX40 or anti-CD137 antibody may comprise a variant or a fragment of any of the specific amino acid sequences recited in Tables B and H, provided that the antibody retains binding to its target.
- Such a variant or fragment may typically retain the CDR sequences of the said sequence of Table B or H.
- the CTLA-4 binding domain may comprise a variant of any of the sequences of Table C, providing that that the binding domain retains binding to its target.
- a fragment of any one of the heavy or light chain amino acid sequences recited herein may comprise at least 7, at least 8, at least 9, at least 10, at least 12, at least 15, at least 18, at least 20, at least 25, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 consecutive amino acids from the said amino acid sequence.
- a variant of any one of the heavy or light chain amino acid sequences recited herein may be a substitution, deletion or addition variant of said sequence.
- a variant may comprise 1 , 2, 3, 4, 5, up to 10, up to 20, up to 30 or more amino acid substitutions and/or deletions from the said sequence.
- “Deletion” variants may comprise the deletion of individual amino acids, deletion of small groups of amino acids such as 2, 3, 4 or 5 amino acids, or deletion of larger amino acid regions, such as the deletion of specific amino acid domains or other features.
- “Substitution” variants preferably involve the replacement of one or more amino acids with the same number of amino acids and making conservative amino acid substitutions.
- an amino acid may be substituted with an alternative amino acid having similar properties, for example, another basic amino acid, another acidic amino acid, another neutral amino acid, another charged amino acid, another hydrophilic amino acid, another hydrophobic amino acid, another polar amino acid, another aromatic amino acid or another aliphatic amino acid.
- an alternative amino acid having similar properties, for example, another basic amino acid, another acidic amino acid, another neutral amino acid, another charged amino acid, another hydrophilic amino acid, another hydrophobic amino acid, another polar amino acid, another aromatic amino acid or another aliphatic amino acid.
- Amino acids herein may be referred to by full name, three letter code or single letter code.
- derivatives or “variants” include those in which instead of the naturally occurring amino acid the amino acid which appears in the sequence is a structural analog thereof.
- Amino acids used in the sequences may also be derivatised or modified, e.g. labelled, providing the function of the antibody is not significantly adversely affected.
- Derivatives and variants as described above may be prepared during synthesis of the antibody or by post- production modification, or when the antibody is in recombinant form using the known techniques of site- directed mutagenesis, random mutagenesis, or enzymatic cleavage and/or ligation of nucleic acids.
- variants have an amino acid sequence which has more than 60%, or more than 70%, e.g. 75 or 80%, preferably more than 85%, e.g. more than 90 or 95% amino acid identity to a sequence as shown in the sequences disclosed herein. This level of amino acid identity may be seen across the full length of the relevant SEQ ID NO sequence or over a part of the sequence, such as across 20, 30, 50, 75, 100, 150, 200 or more amino acids, depending on the size of the full length polypeptide.
- sequence identity refers to sequences which have the stated value when assessed using ClustalW (Thompson et a/., 1994, Nucleic Acids Res. 22(22);4673-80; the disclosures of which are incorporated herein by reference) with the following parameters:
- Pairwise alignment parameters -Method accurate, Matrix: PAM, Gap open penalty: 10.00, Gap extension penalty: 0.10;
- the invention also relates to polynucleotides that encode all or part of a polypeptide of the invention.
- a polynucleotide of the invention may encode any polypeptide as described herein, or all or part of B1 or all or part of B2.
- the terms "nucleic acid molecule” and “polynucleotide” are used interchangeably herein and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- Non-limiting examples of polynucleotides include a gene, a gene fragment, messenger RNA (mRNA), cDNA, recombinant polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- a polynucleotide of the invention may be provided in isolated or substantially isolated form. By substantially isolated, it is meant that there may be substantial, but not total, isolation of the polypeptide from any surrounding medium.
- the polynucleotides may be mixed with carriers or diluents which will not interfere with their intended use and still be regarded as substantially isolated.
- a nucleic acid sequence which "encodes" a selected polypeptide is a nucleic acid molecule which is transcribed (in the case of DNA) and translated (in the case of mRNA) into a polypeptide in vivo when placed under the control of appropriate regulatory sequences.
- the boundaries of the coding sequence are determined by a start codon at the 5' (amino) terminus and a translation stop codon at the 3' (carboxy) terminus.
- such nucleic acid sequences can include, but are not limited to, cDNA from viral, prokaryotic or eukaryotic mRNA, genomic sequences from viral or prokaryotic DNA or RNA, and even synthetic DNA sequences.
- a transcription termination sequence may be located 3' to the coding sequence.
- Representative polynucleotides which encode examples of a heavy chain or light chain amino acid sequence of an antibody may comprise or consist of any one of the nucleotide sequences disclosed herein, for example the sequences set out in Table B or H.
- Representative polynucleotides which encode the polypeptides shown in Tables D, G or H may comprise or consist of the corresponding nucleotide sequences which are also shown in Tables D, G or H (intron sequences are shown in lower case).
- Representative polynucleotides which encode examples of CTLA-4 binding domains may comprise or consist of any one of SEQ ID NOS: 25 to 43 as shown in Table E.
- a suitable polynucleotide sequence may alternatively be a variant of one of these specific polynucleotide sequences.
- a variant may be a substitution, deletion or addition variant of any of the above nucleic acid sequences.
- a variant polynucleotide may comprise 1 , 2, 3, 4, 5, up to 10, up to 20, up to 30, up to 40, up to 50, up to 75 or more nucleic acid substitutions and/or deletions from the sequences given in the sequence listing.
- Suitable variants may be at least 70% homologous to a polynucleotide of any one of nucleic acid sequences disclosed herein, preferably at least 80 or 90% and more preferably at least 95%, 97% or 99% homologous thereto.
- homology and identity at these levels is present at least with respect to the coding regions of the polynucleotides.
- Methods of measuring homology are well known in the art and it will be understood by those of skill in the art that in the present context, homology is calculated on the basis of nucleic acid identity. Such homology may exist over a region of at least 15, preferably at least 30, for instance at least 40, 60, 00, 200 or more contiguous nucleotides. Such homology may exist over the entire length of the unmodified polynucleotide sequence.
- the PILEUP and BLAST algorithms can also be used to calculate homology or line up sequences (typically on their default settings), for example as described in Altschul, 1993, J Mol Evol 36:290-300; Altschul et al, 1990, J Mol 6/0/215:403-10, the disclosures of which are incorporated herein by reference).
- HSPs high scoring sequence pair
- Extensions for the word hits in each direction are halted when: the cumulative alignment score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm performs a statistical analysis of the similarity between two sequences; see e.g. Karlin & Altschul, 1993, Proc. Natl. Acad. Sci. USA 90:5873-5787; the disclosures of which are incorporated herein by reference.
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a sequence is considered similar to another sequence if the smallest sum probability in comparison of the first sequence to the second sequence is less than about 1 , preferably less than about 0.1 , more preferably less than about 0.01 , and most preferably less than about 0.001.
- the homologue may differ from a sequence in the relevant polynucleotide by less than 3, 5, 10, 15, 20 or more mutations (each of which may be a substitution, deletion or insertion). These mutations may be measured over a region of at least 30, for instance at least 40, 60 or 100 or more contiguous nucleotides of the homologue.
- a variant sequence may vary from the specific sequences given in the sequence listing by virtue of the redundancy in the genetic code.
- the DNA code has 4 primary nucleic acid residues (A, T, C and G) and uses these to "spell" three letter codons which represent the amino acids the proteins encoded in an organism's genes.
- the linear sequence of codons along the DNA molecule is translated into the linear sequence of amino acids in the protein(s) encoded by those genes.
- the code is highly degenerate, with 61 codons coding for the 20 natural amino acids and 3 codons representing "stop" signals. Thus, most amino acids are coded for by more than one codon - in fact several are coded for by four or more different codons.
- a variant polynucleotide of the invention may therefore encode the same polypeptide sequence as another polynucleotide of the invention, but may have a different nucleic acid sequence due to the use of different codons to encode the same amino acids.
- a polypeptide of the invention may thus be produced from or delivered in the form of a polynucleotide which encodes and is capable of expressing it.
- Polynucleotides of the invention can be synthesised according to methods well known in the art, as described by way of example in Green & Sambrook (2012, Molecular Cloning - a laboratory manual, 4 th edition; Cold Spring Harbor Press; the disclosures of which are incorporated herein by reference).
- the nucleic acid molecules of the present invention may be provided in the form of an expression cassette which includes control sequences operably linked to the inserted sequence, thus allowing for expression of the polypeptide of the invention in vivo.
- These expression cassettes are typically provided within vectors (e.g., plasmids or recombinant viral vectors).
- vectors e.g., plasmids or recombinant viral vectors.
- Such an expression cassette may be administered directly to a host subject.
- a vector comprising a polynucleotide of the invention may be administered to a host subject.
- the polynucleotide is prepared and/or administered using a genetic vector.
- a suitable vector may be any vector which is capable of carrying a sufficient amount of genetic information, and allowing expression of a polypeptide of the invention.
- the present invention thus includes expression vectors that comprise such polynucleotide sequences.
- Such expression vectors are routinely constructed in the art of molecular biology and may for example involve the use of plasmid DNA and appropriate initiators, promoters, enhancers and other elements, such as for example polyadenylation signals which may be necessary, and which are positioned in the correct orientation, in order to allow for expression of a peptide of the invention.
- Other suitable vectors would be apparent to persons skilled in the art (see Green & Sambrook, supra).
- the invention also includes cells that have been modified to express a polypeptide of the invention.
- Such cells include transient, or preferably stable higher eukaryotic cell lines, such as mammalian cells or insect cells, lower eukaryotic cells, such as yeast or prokaryotic cells such as bacterial cells.
- eukaryotic cell lines such as mammalian cells or insect cells
- lower eukaryotic cells such as yeast or prokaryotic cells
- bacterial cells such as bacterial cells.
- cells which may be modified by insertion of vectors or expression cassettes encoding for a polypeptide of the invention include mammalian HEK293T, CHO, HeLa, NS0 and COS cells.
- the cell line selected will be one which is not only stable, but also allows for mature glycosylation and cell surface expression of a polypeptide.
- Such cell lines of the invention may be cultured using routine methods to produce a polypeptide of the invention, or may be used therapeutically or prophylactically to deliver antibodies of the invention to a subject.
- polynucleotides, expression cassettes or vectors of the invention may be administered to a cell from a subject ex v/vo and the cell then returned to the body of the subject.
- the present invention provides compositions comprising molecules of the invention, such as the antibodies, bispecific polypeptides, polynucleotides, vectors and cells described herein.
- the invention provides a composition comprising one or more molecules of the invention, such as one or more antibodies and/or bispecific polypeptides of the invention, and at least one pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier is suitable for parenteral, e.g. intravenous, intramuscular or subcutaneous administration (e.g., by injection or infusion).
- the polypeptide may be coated in a material to protect the polypeptide from the action of acids and other natural conditions that may inactivate or denature the polypeptide.
- Preferred pharmaceutically acceptable carriers comprise aqueous carriers or diluents.
- aqueous carriers examples include water, buffered water and saline.
- suitable aqueous carriers include water, buffered water and saline.
- suitable aqueous carriers include ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- a composition of the invention also may include a pharmaceutically acceptable antioxidant.
- These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
- Sterile injectable solutions can be prepared by incorporating the active agent (e.g. polypeptide) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active agent into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active agent plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- compositions are formulated for systemic administration or for local administration.
- Local administration may be at the site of a tumour or into a tumour draining lymph node.
- the composition may preferably be formulated for sustained release over a period of time.
- the composition may be provided in or as part of a matrix facilitating sustained release.
- Preferred sustained release matrices may comprise a montanide or ⁇ -polyglutamic acid (PGA) nanoparticles.
- Localised release of a polypeptide of the invention, optionally over a sustained period of time may reduce potential autoimmune side-effects associated with administration of a CTLA-4 antagonist.
- compositions of the invention may comprise additional active ingredients as well as a polypeptide of the invention.
- compositions of the invention may comprise one or more polypeptides of the invention. They may also comprise additional therapeutic or prophylactic agents.
- kits comprising polypeptides or other compositions of the invention and instructions for use.
- the kit may further contain one or more additional reagents, such as an additional therapeutic or prophylactic agent as discussed above.
- additional reagents such as an additional therapeutic or prophylactic agent as discussed above.
- the polypeptides in accordance with the present invention maybe used in therapy or prophylaxis.
- polypeptides or compositions are administered to a subject already suffering from a disorder or condition, in an amount sufficient to cure, alleviate or partially arrest the condition or one or more of its symptoms.
- Such therapeutic treatment may result in a decrease in severity of disease symptoms, or an increase in frequency or duration of symptom-free periods.
- An amount adequate to accomplish this is defined as "therapeutically effective amount”.
- polypeptides or compositions are administered to a subject not yet exhibiting symptoms of a disorder or condition, in an amount sufficient to prevent or delay the development of symptoms. Such an amount is defined as a "prophylactically effective amount".
- the subject may have been identified as being at risk of developing the disease or condition by any suitable means.
- antibodies and bispecific polypeptides of the invention may be useful in the treatment or prevention of cancer.
- the invention provides an antibody or bispecific polypeptide of the invention for use in the treatment or prevention of cancer.
- the invention also provides a method of treating or preventing cancer comprising administering to an individual a polypeptide of the invention.
- the invention also provides an antibody or bispecific polypeptide of the invention for use in the manufacture of a medicament for the treatment or prevention of cancer.
- the cancer may be prostate cancer, breast cancer, colorectal cancer, pancreatic cancer, ovarian cancer, lung cancer, cervical cancer, rhabdomyosarcoma, neuroblastoma, multiple myeloma, leukemia, acute lymphoblastic leukemia, melanoma, bladder cancer, gastric cancer, head and neck cancer, liver cancer, skin cancer, lymphoma or glioblastoma.
- An antibody or bispecific polypeptide of the present invention, or a composition comprising said antibody or said polypeptide may be administered via one or more routes of administration using one or more of a variety of methods known in the art.
- the route and/or mode of administration will vary depending upon the desired results.
- Systemic administration or local administration are preferred.
- Local administration may be at the site of a tumour or into a tumour draining lymph node.
- Preferred modes of administration for polypeptides or compositions of the invention include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral modes of administration, for example by injection or infusion.
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection.
- a polypeptide or composition of the invention can be administered via a non-parenteral mode, such as a topical, epidermal or mucosal mode of administration.
- a suitable dosage of an antibody or polypeptide of the invention may be determined by a skilled medical practitioner. Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular polypeptide employed, the route of administration, the time of administration, the rate of excretion of the polypeptide, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- a suitable dose of an antibody or polypeptide of the invention may be, for example, in the range of from about 0.1 g/kg to about 100mg/kg body weight of the patient to be treated.
- a suitable dosage may be from about 1 Mg/kg to about 10mg/kg body weight per day or from about 10 g/kg to about 5 mg/kg body weight per day.
- Dosage regimens may be adjusted to provide the optimum desired response ⁇ e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- Antibodies or polypeptides may be administered in a single dose or in multiple doses.
- the multiple doses may be administered via the same or different routes and to the same or different locations.
- antibodies or polypeptides can be administered as a sustained release formulation as described above, in which case less frequent administration is required.
- Dosage and frequency may vary depending on the half-life of the polypeptide in the patient and the duration of treatment that is desired.
- the dosage and frequency of administration can also vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage may be administered at relatively infrequent intervals over a long period of time. In therapeutic applications, a relatively high dosage may be administered, for example until the patient shows partial or complete amelioration of symptoms of disease.
- the antibody or polypeptide and the other agent may be administered together in a single composition.
- the antibody or polypeptide and the other agent may be administered in separate compositions as part of a combined therapy.
- the modulator may be administered before, after or concurrently with the other agent.
- An antibody, polypeptide or composition of the invention may also be used in a method of increasing the activation of a population of cells expressing the first and second T cell target, the method comprising administering to said population of cells a polypeptide or composition of the invention under conditions suitable to permit interaction between said cell and a polypeptide of the invention.
- the population of cells typically comprises at least some cells which express the first T cell target, typically T cells, and at least some cells which express the second T cell target.
- the method is typically carried out ex vivo.
- an antibody, polypeptide or composition of the invention may also be used in a method of increasing the activation of a population of cells expressing human OX40 and human CTLA-4, the method as described above.
- an antibody, polypeptide or composition of the invention may also be used in a method of increasing the activation of a population of cells expressing human OX40 and human CD137, the method as described above.
- an antibody, polypeptide or composition of the invention may also be used in a method of increasing the activation of a population of cells expressing human CTLA-4 and human CD137, the method as described above.
- the bispecific polypeptides of the invention may comprise a binding domain which is specific for CD137.
- the antibody, or antigen binding fragment thereof, that binds specifically to CD137 has certain preferred binding characteristics and functional effects, which are explained in more detail below. Said antibody, or antigen binding fragment thereof, preferably retains these binding characteristics and functional effects when incorporated as part of a bispecific antibody of the invention.
- the invention also provides said antibody as an antibody or antigen-binding fragment thereof in isolated form, i.e. independently of a bispecific antibody of the invention.
- the anti-CD137 antibody preferably specifically binds to CD137, i.e. it binds to CD137 but does not bind, or binds at a lower affinity, to other molecules.
- CD137 typically refers to human CD137.
- the sequence of human CD137 is set out in SEQ ID NO: 148 (corresponding to GenBank: AAH06196.1 ).
- the antibody may have some binding affinity for CD137 from other mammals, such as CD137 from a non-human primate, for example Macaca fascicularis (cynomolgus monkey).
- the antibody preferably does not bind to murine CD137 and/or does not bind to other human TNFR superfamily members, for example human OX40 or CD40.
- the antibody has the ability to bind to CD137 in its native state and in particular to CD137 localised on the surface of a cell.
- the antibody will bind specifically to CD137. That is, an antibody of the invention will preferably bind to CD137 with greater binding affinity than that at which it binds to another molecule.
- the antibody may modulate the activity of a cell expressing CD137, wherein said modulation is an increase or decrease in the activity of said cell.
- the cell is typically a T cell.
- the antibody may increase the activity of a CD4+ or CD8+ effector cell, or may decrease the activity of, or deplete, a regulatory T cell (T reg). In either case, the net effect of the antibody will be an increase in the activity of effector T cells, particularly CD4+, CD8+ or NK effector T cells.
- T reg regulatory T cell
- the antibody preferably causes an increase in activity in a CD8+ T cell in vitro, optionally wherein said increase in activity is an increase in proliferation, IFN- ⁇ production and/or IL- 2 production by the T cell.
- the increase is preferably at least 2-fold, more preferably at least 10-fold and even more preferably at least 25-fold higher than the change in activity caused by an isotype control antibody measured in the same assay.
- the antibody preferably binds to human CD137 with a Kd value which is less than 10x10 " 9 M or less than 7x10 ⁇ 9 M, more preferably less than 4, or 2x10 "9 M, most preferably less than 1.2x10 "9 M.
- the antibody preferably does not bind to murine CD137 or any other TNFR superfamily member, such as OX40 or CD40. Therefore, typically, the Kd for the antibody with respect to human CD137 will be 2-fold, preferably 5-fold, more preferably 10-fold less than Kd with respect to the other, non-target molecule, such as murine CD137, other TNFR superfamily members, or any other unrelated material or accompanying material in the environment. More preferably, the Kd will be 50-fold less, even more preferably 100-fold less, and yet more preferably 200-fold less.
- This dissociation constant can be determined directly by well-known methods, as described earlier.
