WO2016177664A1 - Anti-human-her3 antibodies and uses thereof - Google Patents
Anti-human-her3 antibodies and uses thereof Download PDFInfo
- Publication number
- WO2016177664A1 WO2016177664A1 PCT/EP2016/059739 EP2016059739W WO2016177664A1 WO 2016177664 A1 WO2016177664 A1 WO 2016177664A1 EP 2016059739 W EP2016059739 W EP 2016059739W WO 2016177664 A1 WO2016177664 A1 WO 2016177664A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- cancer
- seq
- set forth
- sequence set
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to chimeric low-fucose neuregulin
- the human epidermal growth factor receptor ErbB/HER family of receptor tyrosine kinases includes four members: EGFR (ErbBl/HERl), HER2 (c-Neu, HER2), HER3 (ErbB3/HER3) and HER4 (ErbB4/HER4).
- the HER receptors comprise an extracellular glycosylated domain consisting of four structural domains, marked 1 to 4, followed by a transmembrane domain and an intracellular C-terminal part containing a kinase domain for coupling to signalling pathways. Except for HER3, the intracellular region contains a tyrosine kinase activity.
- HER2 has no specific ligand because it is naturally under an "active" conformation.
- the other HER receptors exist as inactive monomers with the molecules folded in such a way to prevent dimerization.
- Ligand binding to domains 1 and 3 induces major conformational changes ultimately exposing the dimerization loop in domain 2 of the receptor. This exposure of the dimerization loop allows for receptor dimerization.
- the HER3 receptor that has been first described in 1990, is the only HER family member receptor that shows low kinase activity and downstream signalling is achieved through heterodimerization.
- the HER3 receptor as a monomer, is called "non-self and cannot form homodimers. Binding of the ligand neuregulin (NRG) to HER3 receptor triggers the heterodimerization of HER3 with the others HER family receptors (HER2 preferentially). Within the heterodimer, the HER3 kinase domain acts as an allosteric activator of its HER family partner.
- NSG ligand neuregulin
- HER3 is implicated in tumorigenesis of various cancers including breast and ovarian cancer (Lee-Hoeflich ST, Cancer Res. 2008; Mclntyre E, Breast Cancer Res Treat. 2010; Tanner B, J Clin Oncol. 2006).
- HER3 expression correlates with tumor progression and reduced patient survival in malignant melanoma and metastases, and is associated with decrease survival in ovary cancer.
- tumors with low HER2 expression which are not eligible to Herceptin treatment, often are "programmed" to strongly express HER3 (Smith et al. Br. J.
- HER2+++ tumors which become resistant to Herceptin after prolonged treatment, are "re-programmed” to strongly express HER3 (Narayan, Cancer Res. 2009).
- Cetuximab resistance was also associated with HER3 over-expression in lung cancer (Wheeler, Oncogene 2008) and colorectal carcinomas (Lu Cancer Res 2007), together with dysregulation of EGFR internalization/degradation.
- HER3 over-expression was significantly associated with worse metastasis-free survival in colorectal carcinoma (Ho-Pun-Cheung, Int J Cancer 2010).
- HER3 over-expression and compensatory signalling through activation of the PI3K/AKT pathway are implicated in the development of resistance to treatment with HER-targeted therapies (antibodies and TKI) (Wheeler 2008, Lu 2007, Narayan, 2009, Sergina, 2007) but also to treatment with IGFR-targeted therapies (Desbois-Mouthon, Clin Cancer Res 2009) and with chemotherapeutic agents (Kruser, Exp Cell Res 2010).
- HER3-targeted agents and in particular antibodies, might help to further understand the role of HER3 signalling in cancers and especially be used as efficient immunotherapeutics.
- MM-121 antibody PCT WO2008/100624
- U3 PharmaAG/Daiichi Sankyo/Amgen U3-1287 or AMG-888; PCT WO2007/077028
- HER2/HER3 bispecific antibody MM-111 (Merrimack Pharmaceuticals; PCT WO2005/117973, WO2006/091209) is involved in phase I/II clinical trials, alone or in combination with trastuzumab or lapatinib, in HER2-amplified breast cancer.
- NRG increases the binding of 9F7-F11 to its epitope.
- binding of NRG to its receptor leads to a conformational change in the structure of HER3, leading either to a better availability of the epitope of 9F7-F11 and/or to a structural modification of the epitope that provides a better affinity with 9F7-F11.
- 9F7-F11 did not exert increased in vivo anti-tumor activity against NRG-expressing tumor tissue, as compared with NRG-competitive antibodies (Lazrek et al, 2013).
- the present invention discloses an anti-human HER3 antibody comprising at least one of the CDRs selected from the group consisting of:
- H-CDR1 having at least 90% or 95% identity with a sequence set forth as SEQ ID NO: 2;
- H-CDR2 having at least 90% or 95% identity with a sequence set forth as SEQ ID NO: 3;
- H-CDR3 having at least 90% or 95% identity with a sequence set forth as SEQ ID NO: 4;
- L-CDR1 having at least 90% or 95% identity with a sequence set forth as
- L-CDR2 having at least 90% or 95% identity with a sequence set forth as SEQ ID NO: 7;
- L-CDR3 having at least 90% or 95% identity with a sequence set forth as SEQ ID NO: 8;
- said antibody having a human constant region
- glycan structures carried by the glycosylation site of the antibody comprise a fucose molecule.
- the present invention discloses a neuregulin non competitive allosteric anti-human HER3 antibody comprising at least one of the CDRs selected from the group consisting of:
- H-CDR1 having a sequence set forth as SEQ ID NO: 2;
- H-CDR2 having a sequence set forth as SEQ ID NO: 3;
- H-CDR3 having a sequence set forth as SEQ ID NO: 4;
- L-CDR1 having a sequence set forth as SEQ ID NO: 6;
- said antibody having a human constant region
- glycan structures carried by the glycosylation site of the antibody comprise a fucose molecule.
- the present invention also discloses a neuregulin non competitive allosteric anti- human HER3 antibody comprising:
- variable domain comprises: a H-CDR1 having at least 90 % or 95 % identity with a sequence set forth as SEQ ID NO: 2;
- H-CDR2 having at least 90 % or 95 % identity with a sequence set forth as SEQ ID NO: 3;
- H-CDR3 having at least 90 % or 95 % identity with a sequence set forth as
- variable domain comprises at least a CDR having a sequence chosen from the group consisting of:
- said antibody having a human constant region
- a first object of the present invention is thus a neuregulin non competitive allosteric anti-human HER3 antibody comprising:
- variable domain comprises:
- H-CDR1 having a sequence set forth as SEQ ID NO: 2;
- H-CDR2 having a sequence set forth as SEQ ID NO: 3;
- H-CDR3 having a sequence set forth as SEQ ID NO: 4;
- variable domain comprises at least a CDR selected from the group consisting of:
- L-CDR2 having a sequence set forth as SEQ ID NO:7;
- L-CDR3 having a sequence set forth as SEQ ID NO: 8;
- said antibody having a human constant region; and less than 65% of the glycan structures carried by the glycosylation site of the antibody comprise a fucose molecule.
- the antibody of the invention comprises a light chain variable region comprising a sequence having at least 90% or 95% identity with the sequence set forth as SEQ ID NO:6 as L-CDR1 , a sequence having at least 90%> or 95% identity with the sequence set forth as SEQ ID NO: 7 as L-CDR2 and a sequence having at least 90% or 95% identity with the sequence set forth as SEQ ID NO: 8 as L-CDR3.
- the antibody of the invention comprises a light chain variable region comprising a L-CDR1 having a sequence set forth as SEQ ID NO:6, a L-CDR2 having a sequence set forth as SEQ ID NO: 7 and a L-CDR3 having a sequence set forth as SEQ ID NO:8.
- the heavy chain variable region of the antibody of the invention has a sequence having at least 90% or 95% identity with the amino acid sequence set forth as SEQ ID NO: 1 and/or the light chain variable region has a sequence having at least 90% or 95% identity with the amino acid sequence set forth as SEQ ID NO: 5.
- the heavy chain variable region of the antibody of the invention having a sequence having at least 90% or 95% identity with the amino acid sequence set forth as SEQ ID NO: 1 has:
- H-CDR1 having a sequence set forth as SEQ ID NO: 2;
- H-CDR2 having a sequence set forth as SEQ ID NO: 3;
- H-CDR3 having a sequence set forth as SEQ ID NO: 4.
- the light chain variable region having a sequence having at least 90%) or 95% identity with the amino acid sequence set forth as SEQ ID NO: 5 has:
- L-CDR2 having a sequence set forth as SEQ ID NO:7;
- L-CDR3 having a sequence set forth as SEQ ID NO:8.
- the heavy chain variable region of said antibody has the amino acid sequence set forth as SEQ ID NO: 1 and/or the light chain variable region has the amino acid sequence set forth as SEQ ID NO: 5. More preferably, the heavy chain variable region of said antibody has the amino acid sequence set forth as SEQ ID NO: 1 and the light chain variable region has the amino acid sequence set forth as SEQ ID NO: 5.
- the heavy chain of the antibody of the invention has the amino acid sequence having at least 90% or 95% identity with the amino acid sequence set forth as SEQ ID NO: 9 and/or the light chain of said antibody has the amino acid sequence having at least 90% or 95% identity with the amino acid sequence set forth as SEQ ID NO: 10.
- the heavy chain of said antibody has the amino acid sequence set forth as SEQ ID NO: 9 and/or the light chain of said antibody has the amino acid sequence set forth as SEQ ID NO: 10. More preferably, the heavy chain of said antibody has the amino acid sequence set forth as SEQ ID NO: 9 and the light chain of said antibody has the amino acid sequence set forth as SEQ ID NO: 10.
- an antibody according to the invention is such that less than 50%> of the glycan structures carried by the glycosylation site of the antibody comprise a fucose molecule, preferably less than 40%, more preferably less than 30%), in particular less than 20%>.
- the antibody of the invention is a chimeric antibody, preferably a chimeric mouse/human antibody, and preferably a humanized antibody.
- a second object of the invention relates to a nucleic acid sequence encoding at least for an heavy chain or light chain of a monoclonal antibody according to the invention, preferably for an antibody of the invention.
- a third object of the invention relates to a vector comprising a nucleic acid according to the invention.
- a forth object of the invention relates to a host cell comprising a nucleic acid according to the invention or a vector according to the invention.
- a fifth object of the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising at least an antibody according to the invention and a pharmaceutically acceptable carrier.
- a sixth object of the invention relates to an immunoconjugate comprising the antibody of the invention linked to a therapeutic agent.
- a seventh object of the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising at least the immunoconjugate according to the invention and a pharmaceutically acceptable carrier.
- An eighth object of the invention relates to the antibody and/or the immunoconjugate according to the invention, for its use as a drug.
- a ninth object of the invention relates to the antibody and/or the immunoconjugate according to the invention for its use in the treatment of a cancer associated with the expression of HER3 wherein neuregulin is present, in particular neuregulin 1 ⁇ , in a subject.
