WO2016180958A1 - Treatment for multiple myeloma (mm) - Google Patents
Treatment for multiple myeloma (mm) Download PDFInfo
- Publication number
- WO2016180958A1 WO2016180958A1 PCT/EP2016/060810 EP2016060810W WO2016180958A1 WO 2016180958 A1 WO2016180958 A1 WO 2016180958A1 EP 2016060810 W EP2016060810 W EP 2016060810W WO 2016180958 A1 WO2016180958 A1 WO 2016180958A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- sequence
- administered
- region
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/56—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
- A61K31/57—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone
- A61K31/573—Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone substituted in position 21, e.g. cortisone, dexamethasone, prednisone or aldosterone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
- A61K9/0021—Intradermal administration, e.g. through microneedle arrays or needleless injectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
Definitions
- Multiple myeloma is a B cell malignancy characterized by the latent accumulation in bone marrow of secretory plasma cells with a low proliferative index and an extended life span. The disease ultimately attacks bones and bone marrow, resulting in multiple tumors and lesions throughout the skeletal system.
- MM myeloma
- the incidence of MM increases in the aging population, with the median age at time of diagnosis being about 61 years.
- the currently available therapies for multiple myeloma include chemotherapy, stem cell transplantation, Thalomid® (thalidomide), Velcade® (bortezomib), Aredia® (pamidronate), and Zometa® (zoledronic acid).
- the current treatment protocols which include a combination of chemotherapeutic agents such as vincristine, BCNU, melphalan, cyclophosphamide, adriamycin, and prednisone or dexamethasone, yield a complete remission rate of only about 5%, and median survival is approximately 36-48 months from the time of diagnosis.
- chemotherapeutic agents such as vincristine, BCNU, melphalan, cyclophosphamide, adriamycin, and prednisone or dexamethasone
- CD38 is an example of an antigen expressed on such malignant B cells, plasma cells, and other lymphocytes. Functions ascribed to CD38 include both receptor mediation in adhesion and signaling events and (ecto-) enzymatic activity. As an ectoenzyme, CD38 uses NAD+ as substrate for the formation of cyclic ADP-ribose (cADPR) and ADPR, but also of nicotinamide and nicotinic acid-adenine dinucleotide phosphate (NAADP). cADPR and NAADP have been shown to act as second messengers for Ca2+ mobilization.
- cADPR cyclic ADP-ribose
- NAADP nicotinamide and nicotinic acid-adenine dinucleotide phosphate
- CD38 By converting NAD+ to cADPR, CD38 regulates the extracellular NAD+ concentration and hence cell survival by modulation of NAD-induced cell death (NCID).
- NAD-induced cell death In addition to signaling via Ca2+, CD38 signaling occurs via cross-talk with antigen-receptor complexes on T and B cells or other types of receptor complexes, e.g. MHC molecules, and is in this way involved in several cellular responses, but also in switching and secretion of IgG.
- Antibodies specific for CD38 are described in W01999/62526 (Mayo Foundation); WO200206347 (Crucell Holland); US2002164788 (Jonathan Ellis) which is incorporated by reference in its entirety; WO2005/103083 (MorphoSys AG), US serial no.
- the present invention relates to certain surprising findings observed in the first in human clinical trial with the CD38 monoclonal antibody MOR202 in patients with relapsed or refractory Multiple Myeloma (MM).
- MM Multiple Myeloma
- Figure 1 shows the amino acid sequence of the variable domains of antibody MOR202.
- Figure 2 shows the best responses and time on treatment for patients from cohorts 5-8 receiving at least 1 treatment cycle.
- Figure 3 shows the best change in M protein for patients from cohorts 5-8 receiving at least 1 treatment cycle.
- Figure 4 shows the MOR202 dose vs. overall response results in the clinical trial of
- MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.
- Figure 5 shows the trough levels of MOR202 according to best response in the clinical trial of MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.
- Figure 6 shows any infusion-related reactions in the clinical trial of MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.
- FIGS. 7A - D show MOR202 serum concentrations over time in the clinical trial of
- MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.
- Figure 8 shows the mean trough levels of MOR202 resulting from certain dosing regimens in the clinical trial of MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.