- a competitive binding assay can also be conducted, as described earlier.
- An antibody of the invention is preferably capable of binding to its target with an affinity that is at least two-fold, 10-fold, 50-fold, 100-fold or greater than its affinity for binding to another non-target molecule.
- the anti-CD137 antibody preferably exhibits at least one of the following functional characteristics:
- the increase is preferably at least 2-fold, more preferably at least 10-fold and even more preferably at least 25-fold higher than the change in activity caused by an isotype control antibody measured in the same assay.
- the antibody is specific for CD137, typically human CD137 and may comprise any one, two, three, four, five or all six of the exemplary CDR sequences of any corresponding pair of rows in Tables 1(1 ) and l(2).
- the antibody may comprise any one, two, three, four, five or all six of the exemplary CDR sequences of the first rows of Table 1(1) and Table l(2) (SEQ ID NOs: 207, 212, 217, 80, 81 , 222)
- the antibody may comprise any one, two, three, four, five or all six of the exemplary CDR sequences of the second, third, fourth or fifth rows of Tables 1(1 ) and l(2).
- Preferred anti-CD137 antibodies may comprise at least a heavy chain CDR3 as defined in any individual row of Table 1(1 ) and/or a light chain CDR3 as defined in in any individual row of Table l(2).
- the antibody may comprise all three heavy chain CDR sequences shown in an individual row of Table 1(1 ) (that is, all three heavy chain CDRs of a given "VH number") and/or all three light chain CDR sequences shown in an individual row of Table l(2) (that is, all three light chain CDRs of a given "VL number").
- Table H Examples of complete heavy and light chain variable region amino acid sequences of anti- CD137 antibodies are shown in Table H. Exemplary nucleic acid sequences encoding each amino acid sequence are also shown. SEQ ID NOs 177 to 196 refer to the relevant amino acid and nucleotide sequences of anti-CD137 antibodies. The numbering of said VH and VL regions in Table H corresponds to the numbering system used as in Table 1(1) and (2).
- the amino acid sequence for "1205, light chain VL” is an example of a complete VL region sequence comprising all three CDRs of VL number 1205 shown in Table l(2) and the amino acid sequence for "1204, heavy chain VH” is an example of a complete VH region sequence comprising all three CDRs of VH number 1204 shown in Table 1(1).
- Preferred anti-CD137 antibodies of the invention include a VH region which comprises all three CDRs of a particular VH number and a VL region which comprises all three CDRs of a particular VL number.
- an antibody may comprise all three CDRs of VH number 1204 and all three CDRs of VL number 1205.
- Such an antibody may be referred to as 1204/1205.
- Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1204 and 1205 as shown in Table H (SEQ ID NOs: 179 and 177).
- An antibody may alternatively comprise all three CDRs of VH number 1214 and all three CDRs of VL number 1215.
- Such an antibody may be referred to as 1214/1215.
- Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1214 and 1215 as shown in Table H (SEQ ID NOs: 181 and 183).
- An antibody may alternatively comprise all three CDRs of VH number 1618 and all three CDRs of VL number 1619. Such an antibody may be referred to as 1618/1619. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1618 and 1619 as shown in Table H (SEQ ID NOs: 185 and 187).
- An antibody may alternatively comprise all three CDRs of VH number 1620 and all three CDRs of VL number 1621. Such an antibody may be referred to as 1620/1621. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1620 and 1621 as shown in Table H (SEQ ID NOs: 189 and 191)
- An antibody may alternatively comprise all three CDRs of VH number 1626 and all three CDRs of VL number 627. Such an antibody may be referred to as 1626/1627. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1626 and 1627 as shown in Table H (SEQ ID NOs: 193 and 195)
- the anti-CD 37 antibody may bind to the same epitope as any of the specific anti-CD137 antibodies described herein. Preferably it binds to the same epitope as any one of the antibodies designated 1204/1205, 1214/1215, 1618/1619, 1620/1621, and 1626/1627. Binding domains for CTLA-4
- the bispecific polypeptides of the invention may comprise a binding domain specific for CTLA-4.
- CD86 and CD80 may be referred to herein as B7 proteins (B7-2 and B7-1 respectively). These proteins are expressed on the surface of antigen presenting cells and interact with the T cell receptors CD28 and CTLA-4.
- B7 proteins B7-2 and B7-1 respectively.
- B7 proteins are expressed on the surface of antigen presenting cells and interact with the T cell receptors CD28 and CTLA-4.
- the binding of the B7 molecules to CD28 promotes T cell activation while binding of B7 molecules to CTLA-4 switches off the activation of the T cell.
- the interaction between the B7 proteins with CD28 and/or CTLA-4 constitutes a costimulatory signalling pathway which plays an important role in immune activation and regulation.
- the B7 molecules are part of a pathway, amenable to manipulation in order to uncouple immune inhibition, thereby enhancing immunity in patients.
- the CD86 protein is a monomer and consists of two extracellular immunoglobulin superfamily domains.
- the receptor binding domain of CD86 has a typical IgV-set structure, whereas the membrane proximal domain has a C1-set like structure.
- the structures of CD80 and CD86 have been determined on their own or in complex with CTLA-4.
- the contact residues on the CD80 and CD86 molecules are in the soluble extracellular domain, and mostly located in the beta-sheets and not in the (CDR-like) loops.
- SEQ ID NO: 3 is the amino acid sequence of the monomeric soluble extracellular domain of human wild-type CD86. This wild type sequence may optionally lack Alanine and Proline at the N terminus, i.e. positions 24 and 25. These amino acids may be referred to herein as A24 and P25 respectively.
- a bispecific polypeptide of the invention may incorporate as a polypeptide binding domain a domain which is specific for CTLA-4, a "CTLA-4 binding domain". Suitable examples of such binding domains are disclosed in WO 2014/207063, the contents of which are incorporated by reference.
- the binding domain specific for CTLA-4 may also bind to CD28.
- CTLA-4 as used herein typically refers to human CTLA-4 and the term CD28 as used herein typically refers to human CD28.
- the sequences of human CTLA-4 and human CD28 are set out in SEQ ID NOs: 1 and 2 respectively.
- the CTLA-4 binding domain of the polypeptide of the present invention may have some binding affinity for CTLA-4 or CD28 from other mammals, for example primate or murine CTLA-4 or CD28.
- the CTLA-4 binding domain has the ability to bind to CTLA-4 in its native state and in particular to CTLA-4 localised on the surface of a cell.
- CTLA-4 binding domain part of the polypeptide of the invention may comprise or consist of:
- the CTLA-4 binding domain is a polypeptide binding domain specific for human CTLA-4 which comprises or consists of (i) the monomeric soluble extracellular domain of human wild-type CD86, or (ii) a polypeptide variant of said soluble extracellular domain, provided that said polypeptide variant binds to human CTLA-4 with higher affinity than wild-type human CD86.
- the CTLA-4 binding domain of the polypeptide of the invention may have the same target binding properties as human wild-type CD86, or may have different target binding properties compared to the target binding properties of human wild-type CD86.
- human wild-type CD86 typically refers to the monomeric soluble extracellular domain of human wild-type CD86 as described in the preceding section.
- Human wild-type CD86 specifically binds to two targets, CTLA-4 and CD28. Accordingly, the binding properties of the CTLA-4 binding domain of the polypeptide of the invention may be expressed as an individual measure of the ability of the polypeptide to bind to each of these targets.
- a polypeptide variant of the monomeric extracellular domain of human wild-type CD86 preferably binds to CTLA-4 with a higher binding affinity than that of wild-type human CD86 for CTLA-4.
- Such a polypeptide may optionally also bind to CD28 with a lower binding affinity than that of wild-type human CD86 for CD28.
- the CTLA-4 binding domain of the polypeptide of the invention is a polypeptide binding domain specific for CTLA-4. This means that it binds to CTLA-4 preferably with a greater binding affinity than that at which it binds to another molecule.
- the CTLA-4 binding domain preferably binds to CTLA-4 with the same or with a higher affinity than that of wild-type human CD86 for CTLA-4.
- the Kd of the CTLA-4 binding domain of the polypeptide of the invention for human CTLA-4 will be at least 2-fold, at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 4.5-fold, at least 5-fold, at least 5.5-fold, at least 8-fold or at least 10- fold less than the Kd of wild-type human CD86 for human CTLA-4.
- the Kd of the CTLA-4 binding domain for human CTLA-4 will be at least 5-fold or at least 10- fold less than the Kd of wild-type human CD86 for human CTLA-4.
- a preferred method for determining the Kd of a polypeptide for CTLA-4 is SPR analysis, e.g. with a BiacoreTM system.
- the EC50 of the CTLA-4 binding domain of the polypeptide of the invention for human CTLA-4 will be at least 1.5-fold, at least 2-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 12-fold, at least 14-fold, at least 15-fold, at least 17-fold, at least 20- fold, at least 25-fold or at least 50-fold less than the EC50 of wild-type human CD86 for human CTLA-4 under the same conditions.
- the EC50 of the CTLA-4 binding domain for human CTLA-4 will be at least 10-fold or at least 25-fold less than the EC50 of wild-type human CD86 for human CTLA-4 under the same conditions.
- a preferred method for determining the EC50 of a polypeptide for CTLA-4 is via ELISA. Suitable ELISA assays for use in the assessment of the EC50 of polypeptides are set out in the Examples.
- the IC50 of the CTLA-4 binding domain of the polypeptide of the invention when competing with wild-type human CD86 for binding to human CTLA-4 will be at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 13-fold, at least 15- fold, at least 50-fold, at least 100-fold, or at least 300-fold less than the IC50 of wild-type human CD86 under the same conditions.
- the IC50 of the CTLA-4 binding domain will be at least 10-fold or at least 300-fold less than the IC50 of wild-type human CD86 under the same conditions.
- a preferred method for determining the IC50 of a polypeptide of the invention is via ELISA. Suitable ELISA assays for use in the assessment of the IC50 of polypeptides of the invention are set out in the Examples.
- the CTLA-4 binding domain of the polypeptide of the invention may also bind specifically to CD28. That is, the CTLA-4 binding domain may bind to CD28 with greater binding affinity than that at which it binds to another molecule, with the exception of CTLA-4.
- the CTLA-4 binding domain may bind to human CD28 with a lower affinity than that of wild- type human CD86 for human CD28.
- the Kd of the CTLA-4 binding domain for human CD28 will be at least 2-fold, preferably at least 5-fold, more preferably at least 10- fold higher than the Kd of wild-type human CD86 for human CD28.
- the binding properties of the CTLA-4 binding domain of the polypeptide of the invention may also be expressed as a relative measure of the ability of a polypeptide to bind to the two targets, CTLA-4 and CD28. That is, the binding properties of the CTLA-4 binding domain may be expressed as a relative measure of the ability of the polypeptide to bind to CTLA-4 versus its ability to bind to CD28.
- the CTLA-4 binding domain has an increased relative ability to bind to CTLA-4 versus CD28, when compared to the corresponding relative ability of human wild-type CD86 to bind to CTLA-4 versus CD28.
- the relative binding ability of the polypeptide for each target may be expressed as a simple ratio of the values of the parameter for each target. This ratio may be referred to as the binding ratio or binding strength ratio of a polypeptide.
- the CTLA-4 binding domain of the polypeptide of the invention preferably has a higher binding ratio than human wild-type CD86. It will be appreciated that direct comparison of the binding ratio for a given polypeptide to the binding ratio for another polypeptide typically requires that the same parameters be used to assess the binding affinities and calculate the binding ratios for both polypeptides.
- the binding ratio for a polypeptide is calculated by determining the Kd of the polypeptide for each target and then calculating the ratio in accordance with the formula [Kd for CD28] ⁇ [Kd for CTLA-4].
- This ratio may be referred to as the Kd binding ratio of a polypeptide.
- a preferred method for determining the Kd of a polypeptide for a target is SPR analysis, e.g. with a BiacoreTM system. Suitable protocols for the SPR analysis of polypeptides of the invention are set out in the Examples.
- the binding ratio of the CTLA- 4 binding domain of the polypeptide of the invention calculated according to this method is preferably at least 2-fold or at least 4-fold higher than the binding ratio of wild-type human CD86 calculated according to the same method.
- the binding ratio for a polypeptide may be calculated by determining the EC50 of the polypeptide for each target and then calculating the ratio in accordance with the formula [EC50 for CD28] ⁇ [EC50 for CTLA-4]. This ratio may be referred to as the EC50 binding ratio of a polypeptide.
- a preferred method for determining the EC50 of a polypeptide for a target is via ELISA. Suitable ELISA assays for use in the assessment of the EC50 of polypeptides of the invention are set out in the Examples.
- the binding ratio of the CTLA-4 binding domain of the polypeptide of the invention calculated according to this method is at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold or at least 10-fold higher than the binding ratio of wild-type human CD86 calculated according to the same method.
- the CTLA-4 binding domain of the polypeptide of the invention may have the ability to cross-compete with another polypeptide for binding to CTLA-4.
- the CTLA-4 binding domain may cross-compete with a polypeptide having the amino acid sequence of any one of SEQ ID NOs: 6 to 24 for binding to CTLA-4.
- Such cross-competing polypeptides may be identified in standard binding assays. For example, SPR analysis (e.g. with a BiacoreTM system), ELISA assays or flow cytometry may be used to demonstrate cross-competition.
- the CTLA-4 binding domain of the polypeptide of the invention has certain preferred structural characteristics.
- the CTLA-4 binding domain either comprises or consists of (i) the monomeric soluble extracellular domain of human wild-type CD86, or (ii) a polypeptide variant of said soluble extracellular domain, provided that said polypeptide variant binds to human CTLA-4 with higher affinity than wild-type human CD86.
- a polypeptide variant of the monomeric soluble extracellular domain of human wild-type CD86 comprises or consists of an amino acid sequence which is derived from that of human wild-type CD86, specifically the amino acid sequence of the soluble extracellular domain of human wild-type CD86 (SEQ ID NO: 3), optionally lacking A24 and P25.
- a variant comprises an amino acid sequence in which at least one amino acid is changed when compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- changed it is meant that at least one amino acids is deleted, inserted, or substituted compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- substituted it is meant that the at least one amino acid in the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25) is replaced with an alternative amino acid.
- At least 1 , 2, 3, 4, 5, 6, 7, 8 or 9 amino acids are changed when compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- no more than 10, 9, 8, 7, 6, 5, 4, 2 or 1 amino acids are changed when compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25). It will be appreciated that any of these lower limits may be combined with any of these upper limits to define a range for the permitted number of changes compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- a polypeptide of the invention may comprise an amino acid sequence in which the permitted number of amino acid changes compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25) is in the range 2 to 3, 2 to 4, 2 to 5, 2 to 6, 2 to 7,
- At least 2 amino acids are changed when compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- the permitted number of amino acid changes compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25) is in the range 2 to 9, 2 to 8 or 2 to 7.
- the variant comprises an amino acid sequence in which all of the changes compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25) are substitutions. That is, a sequence in which no amino acids are deleted or inserted compared to the sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- amino acids are substituted when compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25) and no amino acids are deleted or inserted compared to the sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- the changes compared to the sequence of SEQ ID NO: 3 are in the FG loop region (positions 114 to 121 ) and/or the beta sheet region of SEQ ID NO: 3.
- the strands of the beta sheet region have the following positions in SEQ ID NO: 3: A:27-31 , B:36-37, C:54-58, C ' :64-69, C " :72-74, D:86-88, E:95- 97, F: 107-113, G: 122-133.
- the changes compared to the sequence of SEQ ID NO: 3 are in one or more of the positions selected from 32, 48, 49, 54, 74, 77, 79, 103, 107, 111 , 118, 120, 121 , 122, 125, 127 or 134. All numbering of amino acid positions herein is based on counting the amino acids in SEQ ID NO: 4 starting from the N terminus. Thus, the first position at the N terminus of SEQ ID NO: 3 is numbered 24 (see schematic diagram in Figure 4).
- Particularly preferred insertions include a single additional amino acid inserted between positions 116 and 117 and/or a single additional amino acid inserted between positions 118 and 119.
- the inserted amino acid is preferably Tyrosine (Y), Serine (S), Glycine (G), Leucine (L) or Aspartic Acid (D).
- a particularly preferred substitution is at position 122, which is Arginine (R).
- the polypeptide of the invention preferably includes an amino acid sequence in which at least position 122 is substituted compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- the most preferred substitution at position 122 is to replace Arginine (R) with Lysine (K) or Asparagine (N), ranked in order of preference. This substitution may be referred to as R122K/N.
- Other preferred substitutions are at positions 107, 121 , and 125, which are Leucine (L), Isoleucine (I) and Glutamic acid (Q), respectively.
- the polypeptide of the invention preferably includes an amino acid sequence in which at least one of the amino acids at positions 107, 121 and 125 is also substituted compared to the amino acid sequence of SEQ ID NO: 3 (or said sequence lacking A24 and P25).
- the amino acid sequence of the polypeptide of the invention may also be substituted at one or more of positions 32, 48, 49, 54, 64, 74, 77, 79, 103, 111 , 118, 120, 127 and 134.
- the most preferred substitution at position 107 is to replace Leucine (L) with Isoleucine (I), Phenylalanine (F) or Arginine (R), ranked in order of preference. This substitution may be referred to as L107I/F/R. Similar notation is used for other substitutions described herein.
- the most preferred substitution at position 121 is to replace Isoleucine (I) with Valine (V). This substitution may be referred to as 1121V.
- substitution at position 125 is to replace Glutamine (Q) with Glutamic acid (E). This substitution may be referred to as Q125E.
- Other substitutions which may be preferred in the amino acid sequence of the polypeptide of the invention include: F32I, Q48L, S49T, V54I, V64I, K74I/R, S77A, H79D/S/A, K103E, 1111V, T118S, M120L, N127S/D and A134T.
- Particularly preferred variants of said soluble extracellular domain of human wild-type CD86 comprise or consist of any one of the amino acid sequences of SEQ ID NOs: 6 to 24, as shown in Table C.
- amino acid sequences shown in SEQ ID NOs: 6 to 14 may optionally include the additional residues AP at the N-terminus.
- amino acid sequences shown in SEQ ID NOs: 15 to 24 may optionally lack the residues AP at the N-terminus. In either case, these residues correspond to A24 and P25 of SEQ ID NO: 3.
- the CTLA-4 binding domain of the polypeptide of the invention may comprise or consist of any of the above-described variants of said soluble extracellular domain of human wild- type CD86. That is, the CTLA-4 binding domain of the polypeptide of the invention may comprise or consist of the amino acid sequence of any one of SEQ ID NOs: 6 to 24, as shown in Table C.
- the binding domain may modulate signalling from CTLA-4, for example when administered to a cell expressing CTLA-4, such as a T cell.
- the binding domain reduces, i.e. inhibits or blocks, said signalling and thereby increases the activation of said cell.
- Changes in CTLA-4 signalling and cell activation as a result of administration of a test agent may be determined by any suitable method. Suitable methods include assaying for the ability of membrane-bound CD86 (e.g. on Raji cells) to bind and signal through CTLA-4 expressed on the surface of T cells, when in the presence of a test agent or in the presence of a suitable control. An increased level of T cell IL-2 production or an increase in T cell proliferation in the presence of the test agent relative to the level of T cell IL-2 production and/or T cell proliferation in the presence of the control is indicative of reduced signalling through CTLA-4 and increased cell activation. A typical assay of this type is disclosed in Example 9 of US20080233122.
- binding domains for OX40 may incorporate as a binding domain (for example, as B1 ) any OX40 binding domain, for example an anti-OX40 antibody.
