WO2016077249A1 - Compositions and methods for expressing polypeptides on the surface of cells - Google Patents

Compositions and methods for expressing polypeptides on the surface of cells Download PDF

Info

Publication number
WO2016077249A1
WO2016077249A1 PCT/US2015/059787 US2015059787W WO2016077249A1 WO 2016077249 A1 WO2016077249 A1 WO 2016077249A1 US 2015059787 W US2015059787 W US 2015059787W WO 2016077249 A1 WO2016077249 A1 WO 2016077249A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
cell
nucleic acid
stalk
amino acids
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/059787
Other languages
English (en)
French (fr)
Inventor
Aaron Michael RING
Andrew KRUSE
Aashish MANGLIK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Leland Stanford Junior University
Original Assignee
Leland Stanford Junior University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Leland Stanford Junior University filed Critical Leland Stanford Junior University
Priority to EP15859426.7A priority Critical patent/EP3218477A4/en
Priority to US15/525,397 priority patent/US10829771B2/en
Priority to JP2017524052A priority patent/JP7235436B2/ja
Priority to CN201580059777.8A priority patent/CN107075507B/zh
Publication of WO2016077249A1 publication Critical patent/WO2016077249A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/80Vectors or expression systems specially adapted for eukaryotic hosts for fungi
    • C12N15/81Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70532B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1037Screening libraries presented on the surface of microorganisms, e.g. phage display, E. coli display
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6863Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872Intracellular protein regulatory factors and their receptors, e.g. including ion channels
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/035Fusion polypeptide containing a localisation/targetting motif containing a signal for targeting to the external surface of a cell, e.g. to the outer membrane of Gram negative bacteria, GPI- anchored eukaryote proteins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70503Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
    • G01N2333/70521CD28, CD152
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70503Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
    • G01N2333/70532B7 molecules, e.g. CD80, CD86
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/715Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons
    • G01N2333/7155Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]