- a tenth object of the invention relates to the antibody and/or the immunoconjugate according to the invention for its use in the inhibiting growth of tumor cells associated with the expression of HER3 wherein neuregulin is present, in particular neuregulin 1 ⁇ , in a subject.
- the neuregulin present is secreted by the tumor and/or by the tissues and/or organs surrounding the tumor.
- the tumor is neuregulin-dependant, in particular neuregulin 1 ⁇ -dependant.
- NRG and for example NRG la or NRGip
- a well known method of immunohistochemistry can be applied as described in Gilmour et al. December 2002, Vol. 8, pp. 3933-3942.
- neuregulin and in particular neuregulin 1 ⁇ , is present due to its administration to the subject before, after, or at the same time as the antibody and/or the immunoconjugate.
- the cancers or tumor cells associated with the expression of HER3 considered in the present invention are chosen among squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, gastric cancer, pancreatic cancer, glial cell tumors, such as glioblastoma and neurofibromatosis, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, melanoma, colorectal cancer, endometrial carcinoma, salivary gland carcinoma, kidney cancer, renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and head and neck cancers.
- breast cancer ovarian cancer
- small-cell lung cancer non- small cell lung cancer
- melanoma pancreatic cancer
- colorectal cancer and more particularly among breast cancer, ovarian cancer and pancreatic cancer.
- Figure 1 shows the dose-effect curves obtained by ELISA assay for GMB301 of the invention in order to characterize its affinity to HER3.
- the ELISA assay was performed as described in Example 2.
- X-coordinate Concentration of GMB301.
- Y-coordinate Absorbance at OD 450 nm.
- Figure 2 shows the in vivo effects of a treatment with either GMB301, 9F7-F1 1 or PBS (control) of athymic, 6- to 8-week-old, female BALB/c nude injected with pancreatic cancer cells HP AC (EGFR high , HER2/3 low , PTEN/PIK3CA wt, NRG negative and KRASIBRAF- mutated, NRGip-independent). 15mg/kg is injected twice a week for 4 weeks consecutively (Q3D-4W). Tumor volumes are indicated in ordinate and were calculated by the formula DlxD2xD3/2.
- Figure 3 shows the in vivo effects of a treatment with either GMB301, 9F7-F1 1 or PBS (control) of athymic, 6- to 8-week-old, female BALB/c nude injected with pancreatic cancer cells BxPC3 (EGFR high , HER2/3 low , KRAS/BRAF/PTEN/PIK3CA wt, NRG positive , NRGip-dependent). 15 mg/kg is injected twice a week for 4 weeks consecutively (Q3D-4W). Tumor volumes are indicated in ordinate and were calculated by the formula DlxD2xD3/2.
- Figure 4 shows the effects of a treatment with GMB301, the emabling version of the antibody H4B 121 or an antibody irrelevant (Controle Px) (1 ⁇ g/ml) on the cellular lysis (ADCC) of MDA-MB453 breast cancer cells in the presence of 100 ng/ml of NRGl together with effector peripheral blood mononuclear cells (T:E ratio 1 : 15).
- Abscissa Nature of the antibody used. Ordinate: % of specific lysis of the targeted tumor cells.
- Figure 5 shows the variation of % of binding to HER3 of antibodies H4B-121- emb and GMB301 in function of the concentration of said antibodies.
- the corresponding EC50 of the two antibodies is also indicated in nM.
- Abscissa Concentration of the antibody (M). Ordinate: % of binding to HER3.
- Figure 6 shows the effect of a treatment with GMB301, the emabling version of the antibody H4B 121 (H4B-121-emb) or with vehicle (NaCl - negative control) on tumor volume of 3 different types of NRGl-addicted tumors over time (left panel)
- Figure 5A NRGl -addicted pancreatic BxPC3 (3x106)
- Figure 5B triple-negative breast cancer HCC- 1806 (1x106)
- Figure 5C lung A549 cancer cells.
- Tumor growth data (left panel) are presented as the mean tumor volume (mm 3 ) +/- S.E.M. for each group of nude mice varying with time (days). Grayed zone corresponds to the time of treatment. Kaplan-Meier survival curves were calculated when tumors reached a volume of 1500 or 2000 mm 3 and mice were sacrificed.
- Abscissa Tumor volume (mm 3 ), and Ordinate: Days post-graft.
- Abscissa % tumors ⁇ 1500 mm 3
- Ordinate Days post-graft.
- the inventors have generated a chimeric low-fucose anti-human HER3 antibody, named GMB301, which comprises Complementary Determining Regions (CDRs) of the mouse antibody 9F7-F11 previously assayed by Lazrek et al (2013), which GMB301 antibody possesses unexpected properties as an anti-cancer agent.
- GMB301 Complementary Determining Regions
- the inventors have shown that a chimerized antibody having CDRs of the 9F7- Fl l antibody used by Lazrek et al. (2013) and having a low fucose content possesses an increased in vivo anti-tumor activity, especially against NRG-expressing tumors.
- an antibody having a specific glycosylation pattern, and more precisely a low fucose content, as well as human constant domains may behave as an anticancer agent differently from a parent mouse antibody having the same CDRs and a higher fucose content.
- the inventors have shown that the low fucose antibody that is described herein has specific tumor targeting activities, as compared with a parent antibody having the same CDRs, mouse constant domains and a higher fucose content.
- the results obtained by the inventors are all the more surprising that, in contrast to what might have been expected, the said antibody having CDRs of the 9F7-F11 antibody, human constant domains and having a low fucose content does not exhibit an increased antitumor activity against tumors in the absence of NRG.
- the inventors have unexpectedly found that the increased in vivo anti-tumor activity of the low fucose chimerized anti-HER3 antibody described herein does not seem to be mediated through enhanced ADCC or ADCP properties, but instead by (an) unknown and unexpected mechanism(s).
- the anti-HER3 chimerized antibody having a low fucose content which is described herein possesses an improved antitumoral activity specifically against a population of tumors expressing HER3, in the presence of neuregulin, which encompasses an improved antitumoral activity specifically against a population of tumors expressing both HER3 and neuregulin (autocrine secretion), or that could be stimulated by neuregulin secreted by non- tumor cells from the microenvironment via a paracrine pathway.
- the inventors have found that, as disclosed in the examples herein, and contrary to all expectations:
- the anti-tumor activity of GMB301 is significantly higher than the anti-tumor activity of 9F7- Fl l .
- anti-HER3 chimerized low fucose antibody that is described herein provides at least the following advantages over the anti-HER3 antibodies described in the prior art:
- neuregulin has its general meaning in the art and is often used interchangeably with the term “heregulin”.
- the heregulin family includes alpha, beta and gamma heregulins (Holmes et al, Science, 256: 1205-1210 (1992); U.S. Patent
- HER3 refers to the human HER3 receptor as described in Plowman et al, Proc. Natl. Acad. Sci. USA, 87:4905-4909 (1990); see, also, Kani et al, Biochemistry 44: 15842-857 (2005), Cho and Leahy, Science 297: 1330- 1333 (2002)). HER3 is also known as "HER3".
- anti-human-HER3 antibody refers to an antibody directed against human HER3.
- antibody or “immunoglobulin” have the same meaning, and will be used equally in the present invention.
- the term “antibody” as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen.
- the term antibody encompasses not only whole antibody molecules, but also variants (including derivatives) of antibodies.
- two heavy chains are linked to each other by disulfide bonds and each heavy chain is linked to a light chain by a disulfide bond. There are two types of light chain, lambda (1) and kappa (k).
- the light chain includes two domains, a variable domain (VL) and a constant domain (CL).
- the heavy chain includes four domains, a variable domain (VH) and three constant domains (CHI, CH2 and CH3, collectively referred to as CH).
- VL variable domain
- VH variable domain
- CH constant domain
- the constant region domains of the light (CL) and heavy (CH) chains confer important biological properties such as antibody chain association, secretion, trans-placental mobility, complement binding, and binding to Fc receptors (FcR).
- the Fv fragment is the N-terminal part of the Fab fragment of an immunoglobulin and consists of the variable portions of one light chain and one heavy chain.
- the specificity of the antibody resides in the structural complementarity between the antibody combining site and the antigenic determinant.
- Antibody combining sites are made up of residues that are primarily from the hypervariable or complementarity determining regions (CDRs). Occasionally, residues from nonhypervariable or framework regions (FR) influence the overall domain structure and hence the combining site.
- Complementarity Determining Regions or CDRs refer to amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native immunoglobulin binding site.
- the light and heavy chains of an immunoglobulin each have three CDRs, designated L-CDR1, L-CDR2, L-CDR3 and H-CDR1, H-CDR2, H-CDR3, respectively.
- An antigen-binding site therefore, includes six CDRs, comprising the CDR set from each of a heavy and a light chain V region.
- Framework Regions (FRs) refer to amino acid sequences interposed between CDRs.
- chimeric antibody refers to an antibody which comprises a VH domain and a VL domain of an antibody which are derived from one species and the constant domain which is derived from another species, for example an antibody in which the variable region sequences are derived from a mouse antibody and the constant region sequences are derived from a human antibody.
- humanized antibody refers to an antibody having variable region framework and constant regions from a human antibody but retains the mouse CDRs of antibody of the invention.
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- treatment refers to administering an active agent with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect a condition (e.g., a disease), the symptoms of the condition, or to prevent or delay the onset of the symptoms, complications, biochemical indicia of a disease, or otherwise arrest or inhibit further development of the disease, condition, or disorder in a statistically significant manner.
- a condition e.g., a disease
- the term "patient” or “patient in need thereof is intended for a human or non-human mammal affected or likely to be affected with cancer associated with the expression of human HER3.
- a “therapeutically effective amount” of the antibody of the invention is meant a sufficient amount of the antibody to treat said cancer, at a reasonable benefit/risk ratio applicable to any medical treatment. It will be understood, however, that the total daily usage of the antibodies and compositions of the present invention will be decided by the attending physician within the scope of sound medical judgment.
- the specific therapeutically effective dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; activity of the specific antibody employed; the specific composition employed, the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific antibody employed; the duration of the treatment; drugs used in combination or coincidental with the specific antibody employed; and like factors well known in the medical arts. For example, it is well known within the skill of the art to start doses of the compound at levels lower than those required to achieve the desired therapeutic effect and to gradually increase the dosage until the desired effect is achieved.
- the percent identity between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4: 1 1-17, 1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol, Biol.
- the present invention provides for neuregulin (NRG)-non competitive allosteric anti-HER3 antibodies, preferably in a purified form or in an isolated form.
- an anti-human-HER3 antibody comprising:
- variable domain comprises:
- H-CDR1 having a sequence set forth as SEQ ID NO: 2;
- H-CDR3 having a sequence set forth as SEQ ID NO: 4;
- variable domain comprises at least a CDR having a sequence chosen from the group consisting of SEQ ID NO: 6 as L-CDR1, SEQ ID NO: 7 as L-CDR2 and SEQ ID NO: 8 as L-CDR3;
- said antibody having a human constant region
- glycan structures carried by the glycosylation site of the antibody comprise a fucose molecule.