- antibody means monoclonal antibodies, including any isotype, such as, IgG, IgM, IgA, IgD and IgE.
- An IgG antibody is comprised of two identical heavy chains and two identical light chains that are joined by disulfide bonds. Each heavy and light chain contains a constant region and a variable region. Each variable region contains three segments called “complementarity-determining regions" ("CDRs") or “hypervariable regions", which are primarily responsible for binding an epitope of an antigen. They are referred to as CDR1 , CDR2, and CDR3, numbered sequentially from the N-terminus. The more highly conserved portions of the variable regions outside of the CDRs are called the "framework regions".
- an “antibody fragment” means an Fv, scFv, dsFv, Fab, Fab' F(ab')2 fragment, or other fragment, which contains at least one variable heavy or variable light chain, each containing CDRs and framework regions.
- VH refers to the variable region of an immunoglobulin heavy chain of an antibody, or antibody fragment.
- VL refers to the variable region of the immunoglobulin light chain of an antibody, or antibody fragment.
- CDRs herein are defined by either Chothia et al or Kabat et al. See Chothia C, Lesk AM. (1987) Canonical structures for the hypervariable regions of immunoglobulins. J Mol Biol., 196(4):901 -17, which is incorporated by reference in its entirety. See Kabat E.A, Wu T.T., Perry H.M., Gottesman K.S. and Foeller C. (1991 ). Sequences of Proteins of Immunological Interest. 5th edit., NIH Publication no. 91 -3242, US Dept. of Health and Human Services, Washington, DC.
- CD38 refers to the protein known as CD38, having the following synonyms: ADP-ribosyl cyclase 1 , cADPr hydrolase 1 , Cyclic ADP-ribose hydrolase 1 , T10.
- Human CD38 has the amino acid sequence of:
- MOR202 an anti-CD38 antibody whose amino acid sequence is provided in Figure 1 .
- MOR202 is disclosed in US Patent Number 8,088,896, which is incorporated by reference in its entirety.
- MOR202 and MOR03087 are used as synonyms to describe the antibody shown in Figure 1 .
- the DNA sequence encoding the MOR202 Variable Heavy Domain is:
- the DNA sequence encoding the MOR202 Variable Light Domain is:
- MOR202 has an lgG1 Fc region.
- a pharmaceutical composition includes an active agent, e.g. an antibody for therapeutic use in humans.
- a pharmaceutical composition may additionally include pharmaceutically acceptable carriers or excipients.
- Multiple myeloma is also known as plasma cell myeloma, myelomatosis, or Kahler's disease (after Otto Kahler), and is a cancer of plasma cells, a type of white blood cell normally responsible for producing antibodies.
- plasma cell myeloma myelomatosis, or Kahler's disease (after Otto Kahler)
- Kahler's disease is a cancer of plasma cells, a type of white blood cell normally responsible for producing antibodies.
- multiple myeloma collections of abnormal plasma cells accumulate in the bone marrow, where they interfere with the production of normal blood cells. Most cases of multiple myeloma also feature the production of a paraprotein an abnormal antibody which can cause kidney problems. Bone lesions and hypercalcemia (high blood calcium levels) are also often encountered.
- M protein or myeloma protein is an abnormal immunoglobulin fragment or immunoglobulin light chain that is produced in excess by an abnormal clonal proliferation of plasma cells, typically in multiple myeloma.
- administering refers to the delivery of a pharmaceutical composition by an injectable form, such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.
- injectable form such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.
- the antibody which is administered according to the present disclosure is administered to the patient in a therapeutically effective amount.
- a “therapeutically effective amount” refers to an amount sufficient to cure, alleviate or partially arrest the clinical manifestations of a given disease or disorder, i.e. MM, and its complications.
- Mg/kg means milligram antibody per kilogram body weight.
- Cmax refers to the highest plasma concentration of the antibody observed within the sampling interval.
- AUC or "area under the curve” refers to the area under the plasma concentration-time curve, as calculated by the trapezoidal rule over the complete sample collection interval.
- the drug dose that leads to a therapeutically effect can also be described in terms of the total exposure to a patient measured by area under the curve.