- the antibody, or antigen binding fragment thereof, that binds specifically to OX40 has certain preferred binding characteristics and functional effects, which are explained in more detail below. Said antibody, or antigen binding fragment thereof, preferably retains these binding characteristics and functional effects when incorporated as part of a bispecific antibody of the invention.
- This binding domain may also be provided independently of the bispecific molecules of the invention.
- the antibody preferably specifically binds to OX40, i.e. it binds to OX40 but does not bind, or binds at a lower affinity, to other molecules.
- OX40 as used herein typically refers to human OX40.
- the sequence of human OX40 is set out in SEQ ID NO:51 (corresponding to GenBank: NP_003318.1 ).
- the antibody may have some binding affinity for OX40 from other mammals, such as OX40 from a non-human primate (for example Macaca fascicularis (cynomolgus monkey), Macaca mulatta).
- the antibody preferably does not bind to murine OX40 and/or does not bind to other human TNFR superfamily members, for example human CD137 or CD40.
- the antibody has the ability to bind to OX40 in its native state and in particular to OX40 localised on the surface of a cell.
- the antibody will bind specifically to OX40. That is, an antibody of the invention will preferably bind to OX40 with greater binding affinity than that at which it binds to another molecule.
- the antibody may modulate the activity of a cell expressing OX40, wherein said modulation is an increase or decrease in the activity of said cell, as defined above.
- the cell is typically a T cell.
- the antibody may increase the activity of a CD4+ or CD8+ effector cell, or may decrease the activity of a regulatory T cell (T reg), as described above.
- the net effect of the antibody will be an increase in the activity of effector T cells, particularly CD4+ effector T cells.
- Methods for determining a change in the activity of effector T cells are well known and are described above.
- the antibody preferably binds to human OX40 with a Kd value which is less than 50x10 " 0 M or less than 25x10- 10 M, more preferably less than 10, 9, 8, 7, or 6x10- 0 M, most preferably less than 5x10 "10 M.
- the antibody preferably does not bind to murine OX40 or any other TNFR superfamily member, such as CD137 or CD40. Therefore, typically, the Kd for the antibody with respect to human OX40 will be 2-fold, preferably 5-fold, more preferably 10-fold less than Kd with respect to the other, non-target molecule, such as murine OX40, other TNFR superfamily members, or any other unrelated material or accompanying material in the environment. More preferably, the Kd will be 50-fold less, even more preferably 100-fold less, and yet more preferably 200-fold less.
- An antibody of the invention is preferably capable of binding to its target with an affinity that is at least two-fold, 10-fold, 50-fold, 100-fold or greater than its affinity for binding to another non-target molecule.
- the antibody preferably exhibits at least one of the following functional characteristics:
- the antibody is specific for OX40, typically human OX40 and may comprise any one, two, three, four, five or all six of the following:
- a heavy chain CDR3 sequence which is 9 to 17 amino acids in length and which comprises the consensus sequence of : "A, R, G/Y/S/H, G/Y/F/V/D, G/Y/P/F, -/H/S, -/N/D/H, -A7G, -/Y, -/Y, - W/A/V, -/A/Y, -/D/A/Y/G/H/N, Y/S/W/A/T, L/M/l/F, D, Y".
- Preferred heavy chain CDR3 sequences within this definition include a CDR3 sequence of 10 amino acids in length which comprises the consensus sequence
- A, R, Y/H, D, Y, A/Y/G, S/W/A, M/L, D, Y or a CDR3 sequence of 1 1 amino acids in length which comprises the consensus sequence "A, R, G/Y, V/F/Y, P, H, G/Y/H, Y, F/l, D, Y";
- a light chain CDR3 sequence which is 8 to 10 amino acids in length and comprises the consensus sequence: "Q,Q, S/Y/G, -/Y/H/G, -/S/Y/G/D, S/Y/G/D , S/Y/G/T, P/L, Y/S/H/L F, T".
- a preferred example a light chain CDR3 sequence within this definition consists of the sequence "Q, Q, S, Y, S, T, P, Y, T"
- the antibody may comprise at least a heavy chain CDR3 as defined in (c) and/or a light chain CDR3 as defined in (f).
- the antibody may comprise all three heavy chain CDR sequences of (a), (b) and (c) and/or all three light chain CDR sequences of (d), (e) and (f).
- Preferred anti-OX40 antibodies may comprise at least a heavy chain CDR3 as defined in any individual row of Table A(1 ) and/or a light chain CDR3 as defined in in any individual row of Table A(2).
- the antibody may comprise all three heavy chain CDR sequences shown in an individual row of Table A(1 ) (that is, all three heavy chain CDRs of a given "VH number") and/or all three light chain CDR sequences shown in an individual row of Table A(2) (that is, all three light chain CDRs of a given "VL number”).
- Examples of complete heavy and light chain variable region amino acid sequences are shown in Table B. Exemplary nucleic acid sequences encoding each amino acid sequence are also shown. The numbering of said VH and VL regions in Table B corresponds to the numbering system used as in Table A(1 ) and (2).
- the amino acid sequence for "1167, light chain VL” is an example of a complete VL region sequence comprising all three CDRs of VL number 1167 shown in Table A(2)
- the amino acid sequence for "1166, heavy chain VH" is an example of a complete VH region sequence comprising all three CDRs of VH number 1166 shown in Table A(1 ).
- Preferred anti-OX40 antibodies of the invention include a VH region which comprises all three CDRs of a particular VH number and a VL region which comprises all three CDRs of a particular VL number.
- VH region which comprises all three CDRs of a particular VH number
- VL region which comprises all three CDRs of a particular VL number.
- an antibody may comprise all three CDRs of VH number 1166 and all three CDRs of VL number 1 167. Such an antibody may be referred to as 1166/1167. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1166 and 1167 as shown in Table B (SEQ ID NOs: 91 and 89). an antibody may comprise all three CDRs of VH number 1170 and all three CDRs of VL number 1171. Such an antibody may be referred to as 1170/1171. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1170 and 1171 as shown in Table B (SEQ ID NOs: 95 and 93).
- an antibody may comprise all three CDRs of VH number 1164 and all three CDRs of VL number 1135. Such an antibody may be referred to as 1164/1135. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1164 and 1135 as shown in Table B (SEQ ID NOs: 99 and 97)
- an antibody may comprise all three CDRs of VH number 1168 and all three CDRs of VL number 1135. Such an antibody may be referred to as 1168/1135. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1168 and 1135 as shown in Table B (SEQ ID NOs: 101 and 97)
- an antibody may comprise all three CDRs of VH number 1482 and all three CDRs of VL number 1483. Such an antibody may be referred to as 1482/1483 Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1482 and 1483 as shown in Table B (SEQ ID NOs: 105 and 103).
- an antibody may comprise all three CDRs of VH number 1490 and all three CDRs of VL number 1135. Such an antibody may be referred to as 1490/1135. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1490 and 1135 as shown in Table B (SEQ ID NOs: 107 and 97).
- an antibody may comprise all three CDRs of VH number 1514 and all three CDRs of VL number 1515. Such an antibody may be referred to as 1514/1515. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1514 and 1515 as shown in Table B (SEQ ID NOs: 111 and 109).
- an antibody may comprise all three CDRs of VH number 1520 and all three CDRs of VL number 1135. Such an antibody may be referred to as 1520/1135. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1520 and 1135 as shown in Table B (SEQ ID NOs: 113 and 97).
- an antibody may comprise all three CDRs of VH number 1524 and all three CDRs of VL number 1525. Such an antibody may be referred to as 1524/1525. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1524 and 1525 as shown in Table B (SEQ ID NOs: 117 and 115).
- an antibody may comprise all three CDRs of VH number 1526 and all three CDRs of VL number 1527. Such an antibody may be referred to as 1526/1527. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1526 and 1527 as shown in Table B (SEQ ID NOs: 121 and 119). - an antibody may comprise all three CDRs of VH number 1542 and all three CDRs of VL number 1135. Such an antibody may be referred to as 1542/1135. Such an antibody may preferably comprise the corresponding complete VH and VL sequences of 1542 and 1135 as shown in Table B (SEQ ID NOs: 123 and 97).
- the antibody may comprise a variant or a fragment of any of the specific amino acid sequences recited in Table B, provided that the antibody binds to human OX40 and exhibits at least one of functional characteristics I to III.
- Such a variant or fragment may typically retain the CDR sequences of the said sequence of Table B.
- a fragment of any one of the heavy or light chain amino acid sequences shown in Table B may comprise at least 7, at least 8, at least 9, at least 10, at least 12, at least 15, at least 18, at least 20, least 25, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 consecutive amino acids from the said amino acid sequence.
- a variant of any one of the heavy or light chain amino acid sequences shown in Table B may be a substitution, deletion or addition variant of said sequence, as defined above.
- the antibody may bind to the same epitope as any of the specific antibodies described herein. Preferably it binds to the same epitope as any one of the antibodies designated 1166/1167, 1170/1171 , 1164/1135, 1168/1135, 1482/ 1483, 1490/1135, 1514/1515, 1520/1135, 1524/1525, 1526/1527 and 1542/1135.
- Heavy chain constant region amino acid sequences which may be combined with any VH region sequence disclosed herein (to form a complete heavy chain), such as the lgG1 heavy chain constant region sequence, are described above.
- Exemplary light chain constant region amino acid sequences which may be combined with any VL region sequence disclosed herein (to form a complete light chain), such as the kappa chain constant region sequence, are described above.
- Embodiment of the invention bispecific polypeptide specific for CTLA-4 and CD137
- the bispecific polypeptide has binding domains which are specific for CD137 and CTLA-4, for example B1 is specific for CD137 and B2 is specific for CTLA-4. These binding domains are as defined above.
- the bispecific polypeptide of the embodiment part B1 - binding domain specific for CD 137 is as defined above.
- the bispecific polypeptide of the embodiment part B2 - binding domain specific for CTLA- 4 The binding domain specific for CTLA-4 is as defined above.
- the bispecific polypeptide of the invention is capable of specifically binding to both human CD137 and human CTLA-4.
- By “capable of specifically binding to both CD137 and CTLA- 4" it is meant that the anti-CTLA-4 part specifically binds to CTLA-4 and the anti-CD137 part specifically binds to CD137, in accordance with the definitions provided for each part above.
- the bispecific polypeptide may comprise any CD137 binding domain as described herein linked to any CTLA-4 binding domain as described herein.
- the binding characteristics of the different parts for their respective targets are unchanged or substantially unchanged when they are present as part of a bispecific antibody of the invention, when compared to said characteristics for the individual parts when present as separate entities.
- the bispecific molecule will have a Kd for CTLA-4 which is preferably substantially the same as the Kd value for CTLA-4 of the CTLA-4 binding domain when present alone.
- the bispecific molecule has a Kd for CTLA-4 which is increased relative to the Kd for CTLA-4 of the CTLA-4 binding domain when present alone, then the increase is by no more than 10 fold, preferably no more than 9 fold, 8 fold, 7 fold, 6 fold, 5 fold, 4 fold, 3 fold or 2 fold.
- the bispecific molecule will independently have a Kd for CD137 which is preferably substantially the same as the Kd value for C137 of the CD137 binding domain when present alone.
- the bispecific molecule has a Kd for CD137 which is increased relative to the Kd for CD137 of the anti-CD137 antibody when present alone, then the increase is by no more than 10 fold, preferably no more than 9 fold, 8 fold, 7 fold, 6 fold, 5 fold, 4 fold, 3 fold or 2 fold.
- Preferred Kd values for the individual binding domains are as described above. It will be appreciated that any of the fold changes in CTLA-4 binding may be independently combined with any of the recited fold changes in CD137 binding to describe the binding characteristics of a given bispecific molecule.
- the binding characteristics for CD137 or CTLA-4 of any bispecific polypeptide of the invention may be assessed by any suitable assay.
- the assays set out above for each separate part may also be applied to a bispecific antibody or a combined assay to assess simultaneous binding to both targets may be used.
- Suitable assays for assessing the binding characteristics of bispecific polypeptides of the invention are also set out in the Examples.
- the bispecific polypeptide of the embodiment is capable of modulating the activity of cells of the immune system to a greater extent than an individual agonist of CD137 or CTLA-4 alone, or than a combination of such individual agonists.
- administration of the bispecific polypeptide produces a higher level of T cell activity, in particular effector T cell activity, for example CD4+ effector T cell activity.
- effector T cell activity is also more localised than that which results from administration of an individual CD137 or CTLA-4 agonist alone (or a combination thereof), because the bispecific polypeptide exerts the greatest effect only in a microenvironment in which CTLA-4 and CD137 are both highly expressed. Tumours are such a microenvironment.
- CD137 is expressed in high levels on CD8 T cells and may thus activate them in particular.
- CD8 T cells are one of the main effector component of an effective tumor response.
- the increase in effector T cell activity may result directly from stimulation of the effector T cells via activation of the CD137 pathway or via blockade of the CTLA-4 inhibition pathway, or may result indirectly from depletion or down-regulation of Tregs, thereby reducing their immunosuppressive effect.
- Depletion / down-regulation of Tregs may be mediated by antibody dependent cellular phagocytosis (ADCP) or antibody dependent cellular cytotoxicity (ADCC) mechanisms.
- ADCP antibody dependent cellular phagocytosis
- ADCC antibody dependent cellular cytotoxicity
- the cell surface expression pattern of CTLA-4 and CD137 is partly overlapping, thus, the bispecific antibodies of the invention may bind to both targets both in c/ ' s and in trans. This may result in stimulation through CD137 and CTLA-4 in a FcyR-cross-linking independent manner, either by increasing the level of receptor clustering in cis on the same cell, or by creating an artificial immunological synapse between two cells in trans, which in turn may lead to enhanced receptor clustering and increased signalling in both cells. Overall, the result will be a very powerful, tumor directed immune activation for the generation of tumoricidal activity.
- Measurement of the effect of a bispecific polypeptide of the invention on cells of the immune system may be achieved with any suitable assay.
- increased activity of effector T cells may be measured by assays as described above in respect of individual components B1 and B2 of the bispecific polypeptide, and include measurement of proliferation or IL-2 production by CD4+ and/or CD8+ T cells in the presence of the bispecific polypeptide relative to a control.
- An increase of proliferation or IL-2 production relative to control is indicative of increased cell activation.
- a typical assay of this type is disclosed in Example 9 of US20080233122.
- Assays for cell proliferation and/or IL-2 production are well known and are also exemplified in the Examples.
- the bispecific molecule When assessed in the same assay, the bispecific molecule will typically induce an increase in the activity of an effector T cell which is at least 1.5 fold higher or at least 2 fold higher, more preferably 3 fold higher, most preferably 5 fold higher than the increase in activity of an effector T cell induced by a combination of monospecific agents binding to the same targets.
- the bispecific molecule potently activates the immune system when in a microenvironment in which both CD137 and CTLA-4 are highly expressed.
- the bispecific molecule will increase the activity of a CD4+ or CD8+ effector cell, or may decrease the activity of a regulatory T cell (T reg). In either case, the net effect of the antibody will be an increase in the activity of effector T cells, particularly CD4+ effector T cells.
- the bispecific molecule will typically induce an increase in the activity of an effector T cell which is at least 1.5 fold higher or at least 1.7 fold higher, more preferably 4.5 fold higher, most preferably 7 fold higher than the increase in activity of an effector T cell induced by a combination of monospecific agents binding to the same targets.
- the polypeptide may be capable of specifically binding to both CTLA-4 and CD137, and B1 may be an antibody, or antigen binding fragment thereof, specific for CD137; and B2 may be a polypeptide binding domain specific for CTLA-4, which comprises or consists of: i) the amino acid sequence of SEQ ID NO: 3; or ii) an amino acid sequence in which at least one amino acid is changed when compared to the amino acid sequence of SEQ ID NO: 3 provided that said binding domain binds to human CTLA-4 with higher affinity than wild-type human CD86.
- the CTLA-4 specifically bound by the polypeptide may be primate or murine, preferably human, CTLA-4, and/or the CD137 specifically bound by the polypeptide may be primate, preferably human, CD137.
- Part B1 of the polypeptide of the invention is an antibody, or antigen-binding fragment thereof, which typically comprises at least one heavy chain (H) and/or at least one light chain (L).
- Part B2 of the polypeptide of the invention may be attached to any part of B1, but may typically be attached to said at least one heavy chain (H) or at least one light chain (L), preferably at either the N or the C terminus.
- Part B2 of the polypeptide of the invention may be so attached either directly or indirectly via any suitable linking molecule (a linker).
- Part B1 preferably comprises at least one heavy chain (H) and at least one light chain (L) and part B2 is preferably attached to the N or the C terminus of either said heavy chain (H) or said light chain (L).
- An exemplary antibody of B1 consists of two identical heavy chains (H) and two identical light chains (L). Such an antibody is typically arranged as two arms, each of which has one H and one L joined as a heterodimer, and the two arms are joined by disulfide bonds between the H chains. Thus, the antibody is effectively a homodimer formed of two H-L heterodimers.
- Part B2 of the polypeptide of the invention may be attached to both H chains or both L chains of such an antibody, or to just one H chain, or just one L chain.
- the polypeptide of the invention may therefore alternatively be described as an anti- CD137 antibody, or an antigen binding fragment thereof, to which is attached at least one polypeptide binding domain specific for CTLA-4, which comprises or consists of the monomeric soluble extracellular domain of human wild-type CD86 or a variant thereof.
- the binding domains of B1 and B2 may be the only binding domains in the polypeptide of the invention.
- polypeptide of the invention may comprise a polypeptide arranged according to any one of the following formulae, written in the direction N-C: (A) L-(X)n-B2;
- the present invention also provides a polypeptide which consists of a polypeptide arranged according to any of formulae (A) to (D).
- Said polypeptide may be provided as a monomer or may be present as a component of a multimeric protein, such as an antibody.
- Said polypeptide may be isolated. Examples of amino acid sequences of such polypeptides are shown in Table H. Exemplary nucleic acid sequences encoding each amino acid sequence are also shown. Exemplary amino acid and nucleotide sequences are recited in SEQ ID NOs 197- 206.
- Part B2 may be attached to any part of a polypeptide of the invention, or to a linker, by any suitable means.
- the various parts of the polypeptide may be joined by chemical conjugation, such as with a peptide bond.
- the polypeptide of the invention may comprise or consist of a fusion protein comprising B1 (or a component part thereof) and B2, optionally joined by a peptide linker.
- the CD137-binding domain or domains of B1 and the CTLA-4-binding domain or domains of B2 may be the only binding domains.
- carbodiimide conjugation may be used to conjugate a variety of agents, including doxorubicin, to antibodies or peptides.
- the water-soluble carbodiimide, 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) is particularly useful for conjugating a functional moiety to a binding moiety.
- conjugation may be achieved by sodium periodate oxidation followed by reductive alkylation of appropriate reactants, or by glutaraldehyde cross-linking.
- a determination should preferably be made that parts B1 and B2 retain or substantially retain their target binding properties when present as parts of the polypeptide of the invention.
- the same techniques may be used to link the polypeptide of the invention (directly or indirectly) to another molecule.
- the other molecule may be a therapeutic agent or a detectable label.
- Suitable therapeutic agents include a cytotoxic moiety or a drug.
- a polypeptide of the invention may be provided in isolated or substantially isolated form.
- substantially isolated it is meant that there may be substantial, but not total, isolation of the polypeptide from any surrounding medium.
- the polypeptides may be mixed with carriers or diluents which will not interfere with their intended use and still be regarded as substantially isolated.