- VL PKLLIYSASNRYTGVPDRFTGSGSGTDFTLTISNMQSEDLADYF CQQYSNYPYTFGGGTKLEIK (SEQ ID NO:5)
- the antibody of the invention comprises a light chain variable region comprising SEQ ID NO:6 as L-CDR1, SEQ ID NO:7 as L-CDR2 and SEQ ID NO: 8 as L-CDR3.
- the heavy chain variable region of the antibody of the invention has the amino acid sequence set forth as SEQ ID NO: 1 and/or the light chain variable region has the amino acid sequence set forth as SEQ ID NO: 5.
- the heavy chain variable region of said antibody has the amino acid sequence set forth as SEQ ID NO: 1 and the light chain variable region has the amino acid sequence set forth as SEQ ID NO: 5.
- the heavy chain of the antibody of the invention has the amino acid sequence set forth as SEQ ID NO: 9 and/or the light chain of said antibody has the amino acid sequence set forth as SEQ ID NO: 10.
- the heavy chain of said antibody has the amino acid sequence set forth as SEQ ID NO: 9 and the light chain of said antibody has the amino acid sequence set forth as SEQ ID NO: 10.
- an antibody according to the invention is such that less than 50% of the glycan structures carried by the glycosylation site of the antibody comprise a fucose molecule, preferably less than 40%, more preferably less than 30%), in particular less than 20%>.
- the antibody of the invention is a chimeric antibody, preferably a chimeric mouse/human antibody, in particular a humanized antibody.
- Anti-human-HER3 antibodies of the invention may be produced by any technique known in the art, such as, without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination.
- antibodies of the desired sequence can readily produce said antibodies, by standard techniques for production of polypeptides. For instance, they can be synthesized using well-known solid phase method, preferably using a commercially available peptide synthesis apparatus (such as that made by Applied Biosystems, Foster City, California) and following the manufacturer's instructions.
- antibodies of the invention can be synthesized by recombinant DNA techniques well-known in the art.
- antibodies can be obtained as DNA expression products after incorporation of DNA sequences encoding the antibodies into expression vectors and introduction of such vectors into suitable eukaryotic or prokaryotic hosts that will express the desired antibodies, from which they can be later isolated using well-known techniques.
- a further object of the invention relates to a nucleic acid sequence encoding an antibody according to the invention.
- said nucleic acid is a DNA or RNA molecule, which may be included in any suitable vector, such as a plasmid, cosmid, episome, artificial chromosome, phage or a viral vector.
- vector means the vehicle by which a DNA or RNA sequence (e.g. a foreign gene) can be introduced into a host cell, so as to transform the host and promote expression (e.g. transcription and translation) of the introduced sequence.
- a DNA or RNA sequence e.g. a foreign gene
- a further object of the invention relates to a vector comprising a nucleic acid of the invention.
- Such vectors may comprise regulatory elements, such as a promoter, enhancer, terminator and the like, to cause or direct expression of said antibody upon administration to a subject.
- promoters and enhancers used in the expression vector for animal cell include early promoter and enhancer of SV40 (Mizukami T. et al. 1987), LTR promoter and enhancer of Moloney mouse leukemia virus (Kuwana Y et al. 1987), promoter (Mason JO et al. 1985) and enhancer (Gillies SD et al. 1983) of immunoglobulin H chain and the like.
- Any expression vector for animal cell can be used, so long as a gene encoding the human antibody C region can be inserted and expressed.
- suitable vectors include pAGE107 (Miyaji H et al. 1990), pAGE103 (Mizukami T et al. 1987), pHSG274 (Brady G et al. 1984), pKCR (O'Hare K et al. 1981), pSGl beta d2-4-(Miyaji H et al. 1990) and the like.
- Plasmids include replicating plasmids comprising an origin of replication, or integrative plasmids, such as for instance pUC, pcDNA, pBR, and the like.
- viral vector examples include adenoviral, retroviral, herpes virus and
- AAV vectors Such recombinant viruses may be produced by techniques known in the art, such as by transfecting packaging cells or by transient transfection with helper plasmids or viruses.
- Typical examples of virus packaging cells include PA317 cells, PsiCRIP cells, GPenv+ cells, 293 cells, etc.
- Detailed protocols for producing such replication-defective recombinant viruses may be found for instance in WO 95/14785, WO 96/22378, US 5,882,877, US 6,013,516, US 4,861,719, US 5,278,056 and WO 94/19478.
- a further object of the present invention relates to a host cell which has been transfected, infected or transformed by a nucleic acid and/or a vector according to the invention.
- transformation means the introduction of a "foreign” (i.e. extrinsic or extracellular) gene, DNA or R A sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence.
- a host cell that receives and expresses introduced DNA or RNA bas been "transformed”.
- the nucleic acids of the invention may be used to produce an antibody of the invention in a suitable expression system.
- expression system means a host cell and compatible vector under suitable conditions, e.g. for the expression of a protein coded for by foreign DNA carried by the vector and introduced to the host cell.
- Common expression systems include E. coli host cells and plasmid vectors, insect host cells and Baculovirus vectors, and mammalian host cells and vectors.
- Other examples of host cells include, without limitation, prokaryotic cells (such as bacteria) and eukaryotic cells (such as yeast cells, mammalian cells, insect cells, plant cells, etc.).
- E.coli Escherreocoli
- Kluyveromyces or Saccharomyces yeasts mammalian cell lines (e.g., Vera cells, CHO cells, 3T3 cells, COS cells, etc.) as well as primary or established mammalian cell cultures (e.g., produced from lymphoblasts, fibroblasts, embryonic cells, epithelial cells, nervous cells, adipocytes, etc.).
- mammalian cell lines e.g., Vera cells, CHO cells, 3T3 cells, COS cells, etc.
- primary or established mammalian cell cultures e.g., produced from lymphoblasts, fibroblasts, embryonic cells, epithelial cells, nervous cells, adipocytes, etc.
- Examples also include mouse SP2/0-Agl4 cell (ATCC CRL1581), mouse P3X63-Ag8.653 cell (ATCC CRL1580), CHO cell in which a dihydrofolate reductase gene (hereinafter referred to as "DHFR gene") is defective (Urlaub G et al; 1980), rat YB2/3HL.P2.G11.16Ag.20 cell (ATCC CRL1662, hereinafter referred to as "YB2/0 cell”), and the like.
- DHFR gene dihydrofolate reductase gene
- a human chimeric antibody of the present invention can be produced by obtaining nucleic sequences encoding VL and VH domains as previously described, constructing a human chimeric antibody expression vector by inserting them into an expression vector for animal cell having genes encoding human antibody CH and human antibody CL, and expressing the coding sequence by introducing the expression vector into an animal cell.
- CH domain of a human chimeric antibody it may be any region which belongs to human immunoglobulin, but those of IgG class are suitable and any one of subclasses belonging to IgG class, such as IgGl, IgG2, IgG3 and IgG4, can also be used.
- CL of a human chimeric antibody it may be any region which belongs to Ig, and those of kappa class or lambda class can be used.
- the antibodies of the present invention are humanized.
- a further object of the present invention also encompasses function-conservative variants of the antibodies of the present invention.
- “Function-conservative variants” are those in which a given amino acid residue in a protein or enzyme has been changed without altering the overall conformation and function of the polypeptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, hydrophobic, aromatic, and the like). Amino acids other than those indicated as conserved may differ in a protein so that the percent protein or amino acid sequence similarity between any two proteins of similar function may vary and may be, for example, from 70% to 99% as determined according to an alignment scheme such as by the Cluster Method, wherein similarity is based on the MEGALIGN algorithm.
- a “function-conservative variant” also includes a polypeptide which has at least 60% amino acid identity as determined by BLAST or FASTA algorithms, preferably at least 75%, more preferably at least 85%, still preferably at least 90%, and even more preferably at least 95%, and which has the same or substantially similar properties or functions as the native or parent protein to which it is compared.
- Two amino acid sequences are "substantially homologous” or “substantially similar” when greater than 80%, preferably greater than 85%, preferably greater than 90% of the amino acids are identical, or greater than about 90%, preferably greater than 95%, are similar (functionally identical) over the whole length of the shorter sequence.
- the similar or homologous sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin) pileup program, or any of sequence comparison algorithms such as BLAST, FASTA, etc.
- amino acids may be substituted by other amino acids in a protein structure without appreciable loss of activity. Since the interactive capacity and nature of a protein define the protein's biological functional activity, certain amino acid substitutions can be made in a protein sequence, and, of course, in its DNA encoding sequence, while nevertheless obtaining a protein with like properties. It is thus contemplated that various changes may be made in the antibodies sequences of the invention, or corresponding DNA sequences which encode said antibodies, without appreciable loss of their biological activity.
- amino acid substitutions are generally therefore based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- Exemplary substitutions which take various of the foregoing characteristics into consideration are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- glycosylation of the antibodies of the invention is altered in view of its fucose content.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagines-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- Chemical deglycosylation requires exposure of the antibody to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the antibody intact. Chemical deglycosylation is described by Sojahr H. et al. (1987) and by Edge, AS. et al. (1981). Enzymatic cleavage of carbohydrate moieties on antibodies can be achieved by the use of a variety of endo-and exo-glycosidases as described by Thotakura, NR. et al. (1987).
- the glycosylation of the antibodies of the invention is altered in that less than 65% of the glycan structures carried by the glycosylation site of the antibody comprise a fucose molecule.
- Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery.
- Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation.
- EP 1176195 by Hang et al. describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit hypofucosylation or are devoid of fucosyl residues.
- PCT Publication WO03/035835 by Presta describes a variant CHO cell line, Lecl3 cells, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also Shields, R.L. et al, 2002 J. Biol. Chem. 277:26733-26740).
- US7931895 and WO 01/77181 describe the production of low fucose antibodies produced in the YB2/0 cell line (ATCC ® , reference CRL-1662).
- Eureka Therapeutics further describes genetically engineered CHO mammalian cells capable of producing antibodies with altered mammalian glycosylation pattern devoid of fucosyl residues (http://www.eurekainc.com/a&boutus/companyoverview.html).
- the antibodies of the invention can be produced in yeasts or filamentous fungi engineered for mammalian- like glycosylation pattern and capable of producing antibodies lacking fucose as glycosylation pattern (see for example EP1297172B1).
- Antibody assays are described in detail below.
- the immunoassays which can be used include, but are not limited to, competitive assay systems using techniques such western blots, radioimmunoassays, ELISA, "sandwich” immunoassays, immunoprecipitation assays, precipitin assays, gel diffusion precipitin assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, and complement-fixation assays.
- Such assays are routine and well known in the art (see, e.g., Ausubel et al, eds, 1994 Current Protocols in Molecular Biology, Vol. 1, John Wiley & sons, Inc., New York).
- the BIACORE® GE Healthcare, Piscaataway, NJ
- routine cross-blocking assays such as those described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane, 1988, can be performed.
- An antibody of the invention can be conjugated with a detectable label to form an anti-HER3 immunoconjugate.