- the amount that is effective for a particular therapeutic purpose will depend on the severity of the disease or injury as well as on the weight and general state of the subject. It will be understood that determination of an appropriate dosage may be achieved, using routine experimentation, by constructing a matrix of values and testing different points in the matrix, all of which is within the ordinary skills of a trained physician or clinical scientist.
- the antibody of the present disclosure can be administered at different time points and the treatment cycle may have a different length.
- the antibodies may be administered daily, every other day, three times a week, weekly or biweekly.
- the antibodies may also be administered over at least four weeks, over at least five weeks, over at least six weeks, over at least seven weeks, over at least eight weeks, over at least nine weeks, over at least ten weeks, over at least eleven weeks or over at least twelve weeks.
- epitope includes any protein determinant capable of specific binding to an antibody or otherwise interacting with a molecule.
- Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics.
- An epitope may be "linear” or “conformational.”
- linear epitope refers to an epitope with all of the points of interaction between the protein and the interacting molecule (such as an antibody) occur linearally along the primary amino acid sequence of the protein (continuous).
- formational epitope refers to an epitope in which discontinuous amino acids that come together in three dimensional conformation. In a conformational epitope, the points of interaction occur across amino acid residues on the protein that are separated from one another.
- An aspect includes a method of treating multiple myeloma in a subject in need thereof comprising administering to the subject a therapeutically effective amount of an antibody specific for CD38 wherein said antibody comprises an HCDR1 region of sequence
- GFTFSSYYMN SEQ ID NO: 1
- SYYMN SEQ ID NO: 2
- an HCDR2 region of sequence GISGDPSNTYYADSVKG SEQ ID NO: 3
- an HCDR3 of sequence DLPLVYTGFAY SEQ ID NO: 4
- an LCDR1 region of sequence SGDNLRHYYVY SEQ ID NO: 5
- an LCDR2 region of sequence GDSKRPS SEQ ID NO: 6
- an LCDR3 region of sequence QTYTGGASL SEQ ID NO: 7
- An aspect includes a use of an antibody specific for CD38 wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1 ) or SYYMN (SEQ ID NO: 2), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 3), an HCDR3 of sequence DLPLVYTGFAY (SEQ ID NO: 4), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 5), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 6), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 7) in the manufacture of a medicament for the treatment of multiple myeloma, wherein said antibody is administered at a dose of 8 mg/kg or more.
- said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1 ) or SYYMN (SEQ ID NO: 2), an HCDR
- the present disclosure relates to an antibody specific for CD38 wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1 ) or SYYMN (SEQ ID NO: 2), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 3), an HCDR3 of sequence DLPLVYTGFAY (SEQ ID NO: 4), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 5), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 6), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 7) for use in the treatment of multiple myeloma, wherein said antibody is administered at a dose of 8 mg/kg or more.
- the antibody comprises the HCDR1 region of sequence
- the antibody comprises the HCDR1 region of sequence SYYMN (SEQ ID NO: 2).
- the multiple myeloma is relapsed / refractory.
- the disclosed antibody specific for CD38 is administered at a dose of 16 mg/kg or more.
- the antibody is administered once every two weeks (q2w) over at least eight weeks.
- the antibody is administered once weekly (q1 w) over at least eight weeks.
- the antibody is administered intravenously.
- the antibody is administered intravenously over a period of two hours.
- the antibody comprises a variable heavy chain of the sequence QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVSGISGDPSNTY YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLPLVYTGFAYWGQGTLVTVSS
- the antibody comprises an lgG1 Fc region.
- the antibody is administered in combination with dexamethasone.
- the antibody is administered in combination with dexamethasone, wherein dexamethasone is dosed at 20mg or 40mg once weekly (q1 W).
- Example 1 Patient selection
- Parts A, B and C (i) Failure of at least 2 previous therapies which must have included an immunomodulatory agent and a proteasome inhibitor (either together or part of different therapies) (ii) All subjects must have documented progression during or after their last prior therapy for multiple myeloma
- the main exclusion criteria were primary, refractory MM; solitary plasmacytoma or plasma cell leukemia; and previous allogenic stem cell transplant.
- Tables 1 A and B describes the demographics of the patients treated in the present study.