- Exemplary polypeptides of the invention may comprise or consist of any one of the amino acid sequences shown in Table H.
- Representative polynucleotides which encode examples of a heavy chain or light chain amino acid sequence of an antibody may comprise or consist of any one of the nucleotide sequences set out in Table H as SEQ ID NOs 178, 180, 182, 184, 186 , 188, 190, 192, 194 or 196.
- Representative polynucleotides which encode the polypeptides shown in Table H may comprise or consist of the corresponding nucleotide sequences which are also shown in Table H (intron sequences are shown in lower case) (For example, SEQ ID NOs 197, 199, 201 , 203 and 205).
- Representative polynucleotides which encode examples of part B2 may comprise or consist of any one of SEQ ID NOS: 25 to 43 as shown in Table E.
- Embodiment of the invention bispecific polypeptide specific for OX40 and CTLA-4
- polypeptide has binding domains which are specific for OX40 and CTLA-4, for example B1 is specific for OX40 and B2 is specific for CTLA-4.
- bispecific polypeptide of the embodiment part B1 - antibody specific for OX40 is as defined above.
- the binding domain specific for OX40 is as defined above.
- Part B2 of the polypeptide of the invention is a polypeptide binding domain specific for CTLA-4, as described above.
- the bispecific polypeptide of the embodiment is capable of modulating the activity of cells of the immune system to a greater extent than an individual agonist of OX40 or CTLA-4 alone, or than a combination of such individual agonists.
- administration of the bispecific polypeptide produces a higher level of effector T cell activity, particular CD4+ effector T cell activity.
- the increase in effector T cell activity is also more localised than that which results from administration of an individual OX40 or CTLA-4 agonist alone (or a combination thereof), because the bispecific polypeptide exerts the greatest effect only in a microenvironment in which CTLA-4 and OX40 are both highly expressed. Tumours are such a microenvironment.
- Tumor infiltrating regulatory T cells (Tregs) express high levels of CTLA-4 and OX40, and higher than effector T cells (both CD4 and CD8).
- the increase in effector T cell activity may result directly from stimulation of the effector T cells via activation of the OX40 pathway or via blockade of the CTLA-4 inhibition pathway, or may result indirectly from depletion or down-regulation of Tregs, thereby reducing their immunosuppressive effect.
- Depletion / down-regulation of Tregs may be mediated by antibody dependent cellular phagocytosis (ADCP) or antibody dependent cellular cytotoxicity (ADCC) mechanisms.
- ADCP antibody dependent cellular phagocytosis
- ADCC antibody dependent cellular cytotoxicity
- the high expression of both CTLA-4 and OX40 on Tregs, compared to effector T cells may induce a significantly higher killing of Tregs compared to the monospecific antibodies. Effector T cells, having lower expression of CTLA-4 and OX40 will not be depleted by this mechanism.
- the result will be a very powerful, localised immune activation for the immediate generation of tumoricidal activity.
- Measurement of the effect of a bispecific polypeptide of the invention on cells of the immune system may be achieved with any suitable assay.
- increased activity of effector T cells may be measured by assays as described above in respect of individual components B1 and B2 of the bispecific polypeptide, and include measurement of proliferation or IL-2 production by CD4+ and/or CD8+ T cells in the presence of the bispecific polypeptide relative to a control.
- the bispecific polypeptide of the invention is capable of specifically binding to both human CTLA-4 and human OX40, and comprises B1 and B2 as defined above.
- part B1 specifically binds to OX40 and part B2 specifically binds to CTLA-4, in accordance with the definitions provided for each part above.
- the binding characteristics of parts B1 and B2 for their respective targets are unchanged or substantially unchanged when they are present as part of a polypeptide of the invention, when compared to said characteristics for parts B1 and B2 when present as separate entities.
- the bispecific molecule will have a Kd for OX40 which is preferably substantially the same as the Kd value for OX40 of B1 when present alone.
- the bispecific molecule has a Kd for OX40 which is increased relative to the Kd for OX40 of B1 when present alone, then the increase is by no more than 10 fold, preferably no more than 9 fold, 8 fold, 7 fold, 6 fold, 5 fold, 4 fold, 3 fold or 2 fold.
- the bispecific molecule preferably binds to human OX40 with a Kd value which is less than 50x10 "10 M, more preferably less than 25x10 "10 M, most preferably less than 20x10 "10 M.
- the bispecific molecule will independently have a Kd for CTLA-4 which is preferably substantially the same as the Kd value for CTLA4 of B2 when present alone.
- the bispecific molecule if the bispecific molecule has a Kd for CTLA-4 which is increased relative to the Kd for CTLA-4 of B2 when present alone, then the increase is by no more than 3 fold, preferably no more than 2 fold.
- the bispecific molecule preferably binds to human CTLA- 4 with a Kd value which is less than 60x10 "9 M, more preferably less than 25x10 "9 M, most preferably less than 10x10 "9 M.
- the bispecific molecule may have a Kd for OX40 which is less than 50x10 " 10 M, 25x10- 10 M, or 20x10 "10 M and independent have a Kd for CTLA-4 which is less than 60x10 "9 M, 25x10 "9 M, or 0x10 "9 M.
- any of the Kd values recited for OX40 may be independently combined with any of the Kd values recited for CTLA-4 to describe the binding characteristics of a given bispecific molecule.
- any of the recited fold changes in OX40 binding may be independently combined with any of the recited fold changes in CTLA-4 binding to describe the binding characteristics of a given bispecific molecule.
- binding characteristics of parts B1 and B2 when present as part a polypeptide of the invention may be assessed by any suitable assay.
- the assays set out above for each separate part may also be applied to B1 and B2 when they are present as part of a polypeptide of the invention.
- Suitable assays for assessing the binding characteristics of bispecific polypeptides of the invention are also set out in the Examples.
- the bispecific molecule potently activates the immune system when in a microenvironment in which both OX40 and CTLA-4 are highly expressed.
- the bispecific molecule will increase the activity of a CD4+ or CD8+ effector cell, or may decrease the activity of a regulatory T cell (T reg). In either case, the net effect of the antibody will be an increase in the activity of effector T cells, particularly CD4+ effector T cells.
- the bispecific molecule will typically induce an increase in the activity of an effector T cell which is at least 1.5 fold higher or at least 1.7 fold higher, more preferably 4.5 fold higher, most preferably 7 fold higher than the increase in activity of an effector T cell induced by a combination of monospecific agents binding to the same targets.
- the polypeptide may be capable of specifically binding to both CTLA-4 and OX40, and B1 may be an antibody, or antigen binding fragment thereof, specific for OX40; and B2 may be a polypeptide binding domain specific for CTLA-4, which comprises or consists of: i) the amino acid sequence of SEQ ID NO: 3; or
- the CTLA-4 specifically bound by the polypeptide may be primate or murine, preferably human, CTLA-4, and/or the OX40 specifically bound by the polypeptide may be primate, preferably human, OX40.
- Part B1 of the polypeptide of the invention is an antibody, or antigen-binding fragment thereof, which typically comprises at least one heavy chain (H) and/or at least one light chain (L).
- Part B2 of the polypeptide of the invention may be attached to any part of B1 , but may typically be attached to said at least one heavy chain (H) or at least one light chain (L), preferably at either the N or the C terminus.
- Part B2 of the polypeptide of the invention may be so attached either directly or indirectly via any suitable linking molecule (a linker).
- Part B1 preferably comprises at least one heavy chain (H) and at least one light chain (L) and part B2 is preferably attached to the N or the C terminus of either said heavy chain (H) or said light chain (L).
- An exemplary antibody of B1 consists of two identical heavy chains (H) and two identical light chains (L). Such an antibody is typically arranged as two arms, each of which has one H and one L joined as a heterodimer, and the two arms are joined by disulfide bonds between the H chains. Thus, the antibody is effectively a homodimer formed of two H-L heterodimers.
- Part B2 of the polypeptide of the invention may be attached to both H chains or both L chains of such an antibody, or to just one H chain, or just one L chain.
- the polypeptide of the invention may therefore alternatively be described as an anti-OX40 antibody, or an antigen binding fragment thereof, to which is attached at least one polypeptide binding domain specific for CTLA-4, which comprises or consists of the monomeric soluble extracellular domain of human wild-type CD86 or a variant thereof.
- the binding domains of B1 and B2 may be the only binding domains in the polypeptide of the invention.
- the polypeptide of the invention may comprise a polypeptide arranged according to any one of the following formulae, written in the direction N-C:
- the present invention also provides a polypeptide which consists of a polypeptide arranged according to any of formulae (A) to (D).
- Said polypeptide may be provided as a monomer or may be present as a component of a multimeric protein, such as an antibody.
- Said polypeptide may be isolated. Examples of amino acid sequences of such polypeptides are shown in Table D. Exemplary nucleic acid sequences encoding each amino acid sequence are also shown.
- Part B2 may be attached to any part of a polypeptide of the invention, or to a linker, by any suitable means.
- the various parts of the polypeptide may be joined by chemical conjugation, such as with a peptide bond.
- the polypeptide of the invention may comprise or consist of a fusion protein comprising B1 (or a component part thereof) and B2, optionally joined by a peptide linker.
- the OX40-binding domain or domains of B1 and the CTLA-4-binding domain or domains of B2 may be the only binding domains.
- carbodiimide conjugation may be used to conjugate a variety of agents, including doxorubicin, to antibodies or peptides.
- the water-soluble carbodiimide, 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) is particularly useful for conjugating a functional moiety to a binding moiety.
- conjugation may be achieved by sodium periodate oxidation followed by reductive alkylation of appropriate reactants, or by glutaraldehyde cross-linking.
- a determination should preferably be made that parts B1 and B2 retain or substantially retain their target binding properties when present as parts of the polypeptide of the invention.
- the same techniques may be used to link the polypeptide of the invention (directly or indirectly) to another molecule.
- the other molecule may be a therapeutic agent or a detectable label.
- Suitable therapeutic agents include a cytotoxic moiety or a drug.
- a polypeptide of the invention may be provided in isolated or substantially isolated form. By substantially isolated, it is meant that there may be substantial, but not total, isolation of the polypeptide from any surrounding medium.
- the polypeptides may be mixed with carriers or diluents which will not interfere with their intended use and still be regarded as substantially isolated.
- Exemplary polypeptides of the invention may comprise or consist of any one of the amino acid sequences shown in Table D.
- the polypeptide comprises or consists of the amino acid sequence selected of from within the group SEQ ID NOs 125 to 134, optionally wherein said polypeptide is a provided as a component part of an antibody.
- Representative polynucleotides which encode examples of a heavy chain or light chain amino acid sequence of an antibody may comprise or consist of any one of the nucleotide sequences set out in Table B.
- Representative polynucleotides which encode the polypeptides shown in Table D may comprise or consist of the corresponding nucleotide sequences which are also shown in Table D (intron sequences are shown in lower case).
- Representative polynucleotides which encode examples of part B2 may comprise or consist of any one of SEQ ID NOS: 25 to 43 as shown in Table E.
- Embodiment of the invention bispecific polypeptide for OX40 and CD137
- polypeptide has binding domains which are specific for OX40 and CD137.
- binding domains are as described above.
- the bispecific polypeptide of the embodiment - binding domain specific for OX40 is as defined above.
- the binding domain specific for CD137 is as defined above, with the previously described functional and structural characteristics.
- the antibody is 1204/1205, as previously defined, with reference to the sequences of Tables H and I.
- the anti-CD137 antibody may bind to the same epitope as any of the specific anti-CD137 antibodies described herein. Preferably it binds to the same epitope as the antibody designated 1204/1205.
- the bispecific polypeptide of the embodiment is 1204/1205, as previously defined, with reference to the sequences of Tables H and I.
- the anti-CD137 antibody may bind to the same epitope as any of the specific anti-CD137 antibodies described herein. Preferably it binds to the same epitope as the antibody designated 1204/1205.
- the bispecific antibody of the invention is capable of specifically binding to both human CD137 and human OX40.
- the anti-OX40 part specifically binds to OX40 and the anti-CD137 part specifically binds to CD137, in accordance with the definitions provided for each part above.
- the bispecific antibody may comprise any anti-CD137 antibody as described herein linked to any anti-OX40 antibody as described herein.
- the binding characteristics of the different parts for their respective targets are unchanged or substantially unchanged when they are present as part of a bispecific antibody of the invention, when compared to said characteristics for the individual parts when present as separate entities.
- the bispecific molecule will have a Kd for OX40 which is preferably substantially the same as the Kd value for OX40 of the anti-OX40 antibody when present alone.
- the bispecific molecule has a Kd for OX40 which is increased relative to the Kd for OX40 of the anti-OX40 antibody when present alone, then the increase is by no more than 10 fold, preferably no more than 9 fold, 8 fold, 7 fold, 6 fold, 5 fold, 4 fold, 3 fold or 2 fold.
- the bispecific molecule will independently have a Kd for CD137 which is preferably substantially the same as the Kd value for C137 of the anti-CD137 antibody when present alone.
- the bispecific molecule has a Kd for CD137 which is increased relative to the Kd for CD137 of the anti-CD137 antibody when present alone, then the increase is by no more than 10 fold, preferably no more than 9 fold, 8 fold, 7 fold, 6 fold, 5 fold, 4 fold, 3 fold or 2 fold.
- any of the fold changes in OX40 binding may be independently combined with any of the recited fold changes in CD137 binding to describe the binding characteristics of a given bispecific molecule.
- the binding characteristics for CD137 or OX40 of any bispecific antibody of the invention may be assessed by any suitable assay.
- the assays set out above for each separate part may also be applied to a bispecific antibody or a combined assay to assess simultaneous binding to both targets may be used.
- Suitable assays for assessing the binding characteristics of bispecific polypeptides of the invention are also set out in the Examples.
- the bispecific antibody of the invention is capable of modulating the activity of cells of the immune system to a greater extent than an individual agonist of OX40 or CD137 alone, or than a combination of such individual agonists.
- administration of the bispecific antibody produces a higher level of T cell activity.
- the increase in effector T cell activity is also more localised than that which results from administration of an individual OX40 or CD137 agonist alone (or a combination thereof), because the bispecific polypeptide exerts the greatest effect only in a microenvironment in which CD137 and OX40 are both highly expressed. Tumours are such a microenvironment.
- the cell surface expression pattern of OX40 and CD137 is partly overlapping, thus, the bispecific antibodies of the invention may bind to both targets both in c/ ' s and in trans. This may result in stimulation through CD137 and OX40 in a FcyR-cross-linking independent manner, either by increasing the level of receptor clustering in cis on the same cell, or by creating an artificial immunological synapse between two cells in trans, which in turn may lead to enhanced receptor clustering and increased signalling in both cells. Overall, the result will be a very powerful, tumor directed immune activation for the generation of tumoricidal activity.
- Measurement of the effect of a bispecific antibody of the invention on cells of the immune system may be achieved with any suitable assay.
- increased activity of effector T cells may be measured by assays as described above in respect of the monospecific components of the bispecific antibody, and include measurement of proliferation or IL-2 production by CD4+ and/or CD8+ T cells in the presence of the bispecific antibody relative to a control.
- An increase of proliferation or IL-2 production relative to control is indicative of increased cell activation.
- a typical assay of this type is disclosed in Example 9 of US20080233122. Assays for cell proliferation and/or IL-2 production are well known and are also exemplified in the Examples.
- the bispecific molecule When assessed in the same assay, the bispecific molecule will typically induce an increase in the activity of an effector T cell which is at least 1.5 fold higher or at least 2 fold higher, more preferably 3 fold higher, most preferably 5 fold higher than the increase in activity of an effector T cell induced by a combination of monospecific agents binding to the same targets.
- the invention provides a bispecific antibody comprising an antibody which specifically binds to OX40 (an anti-OX40 antibody) and an antibody which specifically binds to CD137 (an anti-CD137 antibody), joined to each other directly or indirectly.
- joind indirectly it is meant that another moiety (a linker) links the anti-OX40 antibody to the anti-CD137 antibody.
- linkers include a peptide of amino acid sequence as shown in any one of SEQ ID NOs. 47 to 50, or 144.
- the peptide of sequence GGGGSGGGGSGGGGS is particularly preferred.
- the anti-OX40 antibody may be attached to any part of the anti-CD137 antibody, or to a linker, by any suitable means.
- the various parts of the polypeptide may be joined by chemical conjugation, such as with a peptide bond.
- the polypeptide of the invention may comprise or consist of a fusion protein comprising an anti-OX40 antibody (or antigen binding fragment thereof) and an anti-CD137 antibody (or antigen binding fragment thereof), optionally joined by a peptide linker.
- the CD137-binding domain or domains and the OX40-binding domain or domains may be the only binding domains present.
- carbodiimide conjugation may be used to conjugate a variety of agents, including doxorubicin, to antibodies or peptides.
- the water-soluble carbodiimide, 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) is particularly useful for conjugating a functional moiety to a binding moiety.
- conjugation may be achieved by sodium periodate oxidation followed by reductive alkylation of appropriate reactants, or by glutaraldehyde cross-linking.
- a determination should preferably be made that the anti-OX40 and anti-CD137 parts of the bispecific antibody retain or substantially retain their target binding properties when present as parts of the bispecific antibody of the invention.
- the same techniques may be used to link any antibody of the invention (directly or indirectly) to another molecule.
- the other molecule may be a therapeutic agent or a detectable label. Suitable therapeutic agents include a cytotoxic moiety or a drug.
- the bispecific antibody of the invention may comprise the anti-OX40 antibody (or antigen binding fragment thereof) and the anti-CD137 antibody (or antigen binding fragment thereof) arranged together in any suitable format. It will be appreciated that in any given bispecific format, the anti-OX40 antibody and the anti-CD137 antibody may each independently be a whole antibody or an antigen binding portion thereof.
- bispecific antibodies described herein may typically be referred to by a numbering scheme based on the composition of the OX40 binding domain (which may be referred to as binding domain 1 ) and the composition of the CD137 binding domain (which may be referred to as binding domain 2).
- the numbering scheme is therefore typically in the form VH1/VL1 for the OX40 binding domain (binding domain 1 ) and VH2/VL2 for the CD137 binding domain (binding domain 2), written together as VH1/VL1-VH2/VL2.
- the total number of binding domains and the presence or absence of constant regions may be in accordance with any suitable bispecific antibody format known in the art.
- Many suitable formats of bispecific antibody are known in the art and the bispecific antibody of the invention may be in any of these formats.
- Suitable formats include those described in Figures 1 and 19 (see also Kontermann & Brinkmann, 2015, Drug Discov Today. 838-847; the disclosures of which are incorporated herein by reference).
- constant regions are shown as filled light grey; variable heavy chain region VH1 is shown as checkered black and white; variable light chain region VL1 is shown as filled white; variable heavy chain region VH2 is shown as filled black; and variable light chain region VL2 is shown as white with diagonal lines.
- binding domain 1 OX40 binding domains
- binding domain 2 OX40 binding domains
- binding domain 2 OX40 binding domains
- binding domain 1 and 2 may be switched. That is, an OX40 binding domain may occur in any position shown in Figure 19 for a CD137 domain, and vice versa.
- a preferred format for the bispecific antibody is a kih or "knob-in-hole" arrangement, which is the first shown in the second row of Figure 19.
- the CH3 domain of the heavy chain of each antibody is mutated to allow heterodimerisation between a heavy chain from the anti-OX40 antibody and a heavy chain from the anti-CD137 antibody.
- Each heavy chain associates with its corresponding light chain to form one complete OX40 binding domain and one complete CD137 binding domain. Modifications may be made to the heavy chain CH1 regions to promote association with the correct light chain.