- Suitable detectable labels include, for example, a radioisotope, a fluorescent label, a chemiluminescent label, an enzyme label, a bio luminescent label or colloidal gold. Methods of making and detecting such detectably-labeled immunoconjugates are well-known to those of ordinary skill in the art, and are described in more detail below.
- the detectable label can be a radioisotope that is detected by autoradiography.
- Isotopes that are particularly useful for the purpose of the present invention are 3 H, 125 I, 131 I, 35 S and 14 C.
- Anti-HER3 immunoconjugates of the invention can also be labeled with a fluorescent compound.
- the presence of a fluorescently-labeled antibody is determined by exposing the immunoconjugate to light of the proper wavelength and detecting the resultant fluorescence.
- Fluorescent labeling compounds include fluorescein isothiocyanate, rhodamine, phycoerytherin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescamine.
- anti-HER3 immunoconjugates of the invention can be detectably labeled by coupling an antibody to a chemiluminescent compound.
- the presence of the chemiluminescent-tagged immunoconjugate is determined by detecting the presence of luminescence that arises during the course of a chemical reaction.
- chemiluminescent labeling compounds include luminol, isoluminol, an aromatic acridinium ester, an imidazole, an acridinium salt and an oxalate ester.
- Bio luminescent compound can be used to label anti-HER3 immunoconjugates of the present invention.
- Bio luminescence is a type of chemiluminescence found in biological systems in which a catalytic protein increases the efficiency of the chemiluminescent reaction. The presence of a bio luminescent protein is determined by detecting the presence of luminescence.
- Bio luminescent compounds that are useful for labeling include luciferin, luciferase and aequorin.
- anti-HER3 immunoconjugates can be detectably labeled by linking an anti-human-HER3 monoclonal antibody to an enzyme.
- the enzyme moiety reacts with the substrate to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorometric or visual means.
- enzymes that can be used to detectably label polyspecific immunoconjugates include ⁇ -galactosidase, glucose oxidase, peroxidase and alkaline phosphatase.
- ADC Antibody-drug conjugates
- the present invention provides an anti-human-HER3 monoclonal antibody-drug conjugate.
- An "anti-human-HER3 monoclonal antibody-drug conjugate" as used herein refers to an anti-human-HER3 monoclonal antibody according to the invention conjugated to a therapeutic agent.
- Such anti-human-HER3 monoclonal antibody-drug conjugates produce clinically beneficial effects on HER3 -expressing cells when administered to a subject, such as, for example, a subject with a HER3 -expressing cancer, typically when administered alone but also in combination with other therapeutic agents.
- an anti-human-HER3 monoclonal antibody is conjugated to a cytotoxic agent, such that the resulting antibody-drug conjugate (ADC) exerts a cytotoxic or cytostatic effect on a HER3 -expressing cell ⁇ e.g., a HER3 -expressing cancer cell) when taken up or internalized by the cell.
- ADC antibody-drug conjugate
- moieties for conjugation to antibodies are chemotherapeutic agents, prodrug converting enzymes, radioactive isotopes or compounds, or toxins.
- an anti-human-HER3 monoclonal antibody can be conjugated to a cytotoxic agent such as a chemotherapeutic agent or a toxin ⁇ e.g., a cytostatic or cytocidal agent such as, for example, abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin).
- a cytotoxic agent such as a chemotherapeutic agent or a toxin ⁇ e.g., a cytostatic or cytocidal agent such as, for example, abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin).
- cytotoxic agents include, for example, antitubulin agents, auristatins, DNA minor groove binders, DNA replication inhibitors, alkylating agents ⁇ e.g., platinum complexes such as cis-platin, mono(platinum), bis(platinum) and tri-nuclear platinum complexes and-carboplatin), anthracyclines, antibiotics, antifolates, antimetabolites, chemotherapy sensitizers, duocarmycins, etoposides, fluorinated pyrimidines, ionophores, lexitropsins, nitrosoureas, platinols, pre-forming compounds, purine antimetabolites, puromycins, radiation sensitizers, steroids, taxanes, topoisomerase inhibitors, vinca alkaloids, or the like.
- platinum complexes such as cis-platin, mono(platinum), bis(platinum) and tri-nuclear platinum complexes and-carb
- cytotoxic agents include, for example, an androgen, anthramycin
- AMC asparaginase, 5-azacytidine, azathioprine, bleomycin, busulfan, buthionine sulfoximine, camptothecin, carboplatin, carmustine (BSNU), CC-1065 (Li et al, Cancer Res.
- cytotoxic agents include, for example, dolastatins (e.g., auristatin E, AFP, MMAF, MMAE), DNA minor groove binders (e.g., enediynes and lexitropsins), duocarmycins, taxanes (e.g., paclitaxel and docetaxel), puromycins, vinca alkaloids, CC-1065, SN-38 (7-ethyl-lO-hydroxy-camptothein), topotecan, morpholino- doxorubicin, rhizoxin, cyanomorpholino-doxorubicin, echinomycin, combretastatin, netropsin, epothilone A and B, estramustine, cryptophysins, cemadotin, maytansinoids, discodermolide, eleutherobin, and mitoxantrone.
- dolastatins e.g., auristatin
- a cytotoxic agent is a conventional chemotherapeutic such as, for example, doxorubicin, paclitaxel, melphalan, vinca alkaloids, methotrexate, mitomycin C or etoposide.
- doxorubicin doxorubicin
- paclitaxel paclitaxel
- melphalan vinca alkaloids
- methotrexate mitomycin C or etoposide
- potent agents such as CC-1065 analogues, calicheamicin, maytansine, analogues of dolastatin 10, rhizoxin, and palytoxin can be linked to an anti-HER3 -expressing antibody.
- the cytotoxic or cytostatic agent is auristatin E (also known in the art as dolastatin- 10) or a derivative thereof.
- the auristatin E derivative is, e.g., an ester formed between auristatin E and a keto acid.
- auristatin E can be reacted with paraacetyl benzoic acid or benzoylvaleric acid to produce AEB and AEVB, respectively.
- auristatin derivatives include AFP (dimethylvaline-valine- dolaisoleuine-dolaproine-phenylalanine-p-phenylenediamine), MMAF (dovaline-valine- dolaisoleunine-dolaproine-phenylalanine), and MAE (monomethyl auristatin E).
- AFP dimethylvaline-valine- dolaisoleuine-dolaproine-phenylalanine-p-phenylenediamine
- MMAF dovaline-valine- dolaisoleunine-dolaproine-phenylalanine
- MAE monomethyl auristatin E
- the cytotoxic agent is a DNA minor groove binding agent.
- the minor groove binding agent is a CBI compound.
- the minor groove binding agent is an enediyne ⁇ e.g., calicheamicin).
- an antibody-drug conjugate comprises an anti- tubulin agent.
- anti-tubulin agents include, for example, taxanes ⁇ e.g., Taxol® (paclitaxel), Taxotere® (docetaxel)), T67 (Tularik), vinca alkyloids ⁇ e.g., vincristine, vinblastine, vindesine, and vinorelbine), and dolastatins ⁇ e.g., auristatin E, AFP, MMAF, MMAE, AEB, AEVB).
- antitubulin agents include, for example, baccatin derivatives, taxane analogs ⁇ e.g., epothilone A and B), nocodazole, colchicine and colcimid, estramustine, cryptophysins, cemadotin, maytansinoids, combretastatins, discodermolide, and eleutherobin.
- the cytotoxic agent is a maytansinoid, another group of anti-tubulin agents.
- the maytansinoid is maytansine or DM-1 (ImmunoGen, Inc.; see also Chari et al, Cancer Res. 52: 127-131, 1992).
- the cytotoxic agent is an antimetabolite.
- the antimetabolite can be, for example, a purine antagonist ⁇ e.g., azothioprine or mycophenolate mofetil), a dihydrofolate reductase inhibitor ⁇ e.g., methotrexate), acyclovir, gangcyclovir, zidovudine, vidarabine, ribavarin, azidothymidine, cytidine arabinoside, amantadine, dideoxyuridine, iododeoxyuridine, poscarnet, or trifluridine.
- a purine antagonist ⁇ e.g., azothioprine or mycophenolate mofetil
- a dihydrofolate reductase inhibitor ⁇ e.g., methotrexate
- acyclovir gangcyclovir
- zidovudine vidarabine
- ribavarin azidothymidine
- an anti-human-HER3 monoclonal antibody is conjugated to a pro-drug converting enzyme.
- the pro-drug converting enzyme can be recombinantly fused to the antibody or chemically conjugated thereto using known methods.
- Exemplary prodrug converting enzymes are carboxypeptidase G2, ⁇ -glucuronidase, penicillin- V-amidase, penicillin-G-amidase, ⁇ -lactamase, ⁇ -glucosidase, nitroreductase and carboxypeptidase A.
- the antibody-drug conjugate compounds comprise a linker unit between the drug unit and the antibody unit.
- the linker is cleavable under intracellular conditions, such that cleavage of the linker releases the drug unit from the antibody in the intracellular environment.
- the linker unit is not cleavable and the drug is released, for example, by antibody degradation.
- the linker is cleavable by a cleaving agent that is present in the intracellular environment (e.g., within a lysosome or endosome or caveolea).
- the linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease.
- the peptidyl linker is at least two amino acids long or at least three amino acids long.
- Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydro lyze dipeptide drug derivatives resulting in the release of active drug inside target cells (see, e.g., Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123).
- peptidyl linkers that are cleavable by enzymes that are present in 191P4D12-expressing cells. Examples of such linkers are described, e.g., in U.S. Pat. No. 6,214,345, incorporated herein by reference in its entirety and for all purposes.
- the peptidyl linker cleavable by an intracellular protease is a Val-Cit linker or a Phe-Lys linker (see, e.g., U.S. Pat. No. 6,214,345, which describes the synthesis of doxorubicin with the Val-Cit linker).
- One advantage of using intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
- the cleavable linker is pH-sensitive, i.e., sensitive to hydrolysis at certain pH values.
- the pH-sensitive linker hydrolyzable under acidic conditions.
- an acid-labile linker that is hydrolyzable in the lysosome e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like
- an acid-labile linker that is hydrolyzable in the lysosome e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like
- the hydrolyzable linker is a thioether linker (such as, e.g., a thioether attached to the therapeutic agent via an acylhydrazone bond (see, e.g., U.S. Pat. No. 5,622,929).
- the linker is cleavable under reducing conditions (e.g., a disulfide linker).
- a disulfide linker e.g., a disulfide linker.
- disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2- pyridyldithio)butyrate) and SMPT (N-succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2- pyridyl-dithio)toluene), SPDB and SMPT.
- SATA N-succinimidyl-S-acetylthioacetate
- SPDP N-succinimidy
- the linker is a malonate linker (Johnson et al, 1995, Anticancer Res. 15: 1387-93), a maleimidobenzoyl linker (Lau et al, 1995, Bioorg- Med-Chem. 3(10): 1299-1304), or a 3'-N-amide analog (Lau et al, 1995, Bioorg-Med-Chem. 3(10): 1305-12).
- the linker unit is not cleavable and the drug is released by antibody degradation.
- the linker is not substantially sensitive to the extracellular environment.