- Table 1 A Demographics of Patients Treated in the present Study as of April 13, 2015
- Table 1 B Demographics of Patients Treated in the present Study as of October 26, 2015
- lenalidomide lenalidomide
- POM pomalidomide
- PS performance status
- MOR202 maximum tolerated dose
- DEX dexamethasone
- POM pomalidomide
- LN lenalidomide
- MOR03087 doses were 0.01 mg/kg in part A, 4 mg/kg in parts B and C and 8 mg/kg in parts D and E; in all parts MOR03087 doses was escalated to a maximum of 16 mg/kg.
- part A patients received a biweekly intravenous infusion of MOR03087 which was administered on days 1 and 15 of the cycle.
- parts B to E patients received a weekly intravenous infusion of MOR03087 which was administered on days 1 , 8, 15, and 22 of the cycle.
- dexamethasone was administered to patients orally; 40 mg ( ⁇ 75 years old) or 20 mg (> 75 years old) on days 1 , 8, 15, and 22 of the 28-day cycle. An additional dose was administered in cycle 1 on day 4.
- Pomalidomide was administered to patients orally 4 mg on days 1 -21 of the 28-day cycle.
- Lenalidomide was administered to patients orally 25 mg on days 1 -21 of the 28-day cycle.
- Parts A-C were conducted in patients with rrMM who had failed 2 previous therapies including an immunomodulatory drug and a proteasome inhibitor.
- the duration of treatment was as follows:
- the route of MOR202 administration was a 2-hour intravenous (IV) infusion.
- the premedication, where applicable was antipyretic, histamine H1 receptor blocker.
- confirmatory cohorts (of ⁇ 6 patients each) are planned to validate the MTD and/or recommended dose/schedule of MOR202 as monotherapy with and without dexamethasone (q1 w or q2w), and in combination with POM/DEX and LEN/DEX (q1w).
- MTD Maximum Tolerated Dose
- Table 2 shows the most frequently reported AEs.
- IRRs Infusion-related reactions
- Figure 2 shows responses as of April 13, 2015.
- Figure 3 shows the change in M protein to date.
- the overall response rate, duration of response, time-to-progression, and progression-free survival of all patients will be evaluated.
- Figures 7A - D show the MOR202 serum concentrations over time. In most patients treated with 4 mg/kg q2w, a dominant target- mediated sink effect was observed leading to low or no detectable serum trough levels, see Figures 7A and C. In contrast, patients treated with ⁇ 4mg/kg q1w showed constant or slightly accumulating trough levels, see Figures 7B and D.
- a terminal elimination half-life of 2-3 weeks was estimated by comparing modelled serum concentrations of MOR202 (at 4mg/kg, q1w) with measured patient data.
- PK data indicate the potential for full target occupancy in the majority of pts receiving 8 and 16 mg/kg q1 w.
- Figure 5 supports a direct relationship between minimum trough levels of MOR202 and clinical responses, whereas higher trough levels led to better clinical responses.