- Kih format bispecific antibodies are well-known in the art. See for example Ridgway et al 1996; Protein Eng 9:617-621 , the disclosures of which are incorporated herein by reference.
- scFv2-Fc format Another preferred format for the bispecific antibody of the invention is scFv2-Fc format, which is the second shown in the second row of Figure 19.
- one scFv specific for each target is fused to constant immunoglobulin domains.
- the single chains may be fused to the Fc region of the heavy chain, with one specificity fused to the N- terminal end and the other specificity fused to the C-terminal end of the Fc region (Park et al., 2000, Mol Immunol 37(18):1 123-30; the disclosures of which are incorporated herein by reference).
- Another preferred format for the bispecific antibody of the invention is the BITE/scFv2 format which is the third format shown in the second row of Figure 19.
- two scFv one specific for OX40 and the other specific for CD137, are fused together with a linker (Brischwein er a/., 2007, J Immunother 30(8):798-807; the disclosures of which are incorporated herein by reference).
- the linker may optionally include a protein that increases solubility and serum half-life, such as human serum albumin (HSA), creating scFv-HSA-scFv bispecific antibodies, as shown in the fourth row of Figure 19.
- HSA human serum albumin
- VD double variable domain
- VH2 double variable domain
- VH1 first variable heavy chain
- Another preferred format for the bispecific antibody of the invention is the Dual affinity retargeting (DART) format in which the VH1 is fused to VL2 and VH2 fused to VL1 with a short peptide linker forcing them to form VH1/VL1 and VH2/VL2 binding sites. This construct may be stabilized by formation of a disulphide bridge between the binding sites.
- the DART format may be fused to IgG Fc domains, creating monovalent bispecific antibodies (DART-Fc) or bivalent bispecific antibodies (DART2-FC) (Moore et al., 201 1 , Blood 1 17(17):4542-51 ).
- the DART, DART-Fc and DART 2 -Fc formats are shown in the third row of Figure 19.
- bispecific antibodies generated by the dock and lock technology (DNL).
- DNS dock and lock technology
- cAMP dependent protein kinase A and A kinase anchoring protein can be fused to antibodies, Fab fragments or scFv for each target, thereby generating multivalent bispecific antibodies, e.g. DNL-Fab3 (Chang ef a/., 2007, Clin Cancer Res 13(18 Pt 2):5586s-5591s, as shown in the fourth row of Figure 19; the disclosures of which are incorporated herein by reference).
- a particularly preferred format for the bispecific antibody of the invention is the scFv-lgG format.
- the anti-OX40 antibody is a whole IgG molecule and the anti-CD 37 antibody is an scFv antibody connected to the anti-OX40 antibody at any one of four general locations (heavy chain constant region; light chain constant region; heavy chain variable region; light chain variable region).
- the reverse arrangement is also envisaged. That is, with the anti-CD137 antibody as a whole IgG and the anti-OX40 antibody as an scFv connected to the anti-CD137 antibody at any one of the four general locations.
- the whole IgG molecule may be joined directly to the scFv or may be joined indirectly via a linker.
- linkers include a peptide of amino acid sequence as shown in any one of SEQ ID NOs. 47 to 50, or 144, with the peptide of sequence GGGGSGGGGSGGGGS (SEQ ID NO: 144) particularly preferred.
- the bispecific antibodies comprise two copies of a polypeptide chain which comprises the heavy chain variable sequence VH1 (checkered black and white), linked to a heavy chain constant sequence (He; filled grey), linked (optionally via a linker) to an scFv sequence consisting of the heavy chain variable sequence VH2 (filled black) and the light chain variable sequence VL2 (white with diagonal lines).
- This chain may be referred to as VH1-Hc- VH2 VL2 (ordered N terminus - C terminus).
- the bispecific antibody also comprises two copies of a smaller chain which comprises the light chain variable sequence VL1 (filled white) linked to a light chain constant sequence (Lc; filled grey), which may be referred to as VLI-Lc (ordered N terminus - C terminus).
- VLI-Lc ordered N terminus - C terminus
- the alternative scFv-lgG arrangements shown in Figure 19 also comprise two copies each of two different chains, which may be described in similar fashion.
- the second arrangement comprises two VH1-Hc chains and two VL1-Lc-VH2/VL2 chains.
- the third arrangement comprises two VH A H2-VH1-Hc chains and two VL1-Lc chains.
- the fourth arrangement comprises two VH1-Hc and two VH1/VH2-VL1-Lc chains.
- the most preferred scFv-lgG format for bispecific antibodies of the invention is the first scFv-lgG arrangement shown in Figure 19 (top left of the Figure).
- Exemplary amino acid sequences for polypeptide chains of the type VH1-Hc-VH2/VL2 from this scFv-lgG arrangement are shown in Table F and are used in the bispecific molecules of the Examples.
- the underlined/bold sequence is VH1
- the italic sequence is the heavy chain constant sequence He (typically an lgG1 constant domain in the sequences shown, but this may be replaced with any suitable IgG constant domain such as those disclosed herein)
- the underlined sequence is an optional linker
- the bold sequence is VH2
- the bold italic sequence is VL2.
- Corresponding exemplary nucleotide sequences encoding the polypeptide chains are also shown in Table F.
- the nucleotide sequences include introns.
- Exemplary amino acid sequences for polypeptide chains of the type VL1-Lc from this scFv-lgG arrangement are shown in Table G and are used in the bispecific molecules of the Examples.
- the underlined/bold sequence is VL1 and the italic sequence is the light chain constant sequence Lc (typically kappa, but may be replaced with any suitable light chain constant region).
- Lc typically kappa, but may be replaced with any suitable light chain constant region.
- Corresponding exemplary nucleotide sequences encoding the polypeptide chains are also shown in Table G.
- the present invention provides a polypeptide comprising or consisting of any of the amino acid sequences set out in Tables F and G, either alone or, preferably as part of a monospecific or bispecific antibody.
- the sequences corresponding to heavy or light chain constant regions are exemplary and may be replaced with any other suitable heavy or light chain constant region sequence.
- Preferred heavy and light chain constant region sequences are those of SEQ ID NOs: 135, 136, 137, 138 and 139.
- a bispecific or monospecific antibody of the invention may be provided in isolated or substantially isolated form.
- substantially isolated it is meant that there may be substantial, but not total, isolation of the polypeptide from any surrounding medium.
- the polypeptides may be mixed with carriers or diluents which will not interfere with their intended use and still be regarded as substantially isolated.
- An antibody of the invention may be produced by any suitable means.
- all or part of the antibody may be expressed as a fusion protein by a cell comprising a nucleotide which encodes said polypeptide.
- the individual parts may be produced separately and then subsequently joined together. Joining may be achieved by any suitable means, for example using the chemical conjugation methods and linkers outlined above. Separate production of individual parts may be achieved by any suitable means. For example by expression from separate nucleotides optionally in separate cells, as is explained in more detail below.
- Representative polynucleotides which encode all or part of an antibody of the invention may comprise or consist of any one of the nucleotide sequences set out in Tables B, F, G and H.
- a suitable polynucleotide may alternatively be a variant of any of these sequences, as defined above.
- a second aspect of the invention comprises a bispecific polypeptide according to the first aspect of the invention for use in a method for treating or preventing a disease or condition in an individual, as described above.
- a third aspect of the invention is a method of treating or preventing a disease or condition in an individual, the method comprising administering to an individual a bispecific polypeptide according to the first or second aspects of the invention, as described above.
- One embodiment of the invention is a bispecific polypeptide according to the second aspect of the invention or a method according to third aspect of the invention wherein the disease or condition is cancer and optionally wherein the individual is human.
- the method comprises administering the bispecific antibody systemically or locally, such as at the site of a tumour or into a tumour draining lymph node, as described above.
- the cancer may be prostate cancer, breast cancer, colorectal cancer, pancreatic cancer, ovarian cancer, lung cancer, cervical cancer, rhabdomyosarcoma, neuroblastoma, multiple myeloma, leukemia, acute lymphoblastic leukemia, melanoma, bladder cancer, gastric cancer, head and neck cancer, liver cancer, skin cancer, lymphoma or glioblastoma.
- a fourth aspect of the invention is a polynucleotide encoding at least one polypeptide chain of a bispecific polypeptide according to the first or second aspects of the invention, as described above.
- a fifth aspect of the invention is a composition comprising a bispecific polypeptide according to the first or second aspects of the invention and at least one pharmaceutically acceptable diluent or carrier.
- a polypeptide according to either the first or second aspect of the embodiment is conjugated to an additional therapeutic moiety.
- a sixth aspect of the invention is an antibody specific for CD137 which is as defined earlier.
- a polypeptide capable of specifically binding to both CTLA-4 and OX40 said polypeptide comprising B1 and B2, wherein:
- B1 is an antibody, or antigen binding fragment thereof, specific for OX40.
- B2 is a polypeptide binding domain specific for CTLA-4, which comprises or consists of: i) the amino acid sequence of SEQ ID NO: 3; or
- CTLA-4 specifically bound by the polypeptide is primate or murine, preferably human, CTLA-4, and/or wherein the OX40 specifically bound by the polypeptide is primate, preferably human, OX40.
- At least one heavy chain (H) and at least one light chain (L) and B2 is attached to either the heavy chain or the light chain; or - two identical heavy chains (H) and two identical light chains (L) and B2 is attached to both heavy chains or to both light chains.
- a polypeptide according to any one of the preceding paragraphs which comprises or consists of a polypeptide chain arranged according to any one of the following formulae, written in the direction N-C:
- X is a linker and n is 0 or 1.
- a polypeptide according to any one of the preceding paragraphs which binds to human OX40 with a Kd of less than 50x10- 10 M, 25x10- 10 M, or 20x10- 10 M and/or which binds to human CTLA-4 with a Kd value which is less than 60x10- 9 M, 25x10 "9 M, or 10x10 "9 M.
- a polypeptide according to any one of the preceding paragraphs which induces an increase in the activity of an effector T cell, preferably a CD4+ effector T cell, optionally wherein said increase is at least 1.5 fold, 4.5 fold or 7 fold higher than the increase in activity of an effector T cell induced by a combination of B1 and B2 administered to the T cell as separate molecules.
- a polypeptide according to paragraph 8 wherein said increase in T cell activity is an increase in proliferation and/or IL-2 production by the T cell.
- a polypeptide according to any one of the preceding paragraphs wherein 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acids in said amino acid sequence of B2 (ii) are substituted when compared to the amino acid sequence of SEQ ID NO: 3; optionally wherein there are no insertions or deletions compared to the amino acid sequence of SEQ ID NO: 3.
- a polypeptide according to any one of the preceding paragraphs wherein said amino acid sequence of B2 comprises or consists of an amino acid sequence selected from any one of SEQ ID NOs 8, 6, 7 and 9 to 24. 13. A polypeptide according to any one of the preceding paragraphs, wherein B1 exhibits at least one of the following functional characteristics when present independently of B2:
- B1 comprises any one, two, three, four, five or all six features independently selected from the following:
- a heavy chain CDR3 sequence which is 9 to 17 amino acids in length and which comprises the consensus sequence of : "A, R, G/Y/S/H, G Y/FMD, G/Y/P/F, -/H/S, -/N/D/H, -IY/G, -FY, - ⁇ , -/W/A V, -/A/Y, -/D/A/Y/G/H/N, Y/S/W7A/T, L/M/l/F, D, Y"
- a light chain CDR3 sequence which is 8 to 10 amino acids in length and comprises the consensus sequence: "Q,Q, S/Y/G, -/Y/H/G, -/S/Y/G/D, S/Y/G/D , S/Y/G T, P/L, Y/S/H/L/F, T";
- the heavy chain CDR3 sequence of (c) is preferably a sequence of 10 amino acids in length which comprises the consensus sequence "A, R, Y/H, D, Y, A Y/G, S/W/A, M/L, D, Y” or a CDR3 sequence of 11 amino acids in length which comprises the consensus sequence "A, R, G/Y, V/F/Y, P, H, G Y/H, Y, F/l, D, Y"; and
- the light chain CDR3 sequence of (f) preferably consists of the sequence "Q, Q, S, Y, S, T, P, Y, T".
- B1 comprises all three heavy chain CDR sequences of a VH sequence as shown in Table A( ) and/or all three light chain CDR sequences of a VL sequence as shown in Table A(2), or wherein B1 comprises a heavy chain VH sequence and/or a light chain VL sequence as shown in Table B.
- B1 comprises a heavy chain CDR3 sequence of 1 1 amino acids in length which comprises the consensus sequence "A, R, G/Y, V/F/Y, P, H, G/Y/H, Y, F/l, D, Y"; and the light chain VL sequence of SEQ ID NO: 97 (1135 as shown in Table B), optionally wherein the light chain VL sequence of SEQ ID NO: 97 is present as part of the longer sequence of SEQ ID NO: 129 (1141 as shown in Table D).
- B1 comprises an human Fc region or a variant of a said region, where the region is an lgG1 , lgG2, lgG3 or lgG4 region, preferably an lgG1 or lgG4 region.
- a polypeptide according to any one of the preceding paragraphs which comprises or consists of the amino acid sequence of any one of SEQ ID NOs 125 to 134, optionally wherein said polypeptide is a provided as a component part of an antibody.
- a polypeptide according to any one of the preceding paragraphs for use in a method for treating or preventing a disease or condition in an individual.
- a method of treating or preventing a disease or condition in an individual comprising administering to an individual a polypeptide according to any one of the preceding paragraphs.
- composition comprising a polypeptide according to any one of paragraphs 1 to 18 and at least one pharmaceutically acceptable diluent or carrier.
- a bispecific antibody comprising an antibody which specifically binds to OX40 (an anti-OX40 antibody) and an antibody which specifically binds to CD137 (an anti-CD137 antibody), joined to each other directly or indirectly.
- a bispecific antibody according to any one of the preceding paragraphs which binds to human OX40 with a Kd of less than 50x10- 10 M, 25x10- 10 M, or 20x10 "10 M and/or which binds to human CD137 with a Kd value which is less than 10 x10 "9 M, 4 x10 ⁇ 9 M, or 1.2x10 "9 M.
- a bispecific antibody according to any one of the preceding paragraphs which induces an increase in the activity of an effector T cell, optionally wherein said increase is at least 1.5 fold, 2 fold, 3 fold or 5 fold higher than the increase in activity of an effector T cell induced by a combination of the corresponding monospecific antibodies administered to the T cell as separate molecules.
- a bispecific antibody according to any one of the preceding paragraphs which is an scFv-lgG format bispecific antibody.
- anti-OX40 antibody comprises any one, two, three, four, five or all six features independently selected from the following:
- a heavy chain CDR2 sequence which is 8 amino acids in length and comprises the consensus sequence: " I, G/Y/S/T, G/S/Y, S Y, G/S/Y, G/S/Y, G/S/Y, T";
- a heavy chain CDR3 sequence which is 9 to 17 amino acids in length and which comprises the consensus sequence of : "A, R, G/Y/S/H, G/Y/F/V/D, G/Y/P/F, -/HIS, -/N/D/H, -/Y/G, -/Y, -/Y, -/W/AA/, -/A Y, -/D/A/Y/G/H/N, Y/S/W/A/T, L/M/l/F, D, Y"
- a light chain CDR3 sequence which is 8 to 10 amino acids in length and comprises the consensus sequence: "Q,Q, S/Y/G, -/Y/H/G, -/S/Y/G/D, S/Y/G/D , S/Y/G/T, P/L, Y/S/H/L/F, T";
- the heavy chain CDR3 sequence of (c) is preferably a sequence of 10 amino acids in length which comprises the consensus sequence "A, R, Y/H, D, Y, A Y/G, S/W/A, M/L, D, Y” or a CDR3 sequence of 11 amino acids in length which comprises the consensus sequence "A, R, G/Y, V/F/Y, P, H, G/Y/H, Y, F/l, D, Y"; and
- the light chain CDR3 sequence of (f) preferably consists of the sequence "Q, Q, S, Y, S, T, P, Y, T".
- the anti-OX40 antibody comprises all three heavy chain CDR sequences of a VH sequence as shown in Table A(1 ) and/or all three light chain CDR sequences of a VL sequence as shown in Table A(2), or wherein the anti-OX40 antibody comprises a heavy chain VH sequence and/or a light chain VL sequence as shown in Table B.
- the anti-OX40 antibody comprises a heavy chain CDR3 sequence of 1 1 amino acids in length which comprises the consensus sequence "A, R, G/Y, V/F/Y, P, H, G/Y/H, Y, F/l, D, Y"; and the light chain VL sequence of SEQ ID NO: 97 (1 135 as shown in Table B), optionally wherein the light chain VL sequence of SEQ ID NO: 97 is present as part of the longer sequence of SEQ ID NO: 129 (1 141 as shown in Table D).
- a bispecific antibody according to any one of the preceding paragraphs, wherein the anti-CD137 antibody comprises all three heavy chain CDR sequences of a VH sequence as shown in the first row of Table 1(1) and/or all three light chain CDR sequences of a VL sequence as shown in the first row of Table l(2), or wherein the anti-CD137 antibody comprises a heavy chain VH sequence and/or a light chain VL sequence as shown in Table H, SEQ ID NOs 177-180.
- a bispecific antibody according to any one of the preceding paragraphs, which comprises the amino acid sequence of any one of SEQ ID NOs 149, 151 , 153, 155, 157,
- a bispecific antibody according to any one of the preceding paragraphs which comprises the amino acid sequence of any one of SEQ ID Nos 165, 167, 169, 171 or 173.
- a bispecific antibody according to any one of the preceding paragraphs which comprises the amino acid sequences of:
- a bispecific antibody according to any one of the preceding paragraphs for use in a method for treating or preventing a disease or condition in an individual.
- a method of treating or preventing a disease or condition in an individual comprising administering to an individual a bispecific antibody according to any one of the preceding paragraphs.
- the cancer is prostate cancer, breast cancer, colorectal cancer, pancreatic cancer, ovarian cancer, lung cancer, cervical cancer, rhabdomyosarcoma, neuroblastoma, multiple myeloma, leukemia, acute lymphoblastic leukemia, melanoma, bladder cancer, gastric cancer, head and neck cancer, liver cancer, skin cancer, lymphoma or glioblastoma.
- composition comprising a bispecific antibody according to any one of paragraphs 1 to 20 and at least one pharmaceutically acceptable diluent or carrier.
- Figure 1 shows a schematic representation of the structure of exemplary arrangements for the bispecific polypeptides of the invention.
- Anti-OX40 antibody variable domains are filled in black; constant domains in white.
- CTLA-A binding domains are shaded with diagonal lines.
- Figure 2 shows the CTLA-4 binding properties of CTLA-4 binding domains of polypeptides the invention as determined by an ELISA binding assay.
- Figure 3 shows the CTLA-4 binding properties of CTLA-4 binding domains of polypeptides of the invention as determined by an ELISA inhibition assay.
- Figure 4 provides a schematic representation of human wild-type CD86 amino acid sequences disclosed herein.
- A is the amino acid sequence of the monomeric soluble extracellular domain of human CD86 without N-terminal signal sequence (SEQ ID NO: 3);
- B is the amino acid sequence of the monomeric extracellular and transmembrane domains of human wildtype CD86, including N-terminal signal sequence (SEQ ID NO: 4);
- (C) is the full length amino acid sequence of human CD86 (Genbank ABK41931.1 ; SEQ ID NO: 44).
- sequence in A may optionally lack Alanine and Proline at the N terminus, i.e. positions 24 and 25, shown in bold.