- “not substantially sensitive to the extracellular environment,” in the context of a linker means that no more than about 20%, typically no more than about 15%, more typically no more than about 10%, and even more typically no more than about 5%, no more than about 3%, or no more than about 1% of the linkers, in a sample of antibody-drug conjugate compound, are cleaved when the antibody-drug conjugate compound is present in an extracellular environment (e.g., in plasma).
- Whether a linker is not substantially sensitive to the extracellular environment can be determined, for example, by incubating with plasma the antibody-drug conjugate compound for a predetermined time period (e.g., 2, 4, 8, 16, or 24 hours) and then quantitating the amount of free drug present in the plasma.
- a predetermined time period e.g. 2, 4, 8, 16, or 24 hours
- Antibodies or immunoconjugates, in particular antibody-drug conjugate, of the invention may be useful for treating any HER3 -expressing cancer.
- the antibodies of the invention may be used alone or in combination with any suitable agent.
- Examples of HER3 -expressing cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia.
- cancers include squamous cell cancer, small- cell lung cancer, non-small cell lung cancer, gastric cancer, pancreatic cancer, glial cell tumors such as glioblastoma and neurofibromatosis, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, melanoma, colorectal cancer, endometrial carcinoma, salivary gland carcinoma, kidney cancer, renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancer.
- glial cell tumors such as glioblastoma and neurofibromatosis
- cervical cancer ovarian cancer
- liver cancer bladder cancer
- hepatoma hepatoma
- breast cancer colon cancer
- melanoma colorectal cancer
- endometrial carcinoma salivary gland carcinoma
- kidney cancer renal cancer
- prostate cancer vulval cancer
- thyroid cancer hepatic carcinoma and various types of head and neck cancer.
- breast cancer ovarian cancer
- small-cell lung cancer non- small cell lung cancer
- melanoma pancreatic cancer
- colorectal cancer and more particularly among breast cancer, ovarian cancer and pancreatic cancer.
- a cancer treated using the methods of the present invention is breast cancer or ovarian cancer.
- the present invention discloses a method for treating a cancer associated with the expression of HER3 comprising administering a subject in need thereof with a therapeutically effective amount of an antibody or immunoconjugate of the invention.
- the antibodies and immunoconjugates of the invention are more particularly effective for treating a cancer associated with the expression of HER3 wherein neuregulin is present, in particular neuregulin 1 ⁇ .
- an object of the present invention is an antibody, and/or an immunoconjugate, according to the invention for its use in the treatment of a cancer associated with the expression of HER3 wherein neuregulin is present, in particular neuregulin 1 ⁇ , in a subject.
- the antibodies and immunoconjugates of the invention are particularly suitable for the treatment of ligand (i.e. NRG) dependent cancers.
- the antibodies of the invention are particularly suitable for the treatment of autocrine or paracrine ligand-dependent tumors (due to its allosteric effect).
- the neuregulin present is secreted by the tumor and/or by the tissues and/or organs surrounding the tumor.
- the antibodies and immunoconjugates of the invention are particularly suitable for the treatment of cancers that are resistant to the treatment with antibodies, tyrosine kinase inhibitors (TKI), chemotherapeutic agents or anti-hormone agents.
- TKI tyrosine kinase inhibitors
- the antibodies of the invention are particularly suitable for the treatment of cancers selected from the group consisting of triple-negative breast cancer, pancreatic cancer, and renal cell carcinomas.
- an anti-human-HER3 monoclonal antibody or immunoconjugate in particular antibody-drug conjugate, is used in combination with a second agent for treatment of a disease or disorder.
- an anti-human-HER3 monoclonal antibody or immunoconjugate of the present invention may be used in combination with conventional cancer therapies such as, e.g., surgery, radiotherapy, chemotherapy, or combinations thereof.
- other therapeutic agents useful for combination cancer therapy with an anti-HER3 antibody or antibody-drug conjugate in accordance with the present invention include anti-angiogenic agents.
- an antibody or antibody-drug conjugate in accordance with the present invention is co-administered with a cytokine (e.g., a cytokine that stimulates an immune response against a tumor).
- a cytokine e.g., a cytokine that stimulates an immune response against a tumor.
- other therapeutic agents useful for combination therapy include an antagonist of certain factors that are involved in tumor growth such as, for example, EGFR, HER2, or HER4.
- an anti-human-HER3 monoclonal antibody or immunoconjugate, in particular antibody-drug conjugate, of the present invention is used in combination with an anti-human-HER2 monocolonal antibody, such as Trastuzumab or Pertuzumab.
- an anti-human-HER3 monoclonal antibody or immunoconjugate, in particular antibody-drug conjugate, as described herein is used in combination with a tyrosine kinase inhibitor (TKI).
- TKI tyrosine kinase inhibitor
- TKIs include, but are not limited to: Imatinib mesylate (Gleevec®, Novartis); Gefitinib (Iressa®, AstraZeneca); Erlotinib hydrochloride (Tarceva®, Genentech); Vandetanib (Zactima®, AstraZeneca), Tipifarnib (Zarnestra®, Janssen-Cilag); Dasatinib (Sprycel®, Bristol Myers Squibb); Lonafarnib (Sarasar®, Schering Plough); Vatalanib succinate (Novartis, Schering AG); Lapatinib (Tykerb®, GlaxoSmithKline); Nilotinib (Novartis); Lestaurtinib (Cephalon); Pazopanib hydrochloride (GlaxoSmithKline); Axitinib (Pfizer); Canertinib dihydro chloride (Pfizer); Pelitinib
- the anti-human-HER3 monoclonal antibody or antibody-drug conjugate of the invention is formulated as a pharmaceutical composition.
- a pharmaceutical composition comprising an anti-human-HER3 monoclonal antibody or antibody-drug conjugate can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the therapeutic molecule is combined in a mixture with a pharmaceutically acceptable carrier.
- a composition is said to be a "pharmaceutically acceptable carrier” if its administration can be tolerated by a recipient patient.
- Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier.
- Other suitable carriers are well-known to those in the art. (See, e.g., Gennaro (ed.), Remington's Pharmaceutical Sciences (Mack Publishing Company, 19th ed. 1995).) Formulations may further include one or more excipients, preservatives, solubilizers, buffering agents, albumin to prevent protein loss on vial surfaces, etc.
- compositions of the invention can be formulated for a topical, oral, parenteral, intranasal, intravenous, intramuscular, subcutaneous or intraocular administration and the like.
- the pharmaceutical compositions contain vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- vehicles which are pharmaceutically acceptable for a formulation capable of being injected.
- These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and the like or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.
- the doses used for the administration can be adapted as a function of various parameters, and in particular as a function of the mode of administration used, of the relevant pathology, or alternatively of the desired duration of treatment.
- an effective amount of the antibody may be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- An antibody of the invention can be formulated into a composition in a neutral or salt form.
- Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- the carrier can also be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetables oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminium monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile- filtered solution thereof.
- solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but drug release capsules and the like can also be employed.
- aqueous solutions For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, "Remington's Pharmaceutical Sciences" 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
- the antibodies of the invention may be formulated within a therapeutic mixture to comprise about 0.0001 to 1.0 milligrams, or about 0.001 to 0.1 milligrams, or about 0.1 to 1.0 or even about 10 milligrams per dose or so. Multiple doses can also be administered.
- other pharmaceutically acceptable forms include, e.g. tablets or other solids for oral administration; time release capsules ; and any other form currently used.
- liposomes and/or nanoparticles are contemplated for the introduction of antibodies into host cells.
- the formation and use of liposomes and/or nanoparticles are known to those of skill in the art.
- Nanocapsules can generally entrap compounds in a stable and reproducible way.
- ultrafme particles sized around 0.1 ⁇
- Biodegradable polyalkyl-cyanoacrylate nanoparticles that meet these requirements are contemplated for use in the present invention, and such particles may be are easily made.
- Liposomes are formed from phospholipids that are dispersed in an aqueous medium and spontaneously form multilamellar concentric bilayer vesicles (also termed multilamellar vesicles (MLVs)).
- MLVs generally have diameters of from 25 nm to 4 ⁇ . Sonication of MLVs results in the formation of small unilamellar vesicles (SUVs) with diameters in the range of 200 to 500 A, containing an aqueous solution in the core.
- SUVs small unilamellar vesicles
- the physical characteristics of liposomes depend on pH, ionic strength and the presence of divalent cations. Kits
- kits comprising at least one antibody of the invention.
- Kits containing antibodies of the invention find use in detecting HER3 expression, or in therapeutic or diagnostic assays.
- Kits of the invention can contain an antibody coupled to a solid support, e.g., a tissue culture plate or beads (e.g., sepharose beads).
- Kits can be provided which contain antibodies for detection and quantification of HER3 in vitro, e.g. in an ELISA or a Western blot.
- Such antibody useful for detection may be provided with a label such as a fluorescent or radio label.
- Low- fucose chimerized antibody GMB301 was obtained by sub-cloning of the VH and VL DNA sequences of parental 9F7-F11 antibody downstream to human Cgl and Ck genes into mammalian expression vector. Such low fucose antibody was substantially produced in the YB2/0 cell line (ATCC ® , reference CRL-1662).
- VH-CH 1 -CH2-CH3 gamma chain isotype 1 and VL-Ckappa DNA sequences were constructed by gene synthesis (Geneart®) with codons optimization.
- the neosynthetized heavy chain and light chain were subcloned into pMGM09-H and pMGM09-Lk vectors for each antibody chain expression.
- mammalian expression vectors permit the expression of the antibody in IgGl format isotype driven by a CMV promoter.
- the YB2/0 cells were transfected for the generation of stable pools and a batch production was carried out over one week.
- EXAMPLE 2 GMB301 BINDS TO HER3 EXTRACELLULAR DOMAIN WITH HIGH AFFINITY
- GMB301 was incubated for 1 hour at 37 °C in Maxisorp® plates (Nunc) coated wells with 50ng human HER3-Fc (recombinant HER3 extracellular domain Fc fusion, R&Dsystems).
- the GMB301 concentrations used were in the range of 3.3nM to 6.5pM.
- Bound GMB301 antibody were detected by a conjugated HRP-F(ab')2 goat anti human IgG F(ab')2 specific (Interchim). After two hours at 37 °C and three washes with PBS- Tween 2 o0.5 %, TMB (3,3,5,5 - tetramethylbenzidine, Sigma) was used as substrate for detecting HRP activity and 1M H 2 S0 4 was added to stop the reaction and plate was read at 450nm.
- the GMB301 antibody exhibits a subnanomolar affinity (EC50 0.19nM) to HER3 extracellular domain.
- EXAMPLE 3 IN VIVO EFFECTS OF GMB301 ON REDUCTION OF TUMOR GROWTH IN MICE XENOGRAFTED WITH A PANCREATIC CANCER CELL LINE AND COMPARISON WITH 9F7-F11
- Athymic, 6- to 8-week-old, female BALB/c nude were purchased from Janvier and Charles Rivers Laboratories. EGFR high , HER2/3 low , PTEN/PIK3CA wt, NRG negative and KRAS/BRAF-mutated NRGi -independent pancreatic cancer cells HP AC (3xl0 6 ) were injected s.c. into the right flank of athymic BALB/c nude mice. HP AC does not secrete the ligand NRGip. All in vivo experiments were done in compliance with the French guidelines for experimental animal studies (Agreement no. B34- 172-27).