Definitions

  • surface display can be used for a diverse array of purposes.
  • yeast are eukaryotic
  • using yeast for surface display is well suited for engineering and modifying mammalian proteins (e.g., via directed evolution) that require post- translational modifications for efficient folding and activity (e.g., cell-surface and secreted proteins such as antibodies, receptors, cytokines, and the like).
  • a protein of interest is fused to the Aga2p protein, which is naturally used by yeast to mediate cell-cell contacts during mating.
  • the current surface display methods require multiple genes to be expressed and are limited with respect to the steric accessibility of a displayed protein of interest.
  • compositions and methods that allow for the monocistronic expression and surface display of proteins of interest, e.g., in a way that allows for an adjustable ("tunable") level of accessibility.
  • Methods and compositions are provided for displaying a protein of interest (POI) on the surface of a eukaryotic cell (e.g., a mammalian cell, a fungal cell, a yeast cell, etc.) by fusing the POI to a display moiety (e.g., a moiety having a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide) to generate a surface accessible fusion protein.
  • a display moiety e.g., a moiety having a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide
  • a surface accessible fusion protein is introduced into a eukaryotic cell as part of a nucleic acid (e.g., a recombinant expression vector).
  • Nucleic acids are provided that include nucleotide sequences encoding a display moiety (e.g., a moiety having a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide).
  • a subject nucleic acid includes an insertion site for the insertion of a POI.
  • a subject nucleic acid includes a nucleotide sequence that encodes a POI.
  • a stalk polypeptide is a synthetic stalk polypeptide and various example synthetic stalk polypeptides are disclosed herein.
  • a surface anchor polypeptide is a
  • GPI anchor domain glycosylphosphatidylinisotol (GPI) anchor domain.
  • GPI anchor domain is a synthetic GPI anchor domain.
  • a surface anchor polypeptide is a
  • Methods are provided for measuring the binding of an agent to a POI (e.g.,
  • Methods are also provided for identifying an agent that binds to a POI (e.g., screening test compounds for an agent that binds to a given POI); for identifying a polypeptide that binds to a given agent (e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g., to identify a polypeptide that binds to an agent with an affinity greater than or equal to a pre-determined value); and for generating a variant polypeptide that binds to an agent with an affinity that is different (e.g., greater) than the affinity of the polypeptide from which the variant was derived.
  • an agent that binds to a POI e.g., screening test compounds for an agent that binds to a given POI
  • identifying a polypeptide that binds to a given agent e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g
  • Kits are also provided that include various components of the subject compositions, and such kits can be used to practice the subject methods.
  • FIG. 1A-1C Manipulation of peptide accessibility using variable-length, GPI-anchored "stalks.”
  • Fig. 1 A Schematic of one embodiment of peptide linkage to the yeast cell surface:
  • a protein of interest (POI) (here, the engineered SIRPa variant CV1 ) is secreted as a surface accessible fusion protein in which the POI is fused to (i) a signal polypeptide (which directs the protein to the secretory pathway, but which can be cleaved from the protein via post- translational processing), (ii) a stalk polypeptide (a synthetic sequence, the length of which can be modified over a wide range of lengths), (iii) a GPI anchor (e.g.
  • FIG. 1 B Experimental results showing the relationship between stalk length (in amino acids) and surface staining for 3 labeled probes: anti-HA antibody (-150 kD), CD47-streptavidin tetramers (-100 kD), and CD47-biotin monomers (-15 kDa).
  • FIG. 1C Representative flow cytometry plots of yeast displaying CV-1 attached to different length stalks stained simultaneously with Anti-HA antibodies (Alexa488) and CD47-biotin monomers (Alexa647). The length of the tested stalk sequences, in number of amino acids, is listed above each plot.
  • Fig. 2A-2B The subject compositions and methods are compatible with additional yeast strains.
  • Fig. 2A Schematic of peptide linkage to the yeast cell surface.
  • the engineered SIRPA variant CV1 was secreted as a fusion to the HA epitope tag and a 649 amino-acid long synthetic stalk with a synthetic GPI anchor (i.e, CV1 was the protein of interest (POI), which was expressed as a surface accessible fusion polypeptide).
  • POI protein of interest
  • the yeast strain used for these experiments was YVH10, in contrast to BJ5465 used in Fig. 1A-1 C.
  • YVH10 yeast overexpress yeast protein disulfide isomerase (PDI), enabling greater folding capacity for secreted, disulfide-bond containing proteins.
  • Fig. 2B Representative flow cytometry plots of YVH10 yeast displaying CV-1 attached to a 649 amino acid stalks stained simultaneously with Anti- HA antibodies (Alexa488) and CD47-biotin monomers (Alexa647).
  • Methods and compositions are provided for displaying a protein of interest (POI) on the surface of a eukaryotic cell (e.g., a mammalian cell, a fungal cell, a yeast cell, etc.) by fusing the POI to a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide to generate a surface accessible fusion protein.
  • a surface accessible fusion protein is introduced into a eukaryotic cell as part of a nucleic acid (e.g., a recombinant expression vector).
  • Nucleic acids are provided that include nucleotide sequences encoding a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide.
  • a subject nucleic acid includes and insertion site for the insertion of a POI.
  • a subject nucleic acid includes a nucleotide sequence that encodes a POI.
  • a stalk polypeptide is a synthetic stalk polypeptide and various example synthetic stalk polypeptides are disclosed herein.
  • a surface anchor polypeptide is a glycosylphosphatidylinisotol (GPI) anchor domain.
  • GPI anchor domain is a synthetic GPI anchor domain.
  • Methods are provided for measuring the binding of an agent to a POI (e.g.,
  • Methods are also provided for identifying an agent that binds to a POI (e.g., screening test compounds for an agent that binds to a given POI); for identifying a polypeptide that binds to a given agent (e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g., to identify a polypeptide that binds to an agent with an affinity greater than or equal to a pre-determined value); and for generating a variant polypeptide that binds to an agent with an affinity that is different (e.g., greater) than the affinity of the polypeptide from which the variant was derived.
  • an agent that binds to a POI e.g., screening test compounds for an agent that binds to a given POI
  • identifying a polypeptide that binds to a given agent e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g
  • Kits are also provided that include various components of the subject compositions, and such kits can be used to practice the subject methods.
  • polypeptides known to those skilled in the art, and so forth.