- Signal sequences in B and C are underlined. Numbering of amino acid positions is based on SEQ ID NOs: 4 and 44, starting from the N terminus.
- Figure 5 shows the results of an inhibition ELISA demonstrating that a CTLA-4 binding domains of polypeptides of the invention has binding affinity of a similar magnitude for both human and murine CTLA-4.
- Figure 6 is a plot of dissociation rate constant versus association rate constant for exemplary anti-OX40 antibodies, as determined by surface plasmon resonance.
- Figure 7 shows binding of exemplary anti-OX40 antibodies to human OX40 overexpressed on CHO cells, measured by flow cytometry.
- Figure 8 shows the level of IL-2 production by T cells when incubated in vitro with different exemplary anti-OX40 antibodies.
- the y-axis is the ratio of the top value of IL-2 production by a tested antibody / the top value of a reference antibody. Mean and SEM values from at least 4 donors are shown.
- Figure 9 shows results of an ELISA assay for binding of exemplary bispecific molecules to individual targets OX40 and CTLA4.
- Figure 10 shows results of surface plasmon resonance analysis of binding of exemplary bispecific molecules to both OX40 and CTLA4.
- the different bispecific antibodies were passed over the sensor (start indicated by I)).
- buffer was applied (II) and subsequently CTLA-4 (III) was passed over the sensor surface generating a second association phase, represented by the full line.
- buffer IV was applied, and the following dissociation phase reflects dissociation of both CTLA-4 and OX40 Ab.
- As a control only buffer, with no CTLA-4 was added, represented by the dotted line.
- Figure 11 shows results of an ELISA assay showing binding of exemplary bispecific molecules to both OX40 and CTLA-4 simultaneously.
- Figure 12 shows the level of IL-2 production by T cells when incubated in vitro with different exemplary bispecific molecules in a titration series: A) 1164/1141 and 1166/1141 B) 1168/1141 and 1170/1263 C) 1514/1581 and 1520/1141 D) 1526/1585 and 1542/1141 or a combination of the two corresponding monospecific antibodies for each target (monoclonal OX40 antibodies or the CTLA-4-binding domain coupled to an isotype IgG antibody: 1756/1757).
- the assay was performed in U-shaped non-tissue cultured treated 96-well plates coated with CD3 (UCHT1) and CTLA-4 (Orencia). Mean out of 4 donors is presented.
- Figure 13 shows the level of IL-2 production by T cells when incubated in vitro with different exemplary bispecific molecules at 1.49 nM or a combination of the corresponding monospecific antibodies for each target (a-OX40 mAbs or the CTLA-4- domain coupled to an isotype antibody: 1756/1757).
- the assay was performed in U-shaped non-tissue cultured treated 96-well plates coated with anti-CD3 (UCHT1) with or without CTLA-4 (Orencia), indicated by + or -. Mean and SD out of 4 donors is presented.
- Figure 14 shows binding of exemplary anti-CD137 antibody 1204/1205 to human and cynomolgus monkey CD137 overexpressed on CHO cells, measured by flow cytometry.
- Figure 15 shows the normalized stimulation index of IFNy production of exemplary anti- CD137 antibody 1204/1205 compared with reference antibody 111/112 in a CD8 T cell agonist assay.
- Figure 16 shows the level of IL-2 production by T cells when incubated in vitro with different exemplary bispecific molecules in a titration series: A) 1164/1135-1204/1205. B) 1166/1167-1204/1205, C) 1168/1135-1204/1205, D) 1170/1171-1204/1205, E) 1482/1483-1204/1205, F) 1520/1135-1204/1205, G) 1526/1527-1204/1205, H) 1542/1135-1204/1205; or a combination of the two corresponding monospecific antibodies for each target.
- An isotype control 1188/1187 (lgG1 ) is used as a negative control in all experiments.
- the cells were cultured for 72h in U-shaped non-tissue cultured treated 96- well plates coated with anti-CD3 antibody (UCHT1 ).
- Mean IL-2 levels of 2 donors is presented.
- Figure 17 shows the level of IL-2 production by peripheral blood mononuclear cells when incubated in vitro with exemplary bispecific molecule 1164/1135-1204/1205 at 1 nM, compared to the corresponding monospecific antibodies for each target: anti-OX40 mAb 1164/1135 or mAb anti-CD137 1204/1205 or an isotype control 1188/1187 (lgG1).
- FIG. 18 shows results of an ELISA assay showing binding of exemplary bispecific molecules to both OX40 and CD137 simultaneously.
- Figure 19 shows a schematic representation of the structure of exemplary formats for bispecific antibodies of the invention.
- the constant regions are shown as filled light grey; variable heavy chain regions VH1 are shown as checkered black and white; variable light chain regions VL1 are shown as filled white; variable heavy chain regions VH2 are shown as filled black; and variable light chain regions VL2 are shown as white with diagonal lines.
- OX40 binding domains (binding domain 1 ) are typically represented as a pair of a checkered black and white domain with a filled white domain (VH1/VL1 );
- CD137 binding domains (binding domain 2) are typically represented as a pair of a filled black domain and a white domain with diagonal lines (VH2/VL2).
- binding domains 1 and 2 may be switched. That is, an OX40 binding domain may occur in a position shown in this figure for a CD137 domain, and vice versa. Furthermore, binding domain 2 may occur in different variable heavy and light chain orders, i.e. either in VH2/VL2 or VL2 VH2 order.
- Figure 20 shows binding of the different CD137 antibodies to human CD137 and cynomolgus CD137 expressed on cells and measured by flow cytometry.
- Figure 22 shows the results from an example were the ability to block CD137L binding was evaluated. 100% binding reflects no blocking. Signals below 100% reflects blocking of the binding (antibody concentration from left to right 0.25, 2.5 and 25 g/ml).
- Figure 23 shows the ability of monospecific CD137 antibodies to stimulate CD8 T cells as measured by IFNy release.
- Figure 24 shows the results from a dual ELISA.
- CD137 was coated to an ELISA well and the bispecific antibody was added at different concentrations. Binding was detected using biotinylated CTLA-4.
- Figure 25 shows IFNy levels in supernatants measured from human CD8 positive T cells stimulated with 1.5 nM CD137-CTLA4 bispecific antibodies or an isotype control with CTLA-4 binding only. The assay was performed on plates coated with CD3 with or without CTLA-4.
- Figure 26 shows full dilution curve of IFNy levels in supernatants measured from human CD8 positive T cells stimulated with CD137-CTLA4 bispecific antibodies (at different concentrations) or an isotype control with CTLA-4 binding only.
- the assay was performed on plates coated with CD3 with CTLA-4.
- Figure 27 shows induction of ADCC at different concentration by monospecific CTLA-4 (Control IgG with CTLA-4 binding part, i.e. domain) and OX40 (1166/1167) binding molecules, alone and in combination, compared to ADCC induced by an exemplary bispecific antibody targeting CTLA-4 and OX40.
- Figure 28 CHO cells expressing both CTLA-4 and OX40 were stained with decreasing concentrations of 1166/1261 , or the two monospecific binders 1166/1167 (OX40 specific monoclonal antibody) and control IgG with CTLA-4 binding part (monospecific CTLA4 binding IgG fusion protein) (200 nM - 0,0034 nM), followed by PE-conjugated anti-human IgG. Fluorescence was detected using flow cytometry. 'Ctr IgG' is a negative isotype control.
- FIG. 29 HEK-CTLA4 and CHO-OX40 were stained with PKH26 and PKH67 respectively and incubated with 1 66/1261 or a combination of the two monospecific OX40 and CTLA-4 binding molecules (1166/1167 and Control IgG with CTLA-4 binding part). The percentage of double-positive/aggregated cells were quantified using flow cytometry (representative experiment).
- FIG. 30 Plasma levels of the bispecific OX40-CTLA-4 antibody 1166/1261 and the monospecific OX40 antibody 1166/1167 measured at different time points following administration. Two different ELISA methods were used, ELISA-1 , where OX40 was coated on the wells and anti-Fc was used to detect binding and ELISA-2, where OX40 was coated on the wells and biotinylated CTLA-4 was used for detection.
- HT-29 colon carcinoma cells (4x10 6 ) were inoculated subcutaneously to the right hind flank/back at day 0.
- Human PBMC cells (7x10 6 ) were administered intraperitoneally on the same day. The treatments were done by intraperitoneal injections (667nmol/dose) on days 6, 13, and 20.
- SEQ ID NO: 1 is the amino acid sequence of human CTLA-4 (corresponding to GenBank: AAD00698.1 )
- SEQ ID NO: 2 is the amino acid sequence of human CD28 (corresponding to GenBank: AAA51944.1 )
- SEQ ID NO: 3 is the amino acid sequence of the monomeric extracellular domain of human wildtype CD86, excluding a 23 amino acid signal sequence from the N terminus.
- SEQ ID NO: 4 is the amino acid sequence of the monomeric extracellular and transmembrane domains of human wildtype CD86, including N-terminal signal sequence (see Figure 4). All numbering of amino acid positions herein is based on the positions in SEQ ID NO: 4 starting from the N terminus. Thus, the Alanine at the N terminus of SEQ ID NO: 3 is numbered 24.
- SEQ ID NO: 5 is the amino acid sequence of a mutant form of the extracellular domain of human CD86 disclosed in Peach et al (Journal of Biological Chemistry 1995, vol 270(36), 21181-21 187). H at position 79 of the wild type sequence is substituted with A in the corresponding position for the sequence of SEQ ID NO: 5. This change is referred to herein as H79A. Equivalent nomenclature is used throughout for other amino acid substitutions referred to herein. Numbering of positions is based on SEQ ID NO: 4 as outlined above.
- SEQ ID NOs: 6 to 24 are the amino acid sequences of specific proteins of the invention.
- SEQ ID NOs: 25 to 43 are nucleotide sequences encoding the amino acid sequences of each of SEQ ID NOs 6 to 24, respectively
- SEQ ID NO: 44 is the full length amino acid sequence of human CD86 (corresponding to GenBank: ABK41931.1 )
- SEQ ID NO: 45 is the amino acid sequence of murine CTLA-4 (corresponding to UniProtKB/Swiss-Prot: P09793.1 ).
- SEQ ID NO: 46 is the amino acid sequence of murine CD28 (corresponding to GenBank: AAA37395.1 ).
- SEQ ID Nos: 47 to 50 are various linkers which may be used in the bispecific polypeptides of the invention.
- SEQ ID NO: 51 is the amino acid sequence of human OX40 (corresponding to GenBank: NP_003318.1 )
- SEQ ID NOs: 52 to 88 are exemplary CDR sequences of anti-OX40 antibodies disclosed herein.
- SEQ ID Nos: 89 to 124 are exemplary amino acid and nucleotide sequences of the heavy and light chain variable regions of antibodies disclosed herein.
- SEQ ID Nos: 125 to 134 are exemplary amino acid and nucleotide sequences of bispecific polypeptides disclosed herein.
- SEQ ID NO: 135 is an exemplary heavy chain constant region amino acid sequence.
- SEQ ID NO: 136 is an exemplary light chain constant region amino acid sequence.
- SEQ ID NO: 137 is an exemplary modified human heavy chain lgG4 constant region sequence with a mutation from Ser to Pro in the hinge region (position 108) and from His to Arg in the CH3 region (position 315). Mutations result in reduced serum half-life and stabilization of the core hinge of lgG4 making the lgG4 more stable, preventing Fab arm exchange.
- SEQ ID NO: 138 is an exemplary wild type human heavy chain lgG4 constant region sequence. That is a sequence lacking the mutations of SEQ ID NO: 137.
- SEQ ID NO: 139 is an exemplary modified human heavy chain lgG4 constant region sequence with a single mutation from Ser to Pro in the hinge region (position 108). Mutation results in stabilization of the core hinge of lgG4 making the lgG4 more stable, preventing Fab arm exchange.
- SEQ ID NO: 140 is an exemplary cDNA sequence (i.e. lacking introns) encoding the lgG4 constant region of SEQ ID NO: 137.
- SEQ ID NO: 141 is an exemplary genomic DNA sequence (i.e. including introns) encoding the lgG4 constant region of SEQ ID NO: 137
- SEQ ID NO: 142 is an exemplary cDNA sequence (i.e. lacking introns) encoding the lgG4 constant region of SEQ ID NO: 138.
- SEQ ID NO: 143 is an exemplary genomic DNA sequence (i.e. including introns) encoding the lgG4 constant region of SEQ ID NO: 138.
- SEQ ID NO 144 is a linker which may be used in the bispecific polypeptides of the invention.
- SEQ ID NOs: 145 and 146 are exemplary cDNA and genomic DNA sequences, respectively, encoding the lgG1 constant region of SEQ ID NO: 135.
- SEQ ID NOs: 147 is an exemplary DNA sequence encoding the light chain kappa region of SEQ ID NO: 136.
- SEQ ID NO: 148 is the amino acid sequence of human CD137 (corresponding to GenBank: AAH06196.1)
- SEQ ID NOs: 149 to 174 are amino acid and nucleotide sequences of exemplary bispecific antibodies disclosed herein.
- SEQ ID NO: 175 is an exemplary cDNA sequence (i.e. lacking introns) encoding the lgG4 region of SEQ ID NO: 139.
- SEQ ID NO: 176 is an exemplary genomic DNA sequence (i.e. including introns) encoding the lgG4 region of SEQ ID NO: 139.
- SEQ ID NOs: 177 to 196 are exemplary amino acid and nucleotide sequences of the heavy and light chain variable regions of anti-CD137 antibodies disclosed herein.
- SEQ ID NOs: 197 to 206 are exemplary bispecific polypeptides of the invention.
- SEQ ID NOs 207 to 226 correspond to exemplary CDR sequences for CD137 binding domains (as do SEQ ID NOs 80 and 81 )
- CCTGTGCAG CC AG CG G ATTCACCTTTAG CAG CTATG CCATG AG CTGG GTCCG CCAG G CTCCA G G G AAG G GG CTGG AGTG G GTCTCAG GTATTT CTTACTACG GTGGTTACACATACTATG CAG AC TCCGTGAAGGGCCGGTTCACCATCTCCCGTG ACAATTCCAAGAACACGCTGTATCTGCAAATG AACAG CCTG CGTG CCG AGG ACACG GCTGTAT ATTATTGTGCGCGCTACTACCCGCATCATTAC ATTGACTATTGGGGCCAGGGAACCCTGGTCA CCGTCTCCTCA
- 1 141 1135 aa DIQMTQSPSSLSASVGDRVTITCRASQSISSYLN light chain VL, WYQQKPGKAPKLLIYAASSLQSGVPSRFSGSG with constant SGTDFTLTISSLQPEDFATYYCQQSYSTPYTFG kappa QGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASW sequence, linker CLLNNFYPREAKVQWKVDNALQSGNSQESVTE (underlined) and QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH CD86 mutant QGLSSPVTKSFNRGECSGGGGSGGGGSAPLKI 1040 QAYFNETADLPCQFANSQNLSLSELWFWQDQ
- 1581 1515 aa DIQMTQSPSSLSASVGDRVTITCRASQSISSYLN light chain VL, WYQQKPGKAPKLLIYAASSLQSGVPSRFSGSG with constant SGTDFTLTISSLQPEDFATYYCQQGDYTLFTFG kappa QGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASW sequence, linker CLLNNFYPREAKVQWKVDNALQSGNSQESVTE (underlined) and QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTH CD86 mutant QGLSSPVTKSFNRGECSGGGGSGGGGSAPLKI 1040 QAYFNETADLPCQFANSQNLSLSELWFWQDQ
- AAATC AAAG ATAAG G GTAG GTACCAGTG CATT
- CTGGCG 133 1585 1527 aa DIQMTQSPSSLSASVGDRVTITCRASQSISSYLN light chain VL, WYQQKPGKAPKLLIYAASSLQSGVPSRFSGSG with constant SGTDFTLTISSLQPEDFATYYCQQYGSDSLLTF kappa GQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASV sequence, linker VCLLNNFYPREAKVQWKVDNALQSGNSQESVT (underlined) and EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT CD86 mutant HQGLSSPVTKSFNRGECSGGGGSGGGGSAPL 1040 KIQAYFNETADLPCQFANSQNLSLSELWFWQD
- GAGGTGCAGCTGTTGGAGAGCGGGGGAGGCTTGGT sequence ACAGCCTGGGGGGTCCCTGCGCCTCTCCTGTGCAG encoding SEQ ID CCAGCGGATTCACCTTTTACGGTTCTTCTATGTACTG NO: 149 GGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGG
- This sequence typically expressed together with a light chain sequence comprising VL1 1 167 (SEQ ID NO: 89) fused to kappa sequence (SEQ ID NO: 136) to assemble a 1 166/1 167-1204/1205 bispecific antibody.
- Nucleotide G AGGTG C AG CTGTTG G AG AGCG G G GG AG G CTTGGT sequence ACAGCCTGGGGGGTCCCTGCGCCTCTCCTGTGCAG encoding SEQ ID CC AG CG G ATTC ACCTTTG GTGGTTACTACATGTCTT NO: 151 G GGTCCG CC AGG CTCCAG GG AAG GG G CTG G AGTG
- CAGCAACACCAAGGTGGACAAGAAAGTTGgtgagaggc cagcacagggagggagggtgtctgctggaagccaggctcagcgctcctgc ctggacgcatcccggctatgcagccccagtccagggcagcaaggcaggcc ccgtctgcctcacccggaggcctctgcccccactcatgctcagggag agggtcttctggctttttccccaggctctgggcaggcaggctaggtgcccct aacccaggccctgcacacaaaggggcaggtgctgggctgggctcagacctgcca agagccatatccgggaggaccctgcccctgacctaagcccaccccaagg ccaaactct
- This sequence typically expressed together with a light chain sequence comprising VL1 1135 (SEQ ID NO: 97) fused to kappa sequence (SEQ ID NO: 136) to assemble a 1 168/1135-1204/1205 bispecific antibody.
- VH1 1170 (bold EVQLLESGGGLVQPGGSL LSCAASGFTFGGYYMSW underlined) VRQAPG KG LEWVSYI PGSGG STYYADSVKG RFTI SRD lgG1 constant NSKNTLYLQMNSLRAE DT AVYYC ARYDYYWM D YWG domains (italics) QGTLVfVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV Linker KD YFPEPVTVS WNSGALTS G VHTFPA VL QSS GLYSLS (underlined) S VVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCD VH2: 1204 (bold) KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV VL2: 1205 (bold, TC VVVD VSHEDPEVKFNWYVDGVEVHNA KTKPREEQ italics) YNS TYR V
- This sequence typically expressed together with a light chain sequence comprising VL1 1171 (SEQ ID NO: 93) fused to kappa sequence (SEQ ID NO: 136) to assemble a 1 170/1 171-1204/1205 bispecific antibody.
- CAGCAACACCAAGGTGGACAAGAAAGTTGgtgagaggc cagcacagggagggagggtgtctgctggaagccaggctcagcgctcctgc ctggacgcatcccggctatgcagccccagtccagggcagcaaggcaggcc ccgtctgcctcacccggaggcctctgcccccactcatgctcagggag agggtcttctggctttttccccaggctctgggcaggcaggctaggtgcccct aacccaggccctgcacacaaaggggcaggtgctgggctgggctcagacctgcca agagccatatccgggaggaccctgcccctgacctaagcccaccccaagg ccaaactct
- This sequence typically expressed together with a light chain sequence comprising VL1 1483 (SEQ ID NO: 103) fused to kappa sequence (SEQ ID NO: 136) to assemble a 1482/1483-1204/1205 bispecific antibody.