- Figure 8 supports the direct relationship between the MOR202 dose, frequency of dosing and trough levels showing that higher trough levels were linked to higher doses.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Dermatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Biomedical Technology (AREA)
- Endocrinology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Magnetic Resonance Imaging Apparatus (AREA)
- Display Devices Of Pinball Game Machines (AREA)
Priority Applications (22)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PL16723349T PL3294769T3 (pl) | 2015-05-13 | 2016-05-13 | Leczenie szpiczaka mnogiego (mm) |
| SG11201708691VA SG11201708691VA (en) | 2015-05-13 | 2016-05-13 | Treatment for multiple myeloma (mm) |
| LTEP16723349.3T LT3294769T (lt) | 2015-05-13 | 2016-05-13 | Daugybinei mielomai (dm) skirtas gydymas |
| ES16723349T ES2862708T3 (es) | 2015-05-13 | 2016-05-13 | Tratamiento del mieloma múltiple (MM) |
| RU2017137496A RU2723047C2 (ru) | 2015-05-13 | 2016-05-13 | Средство для лечения множественной миеломы (ММ) |
| KR1020177035726A KR20180008571A (ko) | 2015-05-13 | 2016-05-13 | 다발성 골수종(mm)의 치료 |
| CN201680027238.0A CN107614530A (zh) | 2015-05-13 | 2016-05-13 | 用于多发性骨髓瘤(mm)的治疗 |
| CA2984464A CA2984464C (en) | 2015-05-13 | 2016-05-13 | Treatment for multiple myeloma (mm) |
| SM20210202T SMT202100202T1 (it) | 2015-05-13 | 2016-05-13 | Trattamento per il mieloma multiplo |
| SI201631139T SI3294769T1 (sl) | 2015-05-13 | 2016-05-13 | Zdravljenje multiplega mieloma (MM) |
| AU2016260895A AU2016260895B2 (en) | 2015-05-13 | 2016-05-13 | Treatment for multiple myeloma (MM) |
| RS20210419A RS61668B1 (sr) | 2015-05-13 | 2016-05-13 | Lečenje multiplog mijeloma (mm) |
| HRP20210552TT HRP20210552T1 (hr) | 2015-05-13 | 2016-05-13 | Liječenje multiplog mijeloma (mm) |
| JP2017558542A JP7160533B2 (ja) | 2015-05-13 | 2016-05-13 | 多発性骨髄腫(mm)の処置 |
| DK16723349.3T DK3294769T3 (da) | 2015-05-13 | 2016-05-13 | Behandling for multipelt myelom (mm) |
| US15/569,495 US10533057B2 (en) | 2015-05-13 | 2016-05-13 | Treatment for multiple myeloma (MM) |
| EP16723349.3A EP3294769B1 (en) | 2015-05-13 | 2016-05-13 | Treatment for multiple myeloma (mm) |
| MX2017014396A MX380557B (es) | 2015-05-13 | 2016-05-13 | Anticuerpos específicos para cd38 para usarse en el tratamiento de mieloma múltiple (mm). |
| IL255552A IL255552B (en) | 2015-05-13 | 2017-11-09 | Treatment of multiple myeloma |
| ZA2017/08386A ZA201708386B (en) | 2015-05-13 | 2017-12-11 | Treatment for multiple myeloma (mm) |
| US16/693,904 US11591406B2 (en) | 2015-05-13 | 2019-11-25 | Treatment for multiple myeloma (MM) |
| CY20211100276T CY1123982T1 (el) | 2015-05-13 | 2021-03-30 | Θεραπευτικη αγωγη για το πολλαπλο μυελωμα (μμ) |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15167597 | 2015-05-13 | ||
| EP15167597.2 | 2015-05-13 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/569,495 A-371-Of-International US10533057B2 (en) | 2015-05-13 | 2016-05-13 | Treatment for multiple myeloma (MM) |
| US16/693,904 Continuation US11591406B2 (en) | 2015-05-13 | 2019-11-25 | Treatment for multiple myeloma (MM) |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016180958A1 true WO2016180958A1 (en) | 2016-11-17 |
Family
ID=53174925
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/060810 Ceased WO2016180958A1 (en) | 2015-05-13 | 2016-05-13 | Treatment for multiple myeloma (mm) |
Country Status (24)
| Country | Link |
|---|---|
| US (2) | US10533057B2 (enExample) |