- Tumor-bearing mice were randomized in the different treatment groups when the tumors reached an approximate volume of 150 mm 3 .
- the mice were treated by i.p. injections of GMB301 vs antibody 9F7-F11 vs vehicle (PBS).
- the amount of injected antibody was 300 ⁇ g/injection (15 mg/kg), twice a week, for 4 weeks consecutively (Q3D-4W).
- Tumor dimensions were measured weekly with a caliper and the volumes were calculated by the formula DlxD2xD3/2.
- pancreatic cancer cell line injected in the flank of athymic BALB/c nude mice is EGFR hlgh , HER2/3 high , KRASIBRAFIPTEN/PIK3CA wt, NRG positive NRGip-dependent pancreatic cancer cells BxPC3 (3xl0 6 ).
- BxPC3 expressed HER3 receptor at low level (around 10,000 receptors/cell) and secreted the ligand NRGi (NRGi -dependent paracrine model).
- the inventors have thus identified an antibody which is effective against NRG- dependent and independent cancers, with a superior effectiveness compared to known anti- HER3 antibodies in cancers where the natural ligand NRG is expressed.
- EXAMPLE 4 GMB301 ADCC ON TUMOR CELLS COMPARED TO H4B-121 EMABLING
- H4B-121 emabling (H4B-121-emb) was produced in YB2/0 cell line according to the Emabling ® Technology from LFB, which led to the generation of low-fucose H4B-121.
- ADCC was conducted using the Cytotox 96 Non-radioactive cytotoxicity assay (Promega) which measured the release of lactate dehydrogenase (LDH) from damaged cells.
- the target cells (T) from breast carcinoma MDA-MB-453 were cultivated in
- MDA-MB- 453 cells were added to each well of sterile flat-bottom 96-well plates, and pre-incubated for 24h at 37°C, 5% C02.
- PBMC Peripheral blood mononuclear cells
- E effector cells
- the cell number of PBMC was adjusted to 6xl0 6 cells/ml and 300,000 effector cells were added to each well (15: 1 E:T ratio).
- target cells alone target spontaneous LDH release
- PBMCs alone effector spontaneous LDH release
- target cells with PBMC antibody- independent LDH release
- target cells treated with Triton X-100 target maximum LDH release.
- Reconstituted LDH substrate mix (50 ⁇ /well) was added to each well of the enzymatic assay plate containing samples transferred from the cytotoxicity assay plate.
- percent specific lysis (LDH release from sample value - effector spontaneous release - target spontaneous release)/(target maximum release - target spontaneous
- GMB301 induces a stronger ADCC of MDA-MB-453 tumor cells (about 65% lysis) than the emabling version of the H4B-121 antibody (about 25% lysis).
- EXAMPLE 5 LOW-FUCOSE ANTI-HER3 ANTIBODIES H4B-121-Emb AND GMB301, PRODUCED IN YB2/0 CELLS, BIND TO THE HER3 RECEPTOR WITH SIMILAR AFFINITY
- Recombinant human HER3 extracellular domain (ECD) was purchased from R&D Systems and the H4B-121 was produced as indicated in example 4.
- TMB 3,3,5,5 tetramethylbenzidine, Sigma
- 1M H2S04 was added to stop the reaction
- plate was read at 450nm and binding data curves were analysed using four-parameter nonlinear regression fit from GraphPad Prism.
- H4B-121-Emb and GMB301 bind to the HER3 receptor with similar affinity H4B-121-emb having an EC50 of O.l lnM +/- 0.02, while GMB301 has an EC50 of 0.19nM +/-0.01.
- EXAMPLE 6 GMB301 IS MORE EFFICIENT TO REDUCE TUMOR GROWTH AND TO INCREASE SURVIVAL TIME OF NRG 1 - ADDIC TED TUMORS THAN ANTIBODY H4B-121 EMABLING
- the H4B-121 was produced as indicated in example 4.
- Athymic, 6- to 8-week-old, female BALB/c nude mice were purchased from Janvier and Charles Rivers Laboratories. NRGl-addicted pancreatic BxPC3 (3x106), triple- negative breast cancer HCC-1806 (1x106) and lung A549 cancer cells (4x106) were injected s.c. into the right flank of athymic BALB/c nude mice.
- Tumor-bearing mice were randomized in the different treatment groups when the tumors reached an approximate volume of 120-150 mm3.
- the mice were treated by i.p. injections of GMB301 vs H4B-121-Emb vs vehicle (NaCl - negative control).
- the amount of injected antibody was 300 ⁇ g/injection (15 mg/kg), twice a week, for 4 weeks consecutively (Q3D-4W).
- Tumor dimensions were measured one weekly with a caliper and the volumes were calculated by the formula DlxD2xD3/2.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2018509977A JP6987742B2 (ja) | 2015-05-06 | 2016-05-02 | 抗ヒトher3抗体及びその使用 |
| US15/571,720 US11001634B2 (en) | 2015-05-06 | 2016-05-02 | Anti-human-HER3 antibodies and uses thereof |
| BR112017023874A BR112017023874A2 (pt) | 2015-05-06 | 2016-05-02 | anticorpos anti-her3 humanos com baixa fucose e seus usos |
| RS20220065A RS62912B1 (sr) | 2015-05-06 | 2016-05-02 | Antihumana-her3 antitela i njihova primena |
| PL16722107T PL3292154T3 (pl) | 2015-05-06 | 2016-05-02 | Przeciwciała przeciwko ludzkiemu HER3 i ich zastosowania |
| ES16722107T ES2905531T3 (es) | 2015-05-06 | 2016-05-02 | Anticuerpos anti-HER3 humano y usos de los mismos |
| RU2017138468A RU2017138468A (ru) | 2015-05-06 | 2016-05-02 | Антитела против человеческого her3, имеющие низкое содержание фукозы, и области их применения |
| EP16722107.6A EP3292154B1 (en) | 2015-05-06 | 2016-05-02 | Anti-human-her3 antibodies and uses thereof |
| CN201680035940.1A CN107771183A (zh) | 2015-05-06 | 2016-05-02 | 抗‑人‑her3抗体及其用途 |
| CA2985143A CA2985143C (en) | 2015-05-06 | 2016-05-02 | Anti-human-her3 antibodies and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15305695.7 | 2015-05-06 | ||
| EP15305695.7A EP3091033A1 (en) | 2015-05-06 | 2015-05-06 | Anti-human-her3 antibodies and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016177664A1 true WO2016177664A1 (en) | 2016-11-10 |
Family
ID=53059029
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/059739 Ceased WO2016177664A1 (en) | 2015-05-06 | 2016-05-02 | Anti-human-her3 antibodies and uses thereof |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US11001634B2 (enExample) |
| EP (2) | EP3091033A1 (enExample) |
| JP (1) | JP6987742B2 (enExample) |
| CN (1) | CN107771183A (enExample) |
| BR (1) | BR112017023874A2 (enExample) |
| CA (1) | CA2985143C (enExample) |
| ES (1) | ES2905531T3 (enExample) |
| PL (1) | PL3292154T3 (enExample) |
| PT (1) | PT3292154T (enExample) |
| RS (1) | RS62912B1 (enExample) |
| RU (1) | RU2017138468A (enExample) |
| WO (1) | WO2016177664A1 (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113135995A (zh) * | 2020-01-17 | 2021-07-20 | 上海生物制品研究所有限责任公司 | 抗her3单克隆抗体及其应用 |
| WO2022116141A1 (zh) * | 2020-12-04 | 2022-06-09 | 上海复旦张江生物医药股份有限公司 | 抗体药物偶联物、其中间体、制备方法及应用 |
| WO2022262772A1 (en) * | 2021-06-15 | 2022-12-22 | Beijing Sinotau Bio-Pharmaceuticals Technology Co., Ltd. | Anti-her3 antibody, antibody drug conjugate containing the same, and use thereof |
| RU2805232C2 (ru) * | 2017-05-29 | 2023-10-12 | Экселиксис, Инк. | Ингибитор иммуносупрессии, связанный с раком |
| WO2025248097A3 (en) * | 2024-05-31 | 2026-01-15 | Gamamabs Pharma | Humanized anti-human her3 antibodies and uses thereof |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11326182B2 (en) | 2016-04-29 | 2022-05-10 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| WO2017189964A2 (en) | 2016-04-29 | 2017-11-02 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| CN110724194B (zh) * | 2018-07-17 | 2021-03-19 | 上海生物制品研究所有限责任公司 | 抗her3人源化单克隆抗体及其制剂 |
| KR102871791B1 (ko) | 2018-09-10 | 2025-10-15 | 미라티 테라퓨틱스, 인크. | 병용 요법 |
| GB201913079D0 (en) * | 2019-09-11 | 2019-10-23 | Hummingbird Bioscience Holdings Pte Ltd | Treatment and prevention of cancer using her3 antigen-binding molecules |
| IL314470A (en) * | 2022-01-25 | 2024-09-01 | Medilink Therapeutics Suzhou Co Ltd | Anti-Her3 antibody, conjugate and use thereof |
| CN115724979B (zh) * | 2022-10-13 | 2025-09-30 | 深圳市百士通科技开发有限公司 | 一种多功能重组抗体及其制备方法和应用 |
| CN116444672B (zh) * | 2023-06-13 | 2023-11-03 | 上海偌妥生物科技有限公司 | 人表皮生长因子3的抗体、其制备方法及其应用 |
Citations (50)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4486414A (en) | 1983-03-21 | 1984-12-04 | Arizona Board Of Reagents | Dolastatins A and B cell growth inhibitory substances |
| US4816444A (en) | 1987-07-10 | 1989-03-28 | Arizona Board Of Regents, Arizona State University | Cell growth inhibitory substance |
| US4861719A (en) | 1986-04-25 | 1989-08-29 | Fred Hutchinson Cancer Research Center | DNA constructs for retrovirus packaging cell lines |
| US4879278A (en) | 1989-05-16 | 1989-11-07 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear depsipeptide dolastatin 15 |
| US4880935A (en) | 1986-07-11 | 1989-11-14 | Icrf (Patents) Limited | Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates |
| WO1989012624A2 (en) | 1988-06-14 | 1989-12-28 | Cetus Corporation | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
| US4978744A (en) | 1989-01-27 | 1990-12-18 | Arizona Board Of Regents | Synthesis of dolastatin 10 |
| US4986988A (en) | 1989-05-18 | 1991-01-22 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear depsipeptides dolastatin 13 and dehydrodolastatin 13 |
| US5076973A (en) | 1988-10-24 | 1991-12-31 | Arizona Board Of Regents | Synthesis of dolastatin 3 |
| US5122368A (en) | 1988-02-11 | 1992-06-16 | Bristol-Myers Squibb Company | Anthracycline conjugates having a novel linker and methods for their production |
| US5138036A (en) | 1989-11-13 | 1992-08-11 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Isolation and structural elucidation of the cytostatic cyclodepsipeptide dolastatin 14 |
| US5202238A (en) | 1987-10-27 | 1993-04-13 | Oncogen | Production of chimeric antibodies by homologous recombination |
| US5204244A (en) | 1987-10-27 | 1993-04-20 | Oncogen | Production of chimeric antibodies by homologous recombination |