- Nucleotide GAGGTGCAGCTGTTGGAGAGCGGGGGAGGCTTGGT sequence ACAG CCTGGGG G GTCCCTG CG CCTCTCCTGTG CAG encoding SEQ ID CC AG CGG ATTCACCTTTAG CAG CTATGCCATG AG CT NO: 157 GGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTG
- CAG G G AACCCTG GTCACCGTCTCCTCAG GTG AGTTa aCgtacgctagcaagctttctggggcaggccaggcctgaccttggctttggg gcagggagggggctaaggtgaggcaggtggcgccagccaggtgcacac ccaatgcccatgagcccagacactggacgctgaacctcgcggacagttaa gaacccaggggcctctgcgcctgggcccagctctgtcccacaccgcggtc acatggcaccacctctcttgcagCCTCCACCAAGGGCCCATCG
- This sequence typically expressed together with a light chain sequence comprising VL1 1135 (SEQ ID NO: 97) fused to kappa sequence (SEQ ID NO: 136) to assemble a 1520/1135-1204/1205 bispecific antibody.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/567,163 US11008396B2 (en) | 2015-05-21 | 2016-05-20 | Polypeptides |
| KR1020177033709A KR102712820B1 (ko) | 2015-05-21 | 2016-05-20 | 신규한 폴리펩타이드 |
| EP21202262.8A EP3988577A1 (en) | 2015-05-21 | 2016-05-20 | Anti-cd137 antibodies |
| RU2017142008A RU2017142008A (ru) | 2015-05-21 | 2016-05-20 | Новые полипептиды |
| CN202111495490.3A CN114181309B (zh) | 2015-05-21 | 2016-05-20 | 新型多肽 |
| CA2986415A CA2986415A1 (en) | 2015-05-21 | 2016-05-20 | Anti-cd137 antibodies |
| JP2017560535A JP2018520650A (ja) | 2015-05-21 | 2016-05-20 | 新規のポリペプチド |
| MX2017014699A MX2017014699A (es) | 2015-05-21 | 2016-05-20 | Polipeptidos novedosos. |
| CN201680028916.5A CN107709367A (zh) | 2015-05-21 | 2016-05-20 | 新型多肽 |
| BR112017024770A BR112017024770A2 (pt) | 2015-05-21 | 2016-05-20 | polipeptídeos inovadores |
| EP16724036.5A EP3298045A1 (en) | 2015-05-21 | 2016-05-20 | Novel polypeptides |
| IL255767A IL255767B2 (en) | 2015-05-21 | 2016-05-20 | Novel polypeptides |
| AU2016265447A AU2016265447B2 (en) | 2015-05-21 | 2016-05-20 | Novel polypeptides |
| US16/780,401 US10774150B2 (en) | 2015-05-21 | 2020-02-03 | Polypeptides |
| US17/229,130 US11780928B2 (en) | 2015-05-21 | 2021-04-13 | Polypeptides |
| JP2022077013A JP7419434B2 (ja) | 2015-05-21 | 2022-05-09 | 新規のポリペプチド |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB1508729.9 | 2015-05-21 | ||
| GBGB1508729.9A GB201508729D0 (en) | 2015-05-21 | 2015-05-21 | Binding molecules |
| GBGB1514994.1A GB201514994D0 (en) | 2015-08-24 | 2015-08-24 | Bispecific polypeptide |
| GB1514994.1 | 2015-08-24 | ||
| GB1605450.4 | 2016-03-31 | ||
| GB201605450 | 2016-03-31 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/567,163 A-371-Of-International US11008396B2 (en) | 2015-05-21 | 2016-05-20 | Polypeptides |
| US16/780,401 Continuation US10774150B2 (en) | 2015-05-21 | 2020-02-03 | Polypeptides |
| US17/229,130 Continuation US11780928B2 (en) | 2015-05-21 | 2021-04-13 | Polypeptides |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016185016A1 true WO2016185016A1 (en) | 2016-11-24 |
Family
ID=56026872
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/061420 Ceased WO2016185016A1 (en) | 2015-05-21 | 2016-05-20 | Novel polypeptides |
Country Status (12)
| Country | Link |
|---|---|
| US (3) | US11008396B2 (OSRAM) |
| EP (2) | EP3988577A1 (OSRAM) |
| JP (2) | JP2018520650A (OSRAM) |
| KR (1) | KR102712820B1 (OSRAM) |
| CN (2) | CN107709367A (OSRAM) |
| AU (1) | AU2016265447B2 (OSRAM) |
| BR (1) | BR112017024770A2 (OSRAM) |
| CA (1) | CA2986415A1 (OSRAM) |
| IL (1) | IL255767B2 (OSRAM) |
| MX (1) | MX2017014699A (OSRAM) |
| RU (1) | RU2017142008A (OSRAM) |
| WO (1) | WO2016185016A1 (OSRAM) |
Cited By (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017077085A3 (en) * | 2015-11-04 | 2017-06-22 | Cancer Research Technology | Immunomodulatory antibodies |
| WO2017182672A1 (en) * | 2016-04-22 | 2017-10-26 | Alligator Bioscience Ab | Novel bispecific polypeptides against cd137 |
| WO2018002339A1 (en) * | 2016-07-01 | 2018-01-04 | Alligator Bioscience Ab | Bispecific antibodies directed against ox40 and a tumor-associated antigen |
| WO2018056821A1 (en) * | 2016-09-23 | 2018-03-29 | Merus N.V. | Binding molecules that modulate a biological activity expressed by a cell |
| WO2018091739A1 (en) | 2016-11-21 | 2018-05-24 | Alligator Bioscience Ab | Bispecific polypeptides to gitr and ctla-4 |
| WO2018091740A3 (en) * | 2016-11-21 | 2018-06-28 | Alligator Bioscience Ab | Novel anti_cd137 antibodies and uses thereof |
| WO2018202649A1 (en) * | 2017-05-02 | 2018-11-08 | Alligator Bioscience Ab | Bispecific antibody against ox40 and ctla-4 |
| WO2018237157A1 (en) * | 2017-06-22 | 2018-12-27 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
| WO2019016402A1 (en) | 2017-07-20 | 2019-01-24 | Aptevo Research And Development Llc | BINDING PROTEINS BINDING AT 5T4 AND 4-1BB, COMPOSITIONS AND METHODS RELATED THERETO |
| US10279039B2 (en) | 2017-07-11 | 2019-05-07 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| WO2019175806A1 (en) * | 2018-03-13 | 2019-09-19 | Vascular Biogenics Ltd. | Bispecific antibodies to mospd2 and t cell- or nk cell-specific molecules |
| WO2019214624A1 (en) | 2018-05-11 | 2019-11-14 | Wuxi Biologics (Shanghai) Co., Ltd. | Fully human antibodies against ox40, method for preparing same, and use thereof |
| WO2020011966A1 (en) * | 2018-07-12 | 2020-01-16 | F-Star Beta Limited | Antibody molecules that bind cd137 and ox40 |
| JP2020504101A (ja) * | 2016-12-15 | 2020-02-06 | アッヴィ・バイオセラピューティクス・インコーポレイテッド | 抗ox40抗体及びそれらの使用 |
| KR20200038997A (ko) * | 2017-08-21 | 2020-04-14 | 아다진 인크. | 항-cd137 분자 및 이의 용도 |
| WO2021146328A1 (en) | 2020-01-13 | 2021-07-22 | Aptevo Research And Development Llc | Formulations for protein therapeutics |
| WO2021146336A1 (en) | 2020-01-13 | 2021-07-22 | Aptevo Research And Development Llc | Methods and compositions for preventing adsorption of therapeutic proteins to drug delivery system components |
| US11214618B2 (en) | 2016-06-20 | 2022-01-04 | F-Star Therapeutics Limited | LAG-3 binding members |
| US11214620B2 (en) | 2016-06-20 | 2022-01-04 | F-Star Therapeutics Limited | Binding molecules binding PD-L1 and LAG-3 |
| JP2022024054A (ja) * | 2017-05-19 | 2022-02-08 | ウーシー バイオロジクス(シャンハイ)カンパニー リミテッド | 細胞傷害性tリンパ球関連タンパク質4(ctla-4)に対する新規モノクローナル抗体 |
| WO2022246244A1 (en) | 2021-05-21 | 2022-11-24 | Aptevo Research And Development Llc | Dosing regimens for protein therapeutics |
| US11548948B2 (en) | 2017-12-19 | 2023-01-10 | F-Star Therapeutics Limited | FC binding fragments comprising a PD-L1 antigen-binding site |
| US11629193B2 (en) | 2016-07-19 | 2023-04-18 | F-Star Therapeutics Limited | EGFR binding molecules |
| US11697682B2 (en) | 2020-09-10 | 2023-07-11 | Vascular Biogenics Ltd. | Motile sperm domain containing protein 2 antibodies and methods of use thereof |
| US11718679B2 (en) | 2017-10-31 | 2023-08-08 | Compass Therapeutics Llc | CD137 antibodies and PD-1 antagonists and uses thereof |
| US11851497B2 (en) | 2017-11-20 | 2023-12-26 | Compass Therapeutics Llc | CD137 antibodies and tumor antigen-targeting antibodies and uses thereof |
| US11939388B2 (en) | 2016-07-14 | 2024-03-26 | Genmab A/S | Multispecific antibodies against CD40 and CD137 |
| US11952681B2 (en) | 2018-02-02 | 2024-04-09 | Adagene Inc. | Masked activatable CD137 antibodies |
| RU2817602C2 (ru) * | 2018-07-12 | 2024-04-16 | Ф-Стар Тарапьютикс Лимитед | Молекулы антител, которые связывают cd137 и ox40 |
| US12103976B2 (en) | 2018-07-12 | 2024-10-01 | Invox Pharma Limited | Fc binding fragments comprising a CD137 antigen-binding site |
| US12109264B2 (en) | 2015-07-31 | 2024-10-08 | Immunewalk Therapeutics, Inc. | Motile sperm domain containing protein 2 and inflammation |
| WO2024192308A3 (en) * | 2023-03-14 | 2024-11-07 | Xencor, Inc. | Anti-cd28 compositions |
| EP4389226A3 (en) * | 2017-02-24 | 2024-12-18 | MacroGenics, Inc. | Bispecific binding molecules that are capable of binding cd137 and tumor antigens, and uses thereof |
| US12247074B2 (en) | 2018-07-12 | 2025-03-11 | Invox Pharma Limited | Antibody molecules |
| US12297283B2 (en) | 2018-07-12 | 2025-05-13 | Invox Pharma Limited | Fc binding fragments comprising an OX40 antigen-binding site |
| US12319739B2 (en) | 2018-07-12 | 2025-06-03 | Invox Pharma Limited | Mesothelin and CD137 binding molecules |
| US12325742B2 (en) | 2018-07-12 | 2025-06-10 | Invox Pharma Limited | Anti-mesothelin antibodies |
| US12344672B2 (en) | 2018-07-12 | 2025-07-01 | Invox Pharma Limited | Antibody molecules that bind PD-L1 and CD137 |
| US12365743B2 (en) | 2022-02-23 | 2025-07-22 | Xencor, Inc. | Anti-CD28 x anti-PSMA antibodies |
| US12384845B2 (en) | 2018-12-26 | 2025-08-12 | Xilio Development, Inc. | Activatable masked anti-CTLA4 binding proteins |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA3059366A1 (en) | 2017-04-13 | 2018-10-18 | Agenus Inc. | Anti-cd137 antibodies and methods of use thereof |
| AU2019387482A1 (en) * | 2018-11-30 | 2021-06-17 | Memorial Sloan Kettering Cancer Center | Heterodimeric tetravalency and specificity antibody compositions and uses thereof |
| EP3898679A2 (en) * | 2018-12-17 | 2021-10-27 | Alligator Bioscience AB | Polypeptides |
| AU2020263959A1 (en) | 2019-04-24 | 2021-11-25 | Heidelberg Pharma Research Gmbh | Amatoxin antibody-drug conjugates and uses thereof |
| EP4013506A1 (en) * | 2019-08-12 | 2022-06-22 | Aptevo Research and Development LLC | 4-1bb and ox40 binding proteins and related compositions and methods, antibodies against 4-1bb, antibodies against ox40 |
| EP4041772A4 (en) * | 2019-10-11 | 2024-04-24 | Nanjing Leads Biolabs Co., Ltd. | 4-1BB-BINDING ANTIBODIES AND USES THEREOF |
| CN113045655A (zh) * | 2019-12-27 | 2021-06-29 | 高诚生物医药(香港)有限公司 | 抗ox40抗体及其用途 |
| CA3180665A1 (en) | 2020-05-19 | 2021-11-25 | Boehringer Ingelheim International Gmbh | Binding molecules for the treatment of cancer |
| US20240150483A1 (en) * | 2021-02-17 | 2024-05-09 | Aptevo Research And Development Llc | COMPOSITIONS COMPRISING 4-1BB and OX40 BINDING PROTEINS AND METHODS OF USE |
| US12195546B2 (en) | 2022-12-19 | 2025-01-14 | Sanofi | CD28/OX40 bispecific antibodies |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100303811A1 (en) * | 2008-06-16 | 2010-12-02 | Atsuo Ochi | Recombinant multiple domain fusion protein mitogens and use thereof for inducing enhancement or repression of antigen-specific immunity. |
| WO2014207064A1 (en) * | 2013-06-27 | 2014-12-31 | Alligator Bioscience Ab | Bispecific molecules capable of specifically binding to both ctla-4 and cd40 |
| WO2015095423A2 (en) * | 2013-12-17 | 2015-06-25 | Genentech, Inc. | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
Family Cites Families (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EE05627B1 (et) | 1998-12-23 | 2013-02-15 | Pfizer Inc. | CTLA-4 vastased inimese monoklonaalsed antikehad |
| KR100452954B1 (ko) * | 2002-02-26 | 2004-10-14 | 주식회사 엘지생명과학 | 가변영역 아미노산 치환을 통한 인간 4-1비비분자에 대한결합 특이성이 증가된 변형 인간화 항체의 제조방법 |
| EP1590372A2 (en) * | 2003-02-06 | 2005-11-02 | Micromet AG | Trimeric polypeptide construct to induce an enduring t cell response |
| CN1894413A (zh) * | 2003-03-26 | 2007-01-10 | 特鲁比昂药品公司 | 识别cd3或4-1bb的抗体或基因介导的肿瘤反应性淋巴细胞活化 |
| AR046094A1 (es) * | 2003-10-10 | 2005-11-23 | Bristol Myers Squibb Co | Anticuerpos completamente humanos contra 4-1bb humano |
| US20070253961A1 (en) * | 2004-06-09 | 2007-11-01 | Ulsan Industrial Education Foundation | Pharmaceutical Composition Comprising the Anti-4-1Bb Antibody for Treating or Preventing Rheumatoid Arthritis |
| WO2006088447A1 (en) | 2005-02-15 | 2006-08-24 | Gtc Biotherapeutics, Inc. | An anti-cd137 antibody as an agent in the treatement of cancer and glycosylation variants thereof |
| ES2667863T3 (es) | 2007-03-29 | 2018-05-14 | Genmab A/S | Anticuerpos biespecíficos y métodos de producción de los mismos |
| SG186656A1 (en) * | 2007-12-14 | 2013-01-30 | Bristol Myers Squibb Co | Binding molecules to the human ox40 receptor |
| US9150663B2 (en) | 2010-04-20 | 2015-10-06 | Genmab A/S | Heterodimeric antibody Fc-containing proteins and methods for production thereof |
| SG10201912092VA (en) * | 2010-09-09 | 2020-02-27 | Pfizer | 4-1bb binding molecules |
| US20140178368A1 (en) | 2011-04-19 | 2014-06-26 | Leslie Lynne SHARP | Combinations of anti-4-1bb antibodies and adcc-inducing antibodies for the treatment of cancer |
| WO2014043708A1 (en) | 2012-09-17 | 2014-03-20 | Traber Peter G | Method for enhancing specific immunotherapies in cancer treatment |
| GB201311475D0 (en) | 2013-06-27 | 2013-08-14 | Alligator Bioscience Ab | Polypeptides |
| AU2016219772A1 (en) * | 2015-02-22 | 2017-09-21 | Sorrento Therapeutics, Inc. | Antibody therapeutics that bind CD137 |
-
2016
- 2016-05-20 CN CN201680028916.5A patent/CN107709367A/zh active Pending
- 2016-05-20 JP JP2017560535A patent/JP2018520650A/ja active Pending
- 2016-05-20 EP EP21202262.8A patent/EP3988577A1/en active Pending
- 2016-05-20 IL IL255767A patent/IL255767B2/en unknown
- 2016-05-20 EP EP16724036.5A patent/EP3298045A1/en not_active Withdrawn
- 2016-05-20 CN CN202111495490.3A patent/CN114181309B/zh active Active
- 2016-05-20 KR KR1020177033709A patent/KR102712820B1/ko active Active
- 2016-05-20 MX MX2017014699A patent/MX2017014699A/es unknown
- 2016-05-20 BR BR112017024770A patent/BR112017024770A2/pt not_active IP Right Cessation
- 2016-05-20 AU AU2016265447A patent/AU2016265447B2/en active Active
- 2016-05-20 WO PCT/EP2016/061420 patent/WO2016185016A1/en not_active Ceased
- 2016-05-20 US US15/567,163 patent/US11008396B2/en not_active Expired - Fee Related
- 2016-05-20 CA CA2986415A patent/CA2986415A1/en active Pending
- 2016-05-20 RU RU2017142008A patent/RU2017142008A/ru unknown
-
2020
- 2020-02-03 US US16/780,401 patent/US10774150B2/en not_active Expired - Fee Related
-
2021
- 2021-04-13 US US17/229,130 patent/US11780928B2/en active Active
-
2022
- 2022-05-09 JP JP2022077013A patent/JP7419434B2/ja active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100303811A1 (en) * | 2008-06-16 | 2010-12-02 | Atsuo Ochi | Recombinant multiple domain fusion protein mitogens and use thereof for inducing enhancement or repression of antigen-specific immunity. |
| WO2014207064A1 (en) * | 2013-06-27 | 2014-12-31 | Alligator Bioscience Ab | Bispecific molecules capable of specifically binding to both ctla-4 and cd40 |
| WO2015095423A2 (en) * | 2013-12-17 | 2015-06-25 | Genentech, Inc. | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
Non-Patent Citations (10)
| Title |
|---|
| AMANI MAKKOUK, ET. AL.: "Three Steps to Breaking Immune Tolerance: A Microparticle Approach", 2014, XP002759892, Retrieved from the Internet <URL:http://www.bloodjournal.org/content/124/21/4504> [retrieved on 20160714] * |
| HORNIG NORA ET AL: "Evaluating combinations of costimulatory antibody-ligand fusion proteins for targeted cancer immunotherapy.", CANCER IMMUNOLOGY, IMMUNOTHERAPY : CII AUG 2013, vol. 62, no. 8, August 2013 (2013-08-01), pages 1369 - 1380, XP002759886, ISSN: 1432-0851 * |
| HOUOT ROCH ET AL: "T Cell Modulation Combined with Intratumoral CpG Cures Lymphoma without the Need for Chemotherapy", BLOOD, vol. 112, no. 11, November 2008 (2008-11-01), & 50TH ANNUAL MEETING OF THE AMERICAN- SOCIETY-OF-HEMATOLOGY; SAN FRANCISCO, CA, USA; DECEMBER 06 -09, 2008, pages 561, XP002759893, ISSN: 0006-4971 * |
| LINCH, S. N. ET AL.: "Combined ligation plus CTLA-4 blockade", ONCOIMMUNOLOGY, vol. 3, no. 3, 2014, XP002759889 * |