| EP (1) | EP3294769B1 (enExample) |
| JP (2) | JP7160533B2 (enExample) |
| KR (1) | KR20180008571A (enExample) |
| CN (1) | CN107614530A (enExample) |
| AU (1) | AU2016260895B2 (enExample) |
| CA (1) | CA2984464C (enExample) |
| CY (1) | CY1123982T1 (enExample) |
| DK (1) | DK3294769T3 (enExample) |
| ES (1) | ES2862708T3 (enExample) |
| HR (1) | HRP20210552T1 (enExample) |
| HU (1) | HUE054271T2 (enExample) |
| IL (1) | IL255552B (enExample) |
| LT (1) | LT3294769T (enExample) |
| MX (1) | MX380557B (enExample) |
| PL (1) | PL3294769T3 (enExample) |
| PT (1) | PT3294769T (enExample) |
| RS (1) | RS61668B1 (enExample) |
| RU (1) | RU2723047C2 (enExample) |
| SG (1) | SG11201708691VA (enExample) |
| SI (1) | SI3294769T1 (enExample) |
| SM (1) | SMT202100202T1 (enExample) |
| WO (1) | WO2016180958A1 (enExample) |
| ZA (1) | ZA201708386B (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112154156A (zh) * | 2018-03-28 | 2020-12-29 | 武田药品工业株式会社 | 抗cd38抗体的皮下给药 |
| EP3753955A4 (en) * | 2018-02-12 | 2021-12-08 | Hangzhou Sumgen Biotech Co., Ltd. | CD38 PROTEIN ANTIBODIES AND ASSOCIATED USE |
| US12209138B2 (en) | 2010-12-30 | 2025-01-28 | Takeda Pharmaceutical Company Limited | Anti-CD38 antibodies |
| US12371506B2 (en) | 2018-01-12 | 2025-07-29 | Takeda Pharmaceutical Company Limited | Subcutaneous administration of anti-CD38 antibodies |
| US12391765B2 (en) | 2016-07-15 | 2025-08-19 | Takeda Pharmaceutical Company Limited | Methods and materials for assessing response to plasmablast- and plasma cell-depleting therapies |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PL3294769T3 (pl) * | 2015-05-13 | 2021-07-05 | Morphosys Ag | Leczenie szpiczaka mnogiego (mm) |
| CN109265551B (zh) * | 2018-09-25 | 2020-09-15 | 华东师范大学 | Cd38抗体、嵌合抗原受体和药物 |
| KR20210104736A (ko) * | 2018-12-14 | 2021-08-25 | 모르포시스 아게 | 항체 제형 |
| EP4588484A3 (en) * | 2019-01-28 | 2025-10-15 | Sanofi-Aventis U.S. LLC | Methods of treating multiple myeloma |
| US20200308296A1 (en) * | 2019-03-28 | 2020-10-01 | Janssen Biotech, Inc. | Clinically Proven Subcutaneous Pharmaceutical Compositions Comprising Anti-CD38 Antibodies and Their Uses in Combination with Pomalidomide and Dexamethasone |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012041800A1 (en) * | 2010-09-27 | 2012-04-05 | Morphosys Ag | Anti-cd38 antibody and lenalidomide or bortezomib for the treatment of multiple myeloma and nhl |
Family Cites Families (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20020164788A1 (en) | 1994-12-02 | 2002-11-07 | The Wellcome Foundation Limited | Humanized antibodies to CD38 |
| AU770718B2 (en) | 1998-06-05 | 2004-02-26 | Mayo Foundation For Medical Education And Research | Use of genetically engineered antibodies to CD38 to treat multiple myeloma |
| EP1174440A1 (en) | 2000-07-19 | 2002-01-23 | U-BISys B.V. | A selectively-expressed epitope on the human CD38 molecule detected by a phage display library-derived human scFv antibody fragment |
| NZ548990A (en) | 2004-02-06 | 2009-06-26 | Morphosys Ag | Anti-CD38 human antibodies and uses therefor |
| AU2005235811B2 (en) | 2004-02-06 | 2011-11-03 | Morphosys Ag | Anti-CD38 human antibodies and uses therefor |
| EP3312196B1 (en) | 2005-03-23 | 2019-07-17 | Genmab A/S | Antibodies against cd38 for treatment of multiple myeloma |
| US20090123950A1 (en) | 2005-05-24 | 2009-05-14 | Morphosys Ag | Generation And Profiling Of Fully Human Hucal Gold®-Derived Therapeutic Antibodies Specific For Human CD38 |