| US5278056A (en) | 1988-02-05 | 1994-01-11 | The Trustees Of Columbia University In The City Of New York | Retroviral packaging cell lines and process of using same |
| WO1994019478A1 (en) | 1993-02-22 | 1994-09-01 | The Rockefeller University | Production of high titer helper-free retroviruses by transient transfection |
| US5410024A (en) | 1993-01-21 | 1995-04-25 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide amides |
| WO1995014785A1 (fr) | 1993-11-23 | 1995-06-01 | Rhone-Poulenc Rorer S.A. | Composition pour la production de produits therapeutiques in vivo |
| US5504191A (en) | 1994-08-01 | 1996-04-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide methyl esters |
| US5521284A (en) | 1994-08-01 | 1996-05-28 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide amides and esters |
| US5530097A (en) | 1994-08-01 | 1996-06-25 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory peptide amides |
| WO1996022378A1 (fr) | 1995-01-20 | 1996-07-25 | Rhone-Poulenc Rorer S.A. | Cellules pour la production d'adenovirus recombinants |
| US5554725A (en) | 1994-09-14 | 1996-09-10 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Synthesis of dolastatin 15 |
| US5599902A (en) | 1994-11-10 | 1997-02-04 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Cancer inhibitory peptides |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5641869A (en) | 1991-05-24 | 1997-06-24 | Genentech, Inc. | Method for purifying heregulin |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US5824805A (en) | 1995-12-22 | 1998-10-20 | King; Dalton | Branched hydrazone linkers |
| US5882877A (en) | 1992-12-03 | 1999-03-16 | Genzyme Corporation | Adenoviral vectors for gene therapy containing deletions in the adenoviral genome |
| US6013516A (en) | 1995-10-06 | 2000-01-11 | The Salk Institute For Biological Studies | Vector and method of use for nucleic acid delivery to non-dividing cells |
| US6034065A (en) | 1992-12-03 | 2000-03-07 | Arizona Board Of Regents | Elucidation and synthesis of antineoplastic tetrapeptide phenethylamides of dolastatin 10 |
| US6130237A (en) | 1996-09-12 | 2000-10-10 | Cancer Research Campaign Technology Limited | Condensed N-aclyindoles as antitumor agents |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US6239104B1 (en) | 1997-02-25 | 2001-05-29 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear and cyclo-depsipeptides dolastatin 16, dolastatin 17, and dolastatin 18 |
| WO2001077181A2 (fr) | 2000-04-12 | 2001-10-18 | Laboratoire Francais Du Fractionnement Et Des Biotechnologies | Anticorps monoclonaux anti-rhesus d |
| US6323315B1 (en) | 1999-09-10 | 2001-11-27 | Basf Aktiengesellschaft | Dolastatin peptides |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| WO2002088172A2 (en) | 2001-04-30 | 2002-11-07 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US20030083263A1 (en) | 2001-04-30 | 2003-05-01 | Svetlana Doronina | Pentapeptide compounds and uses related thereto |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| EP1297172B1 (en) | 2000-06-28 | 2005-11-09 | Glycofi, Inc. | Methods for producing modified glycoproteins |
| WO2005117973A2 (en) | 2004-05-05 | 2005-12-15 | Merrimack Pharmaceuticals, Inc. | Bispecific binding agents for modulating biological activity |
| WO2006091209A2 (en) | 2005-02-23 | 2006-08-31 | Merrimack Pharmaceuticals, Inc. | Bispecific binding agents for modulating biological activity |
| WO2007077028A2 (en) | 2005-12-30 | 2007-07-12 | U3 Pharma Ag | Antibodies directed to her-3 and uses thereof |
| WO2008100624A2 (en) | 2007-02-16 | 2008-08-21 | Merrimack Pharmaceuticals, Inc. | Antibodies against erbb3 and uses thereof |
| WO2012156532A1 (en) * | 2011-05-19 | 2012-11-22 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anti-human-her3 antibodies and uses thereof |
| WO2014108484A2 (en) * | 2013-01-11 | 2014-07-17 | F. Hoffmann-La Roche Ag | Combination therapy of anti-her3 antibodies |
| WO2015067986A1 (en) * | 2013-11-07 | 2015-05-14 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Neuregulin allosteric anti-her3 antibody |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101039958A (zh) * | 2004-07-21 | 2007-09-19 | 格利科菲公司 | 含有主要是man3glcnac2糖形的免疫球蛋白 |
| PH12012501157A1 (en) * | 2009-12-22 | 2012-10-29 | Roche Glycart Ag | Anti-her3 antibodies and uses thereof |
| EP2407487A1 (en) * | 2010-07-14 | 2012-01-18 | F-Star Biotechnologische Forschungs - und Entwicklungsges. M.B.H. | Multispecific modular antibody |
| WO2012016576A1 (en) * | 2010-08-04 | 2012-02-09 | Glycotope Gmbh | Improved recombinant human follicle-stimulating hormone |
| EP2617730B1 (en) * | 2010-09-17 | 2018-03-07 | National Institute of Advanced Industrial Science And Technology | Lung cancer differential marker |
| BR112015031572A2 (pt) * | 2013-06-21 | 2017-07-25 | Dsm Ip Assets Bv | novo processo para a manutenção de uma razão de isômeros de compostos carotenoides |
-
2015
- 2015-05-06 EP EP15305695.7A patent/EP3091033A1/en not_active Withdrawn
-
2016
- 2016-05-02 WO PCT/EP2016/059739 patent/WO2016177664A1/en not_active Ceased
- 2016-05-02 PT PT167221076T patent/PT3292154T/pt unknown
- 2016-05-02 CN CN201680035940.1A patent/CN107771183A/zh active Pending
- 2016-05-02 BR BR112017023874A patent/BR112017023874A2/pt not_active Application Discontinuation
- 2016-05-02 ES ES16722107T patent/ES2905531T3/es active Active
- 2016-05-02 RS RS20220065A patent/RS62912B1/sr unknown
- 2016-05-02 PL PL16722107T patent/PL3292154T3/pl unknown
- 2016-05-02 JP JP2018509977A patent/JP6987742B2/ja not_active Expired - Fee Related
- 2016-05-02 US US15/571,720 patent/US11001634B2/en active Active
- 2016-05-02 RU RU2017138468A patent/RU2017138468A/ru not_active Application Discontinuation
- 2016-05-02 CA CA2985143A patent/CA2985143C/en active Active
- 2016-05-02 EP EP16722107.6A patent/EP3292154B1/en active Active
Patent Citations (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4486414A (en) | 1983-03-21 | 1984-12-04 | Arizona Board Of Reagents | Dolastatins A and B cell growth inhibitory substances |
| US4861719A (en) | 1986-04-25 | 1989-08-29 | Fred Hutchinson Cancer Research Center | DNA constructs for retrovirus packaging cell lines |
| US4880935A (en) | 1986-07-11 | 1989-11-14 | Icrf (Patents) Limited | Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates |
| US4816444A (en) | 1987-07-10 | 1989-03-28 | Arizona Board Of Regents, Arizona State University | Cell growth inhibitory substance |
| US5202238A (en) | 1987-10-27 | 1993-04-13 | Oncogen | Production of chimeric antibodies by homologous recombination |
| US5204244A (en) | 1987-10-27 | 1993-04-20 | Oncogen | Production of chimeric antibodies by homologous recombination |
| US5278056A (en) | 1988-02-05 | 1994-01-11 | The Trustees Of Columbia University In The City Of New York | Retroviral packaging cell lines and process of using same |
| US5122368A (en) | 1988-02-11 | 1992-06-16 | Bristol-Myers Squibb Company | Anthracycline conjugates having a novel linker and methods for their production |
| WO1989012624A2 (en) | 1988-06-14 | 1989-12-28 | Cetus Corporation | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
| US5076973A (en) | 1988-10-24 | 1991-12-31 | Arizona Board Of Regents | Synthesis of dolastatin 3 |
| US4978744A (en) | 1989-01-27 | 1990-12-18 | Arizona Board Of Regents | Synthesis of dolastatin 10 |
| US4879278A (en) | 1989-05-16 | 1989-11-07 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear depsipeptide dolastatin 15 |
| US4986988A (en) | 1989-05-18 | 1991-01-22 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear depsipeptides dolastatin 13 and dehydrodolastatin 13 |
| US5138036A (en) | 1989-11-13 | 1992-08-11 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Isolation and structural elucidation of the cytostatic cyclodepsipeptide dolastatin 14 |
| US5641869A (en) | 1991-05-24 | 1997-06-24 | Genentech, Inc. | Method for purifying heregulin |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US6034065A (en) | 1992-12-03 | 2000-03-07 | Arizona Board Of Regents | Elucidation and synthesis of antineoplastic tetrapeptide phenethylamides of dolastatin 10 |
| US5882877A (en) | 1992-12-03 | 1999-03-16 | Genzyme Corporation | Adenoviral vectors for gene therapy containing deletions in the adenoviral genome |
| US5410024A (en) | 1993-01-21 | 1995-04-25 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| WO1994019478A1 (en) | 1993-02-22 | 1994-09-01 | The Rockefeller University | Production of high titer helper-free retroviruses by transient transfection |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| WO1995014785A1 (fr) | 1993-11-23 | 1995-06-01 | Rhone-Poulenc Rorer S.A. | Composition pour la production de produits therapeutiques in vivo |
| US5665860A (en) | 1994-08-01 | 1997-09-09 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory peptide amides |
| US5504191A (en) | 1994-08-01 | 1996-04-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide methyl esters |
| US5530097A (en) | 1994-08-01 | 1996-06-25 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory peptide amides |
| US5521284A (en) | 1994-08-01 | 1996-05-28 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide amides and esters |
| US5554725A (en) | 1994-09-14 | 1996-09-10 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Synthesis of dolastatin 15 |
| US5599902A (en) | 1994-11-10 | 1997-02-04 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Cancer inhibitory peptides |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| WO1996022378A1 (fr) | 1995-01-20 | 1996-07-25 | Rhone-Poulenc Rorer S.A. | Cellules pour la production d'adenovirus recombinants |