| MARABELLE AURÉLIEN ET AL: "Depleting tumor-specific Tregs at a single site eradicates disseminated tumors.", THE JOURNAL OF CLINICAL INVESTIGATION JUN 2013, vol. 123, no. 6, June 2013 (2013-06-01), pages 2447 - 2463, XP002759891, ISSN: 1558-8238 * |
| MUNROE MELISSA E ET AL: "A costimulatory function for T cell CD40.", JOURNAL OF IMMUNOLOGY (BALTIMORE, MD. : 1950) 15 JAN 2007, vol. 178, no. 2, 15 January 2007 (2007-01-15), pages 671 - 682, XP002759887, ISSN: 0022-1767 * |
| REDMOND WILLIAM L ET AL: "Combined targeting of costimulatory (OX40) and coinhibitory (CTLA-4) pathways elicits potent effector T cells capable of driving robust antitumor immunity.", CANCER IMMUNOLOGY RESEARCH FEB 2014, vol. 2, no. 2, February 2014 (2014-02-01), pages 142 - 153, XP002760154, ISSN: 2326-6074 * |
| SCHMIDT-WEBER CARSTEN B ET AL: "TGF-{beta} signaling of human T cells is modulated by the ancillary TGF-{beta} receptor endoglin.", INTERNATIONAL IMMUNOLOGY JUL 2005, vol. 17, no. 7, July 2005 (2005-07-01), pages 921 - 930, XP002759888, ISSN: 0953-8178 * |
| See also references of EP3298045A1 * |
| WEINBERG, ANDREW DALE ET AL.: "OX40 stimulation leads to downregulation of CTLA-4 Functional consequences for Ag-specific T cell survival", 2002, XP002759894, Retrieved from the Internet <URL:http://eurekamag.com/research/035/416/035416658.php> [retrieved on 20160714] * |
Cited By (92)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12109264B2 (en) | 2015-07-31 | 2024-10-08 | Immunewalk Therapeutics, Inc. | Motile sperm domain containing protein 2 and inflammation |
| WO2017077085A3 (en) * | 2015-11-04 | 2017-06-22 | Cancer Research Technology | Immunomodulatory antibodies |
| US11780929B2 (en) | 2015-11-04 | 2023-10-10 | Cancer Research Technology Limited | Immunomodulatory antibodies |
| US11001638B2 (en) | 2015-11-04 | 2021-05-11 | Cancer Research Technology Limited | Immunomodulatory antibodies |
| WO2017182672A1 (en) * | 2016-04-22 | 2017-10-26 | Alligator Bioscience Ab | Novel bispecific polypeptides against cd137 |
| US12173082B2 (en) | 2016-04-22 | 2024-12-24 | Alligator Bioscience Ab | Bispecific polypeptides against CD137 |
| US12187798B2 (en) | 2016-06-20 | 2025-01-07 | Invox Pharma Limited | LAG-3 binding members |
| US11214618B2 (en) | 2016-06-20 | 2022-01-04 | F-Star Therapeutics Limited | LAG-3 binding members |
| US11214620B2 (en) | 2016-06-20 | 2022-01-04 | F-Star Therapeutics Limited | Binding molecules binding PD-L1 and LAG-3 |
| WO2018002339A1 (en) * | 2016-07-01 | 2018-01-04 | Alligator Bioscience Ab | Bispecific antibodies directed against ox40 and a tumor-associated antigen |
| US12077596B2 (en) | 2016-07-14 | 2024-09-03 | Genmab A/S | Multispecific antibodies against CD40 and CD137 |
| US11939388B2 (en) | 2016-07-14 | 2024-03-26 | Genmab A/S | Multispecific antibodies against CD40 and CD137 |
| US11629193B2 (en) | 2016-07-19 | 2023-04-18 | F-Star Therapeutics Limited | EGFR binding molecules |
| WO2018056821A1 (en) * | 2016-09-23 | 2018-03-29 | Merus N.V. | Binding molecules that modulate a biological activity expressed by a cell |
| US11685786B2 (en) | 2016-09-23 | 2023-06-27 | Merus N.V. | Binding molecules that bind CD137 and PD-L1 |
| US12509526B2 (en) | 2016-11-21 | 2025-12-30 | Alligator Bioscience Ab | Anti-CD137 antibodies and uses thereof |
| US11535678B2 (en) | 2016-11-21 | 2022-12-27 | Alligator Bioscience Ab | Anti-CD137 antibodies and uses thereof |
| WO2018091739A1 (en) | 2016-11-21 | 2018-05-24 | Alligator Bioscience Ab | Bispecific polypeptides to gitr and ctla-4 |
| WO2018091740A3 (en) * | 2016-11-21 | 2018-06-28 | Alligator Bioscience Ab | Novel anti_cd137 antibodies and uses thereof |
| US10689454B2 (en) | 2016-11-21 | 2020-06-23 | Alligator Bioscience Ab | Anti-CD137 antibodies and uses thereof |
| JP2020504101A (ja) * | 2016-12-15 | 2020-02-06 | アッヴィ・バイオセラピューティクス・インコーポレイテッド | 抗ox40抗体及びそれらの使用 |
| EP4389226A3 (en) * | 2017-02-24 | 2024-12-18 | MacroGenics, Inc. | Bispecific binding molecules that are capable of binding cd137 and tumor antigens, and uses thereof |
| CN110709421A (zh) * | 2017-05-02 | 2020-01-17 | 鳄鱼生物科学公司 | 针对ox40和ctla-4的双特异性抗体 |
| WO2018202649A1 (en) * | 2017-05-02 | 2018-11-08 | Alligator Bioscience Ab | Bispecific antibody against ox40 and ctla-4 |
| JP2022024054A (ja) * | 2017-05-19 | 2022-02-08 | ウーシー バイオロジクス(シャンハイ)カンパニー リミテッド | 細胞傷害性tリンパ球関連タンパク質4(ctla-4)に対する新規モノクローナル抗体 |
| US12240906B2 (en) | 2017-05-19 | 2025-03-04 | Wuxi Biologics (Shanghai) Co., Ltd. | Monoclonal antibodies to cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) |
| WO2018237157A1 (en) * | 2017-06-22 | 2018-12-27 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
| CN110785187B (zh) * | 2017-06-22 | 2024-04-05 | 诺华股份有限公司 | 针对cd73的抗体分子及其用途 |
| CN110785187A (zh) * | 2017-06-22 | 2020-02-11 | 诺华股份有限公司 | 针对cd73的抗体分子及其用途 |
| US11312783B2 (en) | 2017-06-22 | 2022-04-26 | Novartis Ag | Antibody molecules to CD73 and uses thereof |
| US10716851B2 (en) | 2017-07-11 | 2020-07-21 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US10279039B2 (en) | 2017-07-11 | 2019-05-07 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US11752207B2 (en) | 2017-07-11 | 2023-09-12 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US10279040B1 (en) | 2017-07-11 | 2019-05-07 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US10279038B2 (en) | 2017-07-11 | 2019-05-07 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US10350292B1 (en) | 2017-07-11 | 2019-07-16 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US10434175B2 (en) | 2017-07-11 | 2019-10-08 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
| US11312786B2 (en) | 2017-07-20 | 2022-04-26 | Aptevo Research And Development Llc | Oncofetal antigen binding proteins and related compositions and methods |
| CN111148763A (zh) * | 2017-07-20 | 2020-05-12 | Aptevo研究与开发公司 | 结合于5t4和4-1bb的抗原结合蛋白以及相关组合物和方法 |
| US11725060B2 (en) | 2017-07-20 | 2023-08-15 | Aptevo Reserch and Development LLC | Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods |
| CN111148763B (zh) * | 2017-07-20 | 2023-11-03 | Aptevo研究与开发公司 | 结合于5t4和4-1bb的抗原结合蛋白以及相关组合物和方法 |
| JP2020530770A (ja) * | 2017-07-20 | 2020-10-29 | アプティーボ リサーチ アンド デベロップメント エルエルシー | 癌胎児性抗原結合タンパク質、関連する化合物および方法 |
| JP7369113B2 (ja) | 2017-07-20 | 2023-10-25 | アプティーボ リサーチ アンド デベロップメント エルエルシー | 癌胎児性抗原結合タンパク質、関連する化合物および方法 |
| IL272103B2 (en) * | 2017-07-20 | 2024-10-01 | Aptevo Res & Development Llc | Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods of treating cancer |
| US10239949B2 (en) | 2017-07-20 | 2019-03-26 | Aptevo Research and Development, LLC | Oncofetal antigen binding proteins and related compositions and methods |
| AU2018304585B2 (en) * | 2017-07-20 | 2023-07-06 | Alligator Bioscience Ab | Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods |
| WO2019016402A1 (en) | 2017-07-20 | 2019-01-24 | Aptevo Research And Development Llc | BINDING PROTEINS BINDING AT 5T4 AND 4-1BB, COMPOSITIONS AND METHODS RELATED THERETO |
| IL272103B1 (en) * | 2017-07-20 | 2024-06-01 | Aptevo Res & Development Llc | Antigen binding proteins binding to 5T4 and 4-1BB and related compositions and methods of treating cancer |
| KR102741435B1 (ko) | 2017-08-21 | 2024-12-11 | 아다진 인크. | 항-cd137 분자 및 이의 용도 |
| KR20200038997A (ko) * | 2017-08-21 | 2020-04-14 | 아다진 인크. | 항-cd137 분자 및 이의 용도 |
| JP2020532965A (ja) * | 2017-08-21 | 2020-11-19 | アダジーン インコーポレイテッド | 抗cd137分子及びその使用 |
| AU2018320257B2 (en) * | 2017-08-21 | 2025-04-24 | Adagene Inc. | Anti-CD137 molecules and use thereof |
| JP7369688B2 (ja) | 2017-08-21 | 2023-10-26 | アダジーン インコーポレイテッド | 抗cd137分子及びその使用 |
| US12378319B2 (en) | 2017-08-21 | 2025-08-05 | Adagene Inc. | Anti-CD137 molecules and use thereof |
| US11859003B2 (en) | 2017-08-21 | 2024-01-02 | Adagene Inc. | Method for treating cancer using anti-CD137 antibody |
| US12286483B2 (en) | 2017-10-31 | 2025-04-29 | Compass Therapeutics Llc | Method of treating cancer using CD137 antibodies and PD-1 antagonists |
| US11718679B2 (en) | 2017-10-31 | 2023-08-08 | Compass Therapeutics Llc | CD137 antibodies and PD-1 antagonists and uses thereof |
| US11851497B2 (en) | 2017-11-20 | 2023-12-26 | Compass Therapeutics Llc | CD137 antibodies and tumor antigen-targeting antibodies and uses thereof |
| US11548948B2 (en) | 2017-12-19 | 2023-01-10 | F-Star Therapeutics Limited | FC binding fragments comprising a PD-L1 antigen-binding site |
| US11952681B2 (en) | 2018-02-02 | 2024-04-09 | Adagene Inc. | Masked activatable CD137 antibodies |
| JP2021517153A (ja) * | 2018-03-13 | 2021-07-15 | バスキュラー バイオジェニックス リミテッド | Mospd2およびt細胞またはnk細胞特異的分子に対する二重特異性抗体 電子出願された配列表の参照 |
| WO2019175806A1 (en) * | 2018-03-13 | 2019-09-19 | Vascular Biogenics Ltd. | Bispecific antibodies to mospd2 and t cell- or nk cell-specific molecules |
| CN112041336A (zh) * | 2018-03-13 | 2020-12-04 | 脉管生物生长有限公司 | 针对mospd2和t细胞或nk细胞特异性分子的双特异性抗体 |
| EP3790903A4 (en) * | 2018-05-11 | 2022-06-08 | Wuxi Biologics (Shanghai) Co. Ltd. | FULLY HUMAN ANTIBODIES AGAINST OX40, METHOD FOR PREPARING THEREOF, AND USE THEREOF |
| EP4074732A1 (en) | 2018-05-11 | 2022-10-19 | Wuxi Biologics (Shanghai) Co. Ltd. | Fully human antibodies against ox40, method for preparing the same, and use thereof |
| WO2019214624A1 (en) | 2018-05-11 | 2019-11-14 | Wuxi Biologics (Shanghai) Co., Ltd. | Fully human antibodies against ox40, method for preparing same, and use thereof |
| JP7397055B2 (ja) | 2018-07-12 | 2023-12-12 | エフ-スター セラピューティクス リミテッド | Cd137及びox40に結合する抗体分子 |
| US12247074B2 (en) | 2018-07-12 | 2025-03-11 | Invox Pharma Limited | Antibody molecules |
| AU2019301206B2 (en) * | 2018-07-12 | 2025-10-30 | Invox Pharma Limited | Antibody molecules that bind CD137 and OX40 |
| JP2021524267A (ja) * | 2018-07-12 | 2021-09-13 | エフ−スター ベータ リミテッド | Cd137及びox40に結合する抗体分子 |
| RU2817602C2 (ru) * | 2018-07-12 | 2024-04-16 | Ф-Стар Тарапьютикс Лимитед | Молекулы антител, которые связывают cd137 и ox40 |
| IL280002B2 (en) * | 2018-07-12 | 2025-05-01 | F Star Beta Ltd | Antibody molecules that bind CD137 and OX40 |
| IL280002B1 (en) * | 2018-07-12 | 2025-01-01 | F Star Beta Ltd | Antibody molecules that bind CD137 and OX40 |
| WO2020011966A1 (en) * | 2018-07-12 | 2020-01-16 | F-Star Beta Limited | Antibody molecules that bind cd137 and ox40 |
| US12103976B2 (en) | 2018-07-12 | 2024-10-01 | Invox Pharma Limited | Fc binding fragments comprising a CD137 antigen-binding site |
| US12344672B2 (en) | 2018-07-12 | 2025-07-01 | Invox Pharma Limited | Antibody molecules that bind PD-L1 and CD137 |
| US12252537B2 (en) | 2018-07-12 | 2025-03-18 | Invox Pharma Limited | Antibody molecules that bind CD137 and OX40 |
| JP2024019415A (ja) * | 2018-07-12 | 2024-02-09 | エフ-スター セラピューティクス リミテッド | Cd137及びox40に結合する抗体分子 |
| TWI847989B (zh) * | 2018-07-12 | 2024-07-11 | 英商F—星治療有限公司 | 結合cd137及ox40的抗體分子 |
| US12297283B2 (en) | 2018-07-12 | 2025-05-13 | Invox Pharma Limited | Fc binding fragments comprising an OX40 antigen-binding site |
| JP7701964B2 (ja) | 2018-07-12 | 2025-07-02 | インボックス ファーマ リミテッド | Cd137及びox40に結合する抗体分子 |
| US12319739B2 (en) | 2018-07-12 | 2025-06-03 | Invox Pharma Limited | Mesothelin and CD137 binding molecules |
| US12325742B2 (en) | 2018-07-12 | 2025-06-10 | Invox Pharma Limited | Anti-mesothelin antibodies |
| US12384845B2 (en) | 2018-12-26 | 2025-08-12 | Xilio Development, Inc. | Activatable masked anti-CTLA4 binding proteins |
| US12435142B2 (en) | 2018-12-26 | 2025-10-07 | Xilio Development, Inc. | Anti-CTLA4 antibodies and methods of use thereof |
| WO2021146336A1 (en) | 2020-01-13 | 2021-07-22 | Aptevo Research And Development Llc | Methods and compositions for preventing adsorption of therapeutic proteins to drug delivery system components |
| WO2021146328A1 (en) | 2020-01-13 | 2021-07-22 | Aptevo Research And Development Llc | Formulations for protein therapeutics |
| US11697682B2 (en) | 2020-09-10 | 2023-07-11 | Vascular Biogenics Ltd. | Motile sperm domain containing protein 2 antibodies and methods of use thereof |
| WO2022246244A1 (en) | 2021-05-21 | 2022-11-24 | Aptevo Research And Development Llc | Dosing regimens for protein therapeutics |
| US12365743B2 (en) | 2022-02-23 | 2025-07-22 | Xencor, Inc. | Anti-CD28 x anti-PSMA antibodies |
| US12378326B2 (en) | 2022-02-23 | 2025-08-05 | Xencor, Inc. | Anti-CD28 x anti-PSMA antibodies |
| WO2024192308A3 (en) * | 2023-03-14 | 2024-11-07 | Xencor, Inc. | Anti-cd28 compositions |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107709367A (zh) | 2018-02-16 |
| US11780928B2 (en) | 2023-10-10 |
| RU2017142008A (ru) | 2019-06-24 |
| AU2016265447B2 (en) | 2022-06-16 |
| IL255767B1 (en) | 2023-12-01 |
| IL255767B2 (en) | 2024-04-01 |
| EP3988577A1 (en) | 2022-04-27 |
| KR20180009754A (ko) | 2018-01-29 |
| US20200190208A1 (en) | 2020-06-18 |
| US20210238298A1 (en) | 2021-08-05 |
| CN114181309A (zh) | 2022-03-15 |
| RU2017142008A3 (OSRAM) | 2020-03-20 |
| US11008396B2 (en) | 2021-05-18 |
| CA2986415A1 (en) | 2016-11-24 |
| IL255767A (en) | 2018-01-31 |
| US20180118841A1 (en) | 2018-05-03 |
| AU2016265447A1 (en) | 2017-11-02 |
| JP2018520650A (ja) | 2018-08-02 |
| CN114181309B (zh) | 2024-07-30 |
| KR102712820B1 (ko) | 2024-10-02 |
| US10774150B2 (en) | 2020-09-15 |
| JP7419434B2 (ja) | 2024-01-22 |
| MX2017014699A (es) | 2018-04-11 |
| BR112017024770A2 (pt) | 2018-07-31 |
| EP3298045A1 (en) | 2018-03-28 |
| JP2022105558A (ja) | 2022-07-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11780928B2 (en) | Polypeptides | |
| US20200048358A1 (en) | Bispecific antibody against ox40 and ctla-4 | |
| AU2022201144B2 (en) | Antigen binding molecules comprising a TNF family ligand trimer | |
| CN109641037B (zh) | 抗psma抗体及其用途 | |
| RU2753902C2 (ru) | Комбинированная терапия на основе активирующих т-клетки биспецифических антигенсвязывающих молекул против cd3 и фолатного рецептора 1 (folr1) и антагонистов, связывающихся с осью pd-1 | |
| KR101900953B1 (ko) | Cd86 길항제 다중-표적 결합 단백질 | |
| KR101901458B1 (ko) | Tcr 복합체 면역치료제 | |
| KR20160045134A (ko) | Cd123 및 cd3에 결합할 수 있는 이중특이성 1가 디아바디 및 그것의 용도 | |
| AU2020316495B2 (en) | Humanized anti-VEGF Fab antibody fragment and use thereof | |
| AU2020316498B2 (en) | Humanized anti-VEGF monoclonal antibody | |
| US20190309084A1 (en) | Bispecific Polypeptides to GITR and CTLA-4 | |
| HK1243096A1 (en) | Cd86 antagonist multi-target binding proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16724036 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15567163 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2016265447 Country of ref document: AU Date of ref document: 20160520 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/014699 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2986415 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122021002119 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2017560535 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 255767 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 20177033709 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017142008 Country of ref document: RU |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017024770 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112017024770 Country of ref document: BR Kind code of ref document: A2 Effective date: 20171117 |