| KR20150139636A (ko) | 2005-10-12 | 2015-12-11 | 모르포시스 아게 | 인간 cd38에 특이적인 완전 인간 hucal gold-유도 치료 항체들의 생성 및 프로파일링 |
| PT2068874E (pt) * | 2006-08-07 | 2015-05-21 | Abbvie Biotherapeutics Inc | Métodos de tratamento de mieloma múltiplo utilizando terapias de combinação baseadas em anticorpos anti-csi |
| NZ576122A (en) * | 2006-09-26 | 2012-09-28 | Genmab As | Anti-cd38 plus corticosteroids plus a non-corticosteroid chemotherapeutic for treating tumors |
| EP1914242A1 (en) | 2006-10-19 | 2008-04-23 | Sanofi-Aventis | Novel anti-CD38 antibodies for the treatment of cancer |
| EP3613774A1 (en) * | 2010-06-09 | 2020-02-26 | Genmab A/S | Antibodies against human cd38 |
| US9738933B2 (en) * | 2012-12-05 | 2017-08-22 | H. Lee Moffitt Cancer Center And Research Institute, Inc. | RNF41 as a biomarker predicting response to lenalidomide in non-del(5q) MDS |
| CN103421115B (zh) * | 2013-09-02 | 2015-06-03 | 东南大学 | 一种cd38纳米抗体及应用 |
| US20150118251A1 (en) * | 2013-10-31 | 2015-04-30 | Sanofi | Specific anti-cd38 antibodies for treating human cancers |
| US10213513B2 (en) | 2014-06-16 | 2019-02-26 | Mayo Foundation For Medical Education And Research | Treating myelomas |
| US10617757B2 (en) * | 2014-08-08 | 2020-04-14 | The Regents Of The University Of California | Methods for treating multiple myeloma |
| EP3191187B1 (en) | 2014-09-09 | 2021-07-28 | Janssen Biotech, Inc. | Combination therapies with anti-cd38 antibodies |
| PL3294769T3 (pl) * | 2015-05-13 | 2021-07-05 | Morphosys Ag | Leczenie szpiczaka mnogiego (mm) |
-
2016
- 2016-05-13 PL PL16723349T patent/PL3294769T3/pl unknown
- 2016-05-13 CA CA2984464A patent/CA2984464C/en active Active
- 2016-05-13 JP JP2017558542A patent/JP7160533B2/ja active Active
- 2016-05-13 RU RU2017137496A patent/RU2723047C2/ru active
- 2016-05-13 WO PCT/EP2016/060810 patent/WO2016180958A1/en not_active Ceased
- 2016-05-13 HR HRP20210552TT patent/HRP20210552T1/hr unknown
- 2016-05-13 PT PT167233493T patent/PT3294769T/pt unknown
- 2016-05-13 US US15/569,495 patent/US10533057B2/en active Active
- 2016-05-13 LT LTEP16723349.3T patent/LT3294769T/lt unknown
- 2016-05-13 CN CN201680027238.0A patent/CN107614530A/zh active Pending
- 2016-05-13 AU AU2016260895A patent/AU2016260895B2/en active Active
- 2016-05-13 SM SM20210202T patent/SMT202100202T1/it unknown
- 2016-05-13 DK DK16723349.3T patent/DK3294769T3/da active
- 2016-05-13 KR KR1020177035726A patent/KR20180008571A/ko not_active Ceased
- 2016-05-13 SI SI201631139T patent/SI3294769T1/sl unknown
- 2016-05-13 HU HUE16723349A patent/HUE054271T2/hu unknown
- 2016-05-13 ES ES16723349T patent/ES2862708T3/es active Active
- 2016-05-13 EP EP16723349.3A patent/EP3294769B1/en active Active
- 2016-05-13 RS RS20210419A patent/RS61668B1/sr unknown
- 2016-05-13 SG SG11201708691VA patent/SG11201708691VA/en unknown
- 2016-05-13 MX MX2017014396A patent/MX380557B/es unknown
-
2017
- 2017-11-09 IL IL255552A patent/IL255552B/en unknown
- 2017-12-11 ZA ZA2017/08386A patent/ZA201708386B/en unknown
-
2019
- 2019-11-25 US US16/693,904 patent/US11591406B2/en active Active
-
2021
- 2021-03-30 CY CY20211100276T patent/CY1123982T1/el unknown
- 2021-05-06 JP JP2021078658A patent/JP2021130668A/ja active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012041800A1 (en) * | 2010-09-27 | 2012-04-05 | Morphosys Ag | Anti-cd38 antibody and lenalidomide or bortezomib for the treatment of multiple myeloma and nhl |
Non-Patent Citations (3)
| Title |
|---|