| US6013516A (en) | 1995-10-06 | 2000-01-11 | The Salk Institute For Biological Studies | Vector and method of use for nucleic acid delivery to non-dividing cells |
| US5824805A (en) | 1995-12-22 | 1998-10-20 | King; Dalton | Branched hydrazone linkers |
| US6130237A (en) | 1996-09-12 | 2000-10-10 | Cancer Research Campaign Technology Limited | Condensed N-aclyindoles as antitumor agents |
| US6239104B1 (en) | 1997-02-25 | 2001-05-29 | Arizona Board Of Regents | Isolation and structural elucidation of the cytostatic linear and cyclo-depsipeptides dolastatin 16, dolastatin 17, and dolastatin 18 |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| US6323315B1 (en) | 1999-09-10 | 2001-11-27 | Basf Aktiengesellschaft | Dolastatin peptides |
| WO2001077181A2 (fr) | 2000-04-12 | 2001-10-18 | Laboratoire Francais Du Fractionnement Et Des Biotechnologies | Anticorps monoclonaux anti-rhesus d |
| US7931895B2 (en) | 2000-04-12 | 2011-04-26 | Lfb Biotechnologies | Monoclonal antibodies with enhanced ADCC function |
| EP1297172B1 (en) | 2000-06-28 | 2005-11-09 | Glycofi, Inc. | Methods for producing modified glycoproteins |
| WO2002088172A2 (en) | 2001-04-30 | 2002-11-07 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| US6884869B2 (en) | 2001-04-30 | 2005-04-26 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| US20030083263A1 (en) | 2001-04-30 | 2003-05-01 | Svetlana Doronina | Pentapeptide compounds and uses related thereto |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2005117973A2 (en) | 2004-05-05 | 2005-12-15 | Merrimack Pharmaceuticals, Inc. | Bispecific binding agents for modulating biological activity |
| WO2006091209A2 (en) | 2005-02-23 | 2006-08-31 | Merrimack Pharmaceuticals, Inc. | Bispecific binding agents for modulating biological activity |
| WO2007077028A2 (en) | 2005-12-30 | 2007-07-12 | U3 Pharma Ag | Antibodies directed to her-3 and uses thereof |
| WO2008100624A2 (en) | 2007-02-16 | 2008-08-21 | Merrimack Pharmaceuticals, Inc. | Antibodies against erbb3 and uses thereof |
| WO2012156532A1 (en) * | 2011-05-19 | 2012-11-22 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anti-human-her3 antibodies and uses thereof |
| WO2014108484A2 (en) * | 2013-01-11 | 2014-07-17 | F. Hoffmann-La Roche Ag | Combination therapy of anti-her3 antibodies |
| WO2015067986A1 (en) * | 2013-11-07 | 2015-05-14 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Neuregulin allosteric anti-her3 antibody |
Non-Patent Citations (52)
| Title |
|---|
| "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| "Current Protocols in Molecular Biology", vol. 1, 1994, JOHN WILEY & SONS, INC. |
| "Methods In Enzymology", vol. 184, 1990, ACADEMIC PRESS, article "Avidin-Biotin Technology" |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, and Future Prospective of the Therapeutic Use of Radiolabeled Antibody In Cancer Therapy" |
| "Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING COMPANY |
| "Remington's Pharmaceutical Sciences", pages: 1035 - 1038,157 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy" |
| BAYER ET AL.: "Methods In Molecular Biology", vol. 10, 1992, THE HUMANA PRESS, INC., article "Immunochemical Applications of Avidin-Biotin Technology", pages: 149 - 162 |
| CHARI ET AL., CANCER RES., vol. 52, 1992, pages 127 - 131 |
| CHO; LEAHY, SCIENCE, vol. 297, 2002, pages 1330 - 1333 |
| COOK; SELF: "Monoclonal Antibodies: Production, Engineering, and Clinical Application", 1995, CAMBRIDGE UNIVERSITY PRESS, article "Monoclonal Antibodies in Diagnostic Immunoassays", pages: 180 - 208 |
| DESBOIS-MOUTHON, CLIN CANCER RES, 2009 |
| DIAMANDIS: "Immunoassay", 1996, ACADEMIC PRESS, INC. |
| DUBOWCHIK; WALKER, PHARM. THERAPEUTICS, vol. 83, 1999, pages 67 - 123 |
| E. MEYERS; W. MILLER, COMPUT. APPL. BIOSCI., vol. 4, 1988, pages 1 1 - 17 |
| FALLS AND D.: "neuregulins: functions, forms, and signaling strategies", EXPERIMENTAL CELL RESEARCH, vol. 284, no. 1, 2003, pages 14 - 30, XP002573567, DOI: doi:10.1016/S0014-4827(02)00102-7 |
| GROENEN ET AL., GROWTH FACTORS, vol. 11, 1994, pages 235 - 257 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEIKER, INC., article "Antibodies For Drug Delivery" |
| HOLMES ET AL., SCIENCE, vol. 256, 1992, pages 1205 - 1210 |
| HO-PUN-CHEUNG, INT J CANCER, 2010 |
| JOHNSON ET AL., ANTICANCER RES., vol. 15, 1995, pages 1387 - 93 |
| KANI ET AL., BIOCHEMISTRY, vol. 44, 2005, pages 15842 - 857 |
| KENNEDY ET AL., CLIN. CHIRN. ACTA, vol. 70, 1976, pages 1 |
| KRUSER, EXP CELL RES, 2010 |
| LAU ET AL., BIOORG-MED-CHEM., vol. 3, no. 10, 1995, pages 1299 - 1304 |
| LAU ET AL., BIOORG-MED-CHEM., vol. 3, no. 10, 1995, pages 1305 - 12 |
| LAZREK ET AL., NEOPLASIA, vol. 15, no. 3, March 2013 (2013-03-01), pages 335 - 347 |
| LAZREK Y ET AL: "Anti-HER3 domain 1 and 3 antibodies reduce tumor growth by hindering HER2/HER3 dimerization and AKT-induced MDM2, XIAP, and FoxO1 phosphorylation", NEOPLASIA, NEOPLASIA PRESS, ANN ARBOR, MI, US, vol. 15, no. 3, March 2013 (2013-03-01), pages 335 - 347, XP002727137, ISSN: 1522-8002 * |
| LEE ET AL., PHARM. REV., vol. 47, 1995, pages 51 - 85 |
| LEE-HOEFLICH ST, CANCER RES., 2008 |
| LEMKE, G., MOLEC. & CELL. NEUROSCI., vol. 7, 1996, pages 247 - 262 |
| LI ET AL., CANCER RES., vol. 42, 1982, pages 999 - 1004 |
| LU, CANCER RES, 2007 |
| MCINTYRE E, BREAST CANCER RES TREAT., 2010 |
| NADÈGE GABORIT ET AL: "Examination of HER3 targeting in cancer using monoclonal antibodies", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 112, no. 3, 6 January 2015 (2015-01-06), pages 839 - 844, XP055206109, ISSN: 0027-8424, DOI: 10.1073/pnas.1423645112 * |
| NARAYAN, CANCER RES., 2009 |
| NEEDLEMAN; WUNSCH, J. MOL, BIOL., vol. 48, 1970, pages 444 - 453 |
| NEVILLE ET AL., BIOL. CHEM, vol. 264, 1989, pages 14653 - 14661 |
| PERRY: "Monoclonal Antibodies: Principles and Applications", 1995, WILEY-LISS, INC., article "The Role of Monoclonal Antibodies in the Advancement of Immunoassay Technology", pages: 107 - 120 |
| PLOWMAN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 4905 - 4909 |
| SCHAEFER ET AL., ONCOGENE, vol. 15, 1997, pages 1385 - 1394 |
| SCHURS ET AL., CLIN. CHIM. ACTA, vol. 81, 1977, pages 1 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| SHIH ET AL., INT'L J. CANCER, vol. 46, 1990, pages 1101 |
| SMITH ET AL., BR. J. CANCER, 2004 |
| STEIN ET AL., CANCER RES., vol. 50, 1990, pages 1330 |
| TANNER B, J CLIN ONCOL., 2006 |
| THORPE ET AL., CANCER RES., vol. 47, 1987, pages 5924 - 5931 |
| THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58 |
| THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review" |
| WAWRZYNCZAK ET AL.: "Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy of Cancer", 1987, OXFORD U. PRESS |
| WHEELER, ONCOGENE, 2008 |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2805232C2 (ru) * | 2017-05-29 | 2023-10-12 | Экселиксис, Инк. | Ингибитор иммуносупрессии, связанный с раком |
| CN113135995A (zh) * | 2020-01-17 | 2021-07-20 | 上海生物制品研究所有限责任公司 | 抗her3单克隆抗体及其应用 |
| CN113135995B (zh) * | 2020-01-17 | 2022-08-12 | 上海生物制品研究所有限责任公司 | 抗her3单克隆抗体及其应用 |
| WO2022116141A1 (zh) * | 2020-12-04 | 2022-06-09 | 上海复旦张江生物医药股份有限公司 | 抗体药物偶联物、其中间体、制备方法及应用 |
| US12178880B2 (en) | 2020-12-04 | 2024-12-31 | Shanghai Fudan-Zhangjiang Bio-Pharmaceutical Co., Ltd. | Antibody-drug conjugate, and intermediate thereof, preparation method therefor, and application thereof |
| WO2022262772A1 (en) * | 2021-06-15 | 2022-12-22 | Beijing Sinotau Bio-Pharmaceuticals Technology Co., Ltd. | Anti-her3 antibody, antibody drug conjugate containing the same, and use thereof |
| WO2025248097A3 (en) * | 2024-05-31 | 2026-01-15 | Gamamabs Pharma | Humanized anti-human her3 antibodies and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107771183A (zh) | 2018-03-06 |
| CA2985143A1 (en) | 2016-11-10 |
| US20180155433A1 (en) | 2018-06-07 |
| PT3292154T (pt) | 2022-01-26 |
| EP3091033A1 (en) | 2016-11-09 |
| ES2905531T3 (es) | 2022-04-11 |
| PL3292154T3 (pl) | 2022-04-19 |
| BR112017023874A2 (pt) | 2018-07-24 |
| CA2985143C (en) | 2023-10-17 |
| EP3292154A1 (en) | 2018-03-14 |
| RU2017138468A (ru) | 2019-06-06 |
| US11001634B2 (en) | 2021-05-11 |
| EP3292154B1 (en) | 2021-11-03 |
| RS62912B1 (sr) | 2022-03-31 |
| JP6987742B2 (ja) | 2022-01-05 |
| RU2017138468A3 (enExample) | 2019-09-03 |
| JP2018515137A (ja) | 2018-06-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11001634B2 (en) | Anti-human-HER3 antibodies and uses thereof | |
| EP2710040B1 (en) | Anti-human-her3 antibodies and uses thereof | |
| EP2723377B1 (en) | Anti-axl antibodies and uses thereof | |
| EP2723376B1 (en) | Anti-axl antibodies and uses thereof | |
| CA2929386C (en) | Neuregulin allosteric anti-her3 antibody | |
| US20180291098A1 (en) | Anti-nrg1 (heregulin) antibodies and uses thereof | |
| JP6655673B2 (ja) | ニューレグリンに対して非競合的でアロステリックな抗ヒトher3抗体及びその使用 | |
| NZ618740B2 (en) | Anti-axl antibodies and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16722107 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15571720 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2985143 Country of ref document: CA Ref document number: 2018509977 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017138468 Country of ref document: RU |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017023874 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112017023874 Country of ref document: BR Kind code of ref document: A2 Effective date: 20171106 |