| HARTLEPP ET AL: "800 POSTER MOR202 - a fully human antibody targeting CD38 for the treatment of multiple myeloma and other forms of blood-borne malignancies", EUROPEAN JOURNAL OF CANCER. SUPPLEMENT, PERGAMON, OXFORD, GB, vol. 5, no. 4, 1 September 2007 (2007-09-01), pages 117, XP022333014, ISSN: 1359-6349, DOI: 10.1016/S1359-6349(07)70533-5 * |
| KATHARINA TEILUF ET AL: "[alpha]-Radioimmunotherapy with <sup>213</sup>Bi-anti-CD38 immunoconjugates is effective in a mouse model of human multiple myeloma", ONCOTARGET, vol. 6, no. 7, 10 December 2014 (2014-12-10), pages 4692 - 4703, XP055286741, DOI: 10.18632/oncotarget.2986 * |
| MARC S RAAB ET AL: "A phase I/IIa study of the human anti-CD38 antibody MOR202 (MOR03087) in relapsed or refractory multiple myeloma (rrMM)", 2 June 2015 (2015-06-02), XP055286751, Retrieved from the Internet <URL:https://www.morphosys.com/sites/default/files/phone-conferences/downloads/asco_mor202_poster_final_for_print_21.05.15.pdf> [retrieved on 20160707] * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12209138B2 (en) | 2010-12-30 | 2025-01-28 | Takeda Pharmaceutical Company Limited | Anti-CD38 antibodies |
| US12391765B2 (en) | 2016-07-15 | 2025-08-19 | Takeda Pharmaceutical Company Limited | Methods and materials for assessing response to plasmablast- and plasma cell-depleting therapies |
| US12371506B2 (en) | 2018-01-12 | 2025-07-29 | Takeda Pharmaceutical Company Limited | Subcutaneous administration of anti-CD38 antibodies |
| EP3753955A4 (en) * | 2018-02-12 | 2021-12-08 | Hangzhou Sumgen Biotech Co., Ltd. | CD38 PROTEIN ANTIBODIES AND ASSOCIATED USE |
| US11713357B2 (en) | 2018-02-12 | 2023-08-01 | Hangzhou Sumgen Biotech Co., Ltd. | CD38 protein antibody and application thereof |
| AU2019218518B2 (en) * | 2018-02-12 | 2025-07-10 | Hangzhou Sumgen Biotech Co., Ltd. | CD38 protein antibody and application thereof |
| CN112154156A (zh) * | 2018-03-28 | 2020-12-29 | 武田药品工业株式会社 | 抗cd38抗体的皮下给药 |
| JP2021519295A (ja) * | 2018-03-28 | 2021-08-10 | 武田薬品工業株式会社 | 抗cd38抗体の皮下投薬 |
| JP2024045121A (ja) * | 2018-03-28 | 2024-04-02 | 武田薬品工業株式会社 | 抗cd38抗体の皮下投薬 |
| JP7526099B2 (ja) | 2018-03-28 | 2024-07-31 | 武田薬品工業株式会社 | 抗cd38抗体の皮下投薬 |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11591406B2 (en) | Treatment for multiple myeloma (MM) | |
| AU2013322806B2 (en) | Combinations and uses thereof | |
| JP6499971B2 (ja) | 抗cd38抗体及びレナリドマイドを含む組成物 | |
| EP2849784A1 (en) | Combination of cd37 antibodies with ice (ifosfamide, carboplatin, etoposide) | |
| KR20240117655A (ko) | 항-cd19 항체 및 베네토클락스 조합 치료에 대한 치료 패러다임 | |
| CN113993543B (zh) | 使用抗cd38抗体的组合疗法 | |
| RU2802812C2 (ru) | Лечебный подход, предназначенный для лечения комбинацией антитела к CD19 и венетоклакса | |
| HK1247939A1 (en) | Treatment for multiple myeloma (mm) | |
| HK1210949B (zh) | 组合及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16723349 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201708691V Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2984464 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2017558542 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2016260895 Country of ref document: AU Date of ref document: 20160513 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/014396 Country of ref document: MX Ref document number: 255552 Country of ref document: IL |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20177035726 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017137496 Country of ref document: RU Ref document number: 2016723349 Country of ref document: EP |