  • polypeptide In the description that follows, a number of terms conventionally used in the field are utilized. In order to provide a clear and consistent understanding of the specification and claims, and the scope to be given to such terms, the following definitions are provided. [0018]
  • polypeptide polypeptide
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an .alpha, carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • compositions e.g., a synthetic stalk polypeptide, a synthetic surface anchor polypeptide, a synthetic signal polypeptide, and the like
  • component is non-naturally occurring.
  • a synthetic stalk polypeptide by definition comprises a non-naturally occurring amino acid sequence
  • a synthetic surface anchor polypeptide by definition comprises a non- naturally occurring amino acid sequence
  • a synthetic signal polypeptide by definition comprises a non-naturally occurring amino acid sequence.
  • antibody is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments (e.g., Fab fragments) so long as they exhibit the desired biological activity.
  • Antibodies (Abs) and “immunoglobulins” (Igs) are glycoproteins having the same structural characteristics. While antibodies exhibit binding specificity to a specific antigen, immunoglobulins include both antibodies and other antibodylike molecules which lack antigen specificity. Polypeptides of the latter kind are, for example, produced at low levels by the lymph system and at increased levels by myelomas.
  • “Native antibodies and immunoglobulins” are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains.
  • V H variable domain
  • Each light chain has a variable domain at one end (V L ) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain.
  • Particular amino acid residues are believed to form an interface between the light- and heavy-chain variable domains (Clothia et al., J. Mol. Biol. 186:651 (1985); Novotny and Haber, Proc. Natl. Acad. Sci. U.S.A. 82:4592 (1985)).
  • variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework (FR).
  • CDRs complementarity-determining regions
  • FR framework
  • the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a b-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the b-sheet structure.
  • the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991 )).
  • the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
  • Fv is the minimum antibody fragment which contains a complete antigen-recognition and -binding site.
  • this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association.
  • scFv single-chain Fv species
  • one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a "dimeric" structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer.
  • the Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1 ) of the heavy chain.
  • Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH 1 domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • Antibody fragment and all grammatical variants thereof, as used herein are defined as a portion of an intact antibody comprising the antigen binding site or variable region of the intact antibody, wherein the portion is free of the constant heavy chain domains (i.e. CH2, CH3, and CH4, depending on antibody isotype) of the Fc region of the intact antibody.
  • constant heavy chain domains i.e. CH2, CH3, and CH4, depending on antibody isotype
  • antibody fragments include Fab, Fab', Fab'-SH, F(ab') 2 , and Fv fragments;
  • any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues referred to herein as a "single-chain antibody fragment” or “single chain polypeptide"
  • single-chain antibody fragment or “single chain polypeptide”
  • single chain polypeptide including without limitation (1 ) single-chain Fv (scFv) molecules
  • single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety and (4) nanobodies comprising single Ig domains from non-human species or other specific single-domain binding modules; and multispecific or multivalent structures formed from antibody fragments.
  • the heavy chain(s) can contain any constant domain sequence (e.g. CH1 in the IgG isotype) found in a non-Fc region of an intact antibody, and/or can contain any hinge region sequence found in an intact antibody, and/or can contain a leucine zipper sequence fused to or situated in the hinge region sequence or the constant domain sequence of the heavy chain(s).
  • any constant domain sequence e.g. CH1 in the IgG isotype
  • epitopic determinants means any antigenic determinant on an antigen to which the paratope of an antibody binds. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
  • label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to a molecule. For example, an agent can be said to be “detectably labeled”, or can be said to include a detectable label.
  • the label may itself may be detectable (directly detectable label) (e.g., radioisotope labels, fluorescent labels such as fluorescent chemical adducts, etc.), or the label can be indirectly detectable, e.g., in the case of an enzymatic label, the enzyme may catalyze a chemical alteration of a substrate compound or composition and the product of the reaction is detectable.
  • detectable label e.g., radioisotope labels, fluorescent labels such as fluorescent chemical adducts, etc.
  • the enzyme may catalyze a chemical alteration of a substrate compound or composition and the product of the reaction is detectable.
  • an indirect label is biotin, which can be detected using streptavidin. Any convenient direct or indirect label can be used in the compositions and methods described herein.
  • nucleic acid as used herein means that a particular nucleic acid (DNA or RNA) is the product of various combinations of cloning, restriction, polymerase chain reaction (PCR) and/or ligation steps resulting in a construct having a structural coding or non-coding sequence distinguishable from endogenous nucleic acids found in natural systems.
  • DNA sequences encoding polypeptides can be assembled from cDNA fragments or from a series of synthetic oligonucleotides, to provide a synthetic nucleic acid which is capable of being expressed from a recombinant transcriptional unit contained in a cell or in a cell-free transcription and translation system.
  • Genomic DNA comprising the relevant sequences can also be used in the formation of a recombinant gene or transcriptional unit. Sequences of non- translated DNA may be present 5' or 3' from the open reading frame, where such sequences do not interfere with manipulation or expression of the coding regions, and may indeed act to modulate production of a desired product by various mechanisms. DNA sequences encoding RNA that is not translated may also be considered recombinant. Thus, e.g., the term
  • recombinant nucleic acid refers to one which is not naturally occurring, e.g., is made by the artificial combination of two otherwise separated segments of sequence through human intervention. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. Such is usually done to replace a codon with a codon encoding the same amino acid, a conservative amino acid, or a non-conservative amino acid. Alternatively, it is performed to join together nucleic acid segments of desired functions to generate a desired combination of functions. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. When a recombinant nucleic acid encodes a polypeptide, the sequence of the encoded polypeptide can be naturally occurring ("wild type") or can be a variant (e.g., a mutant) of the naturally occurring sequence.
  • a "vector” is a replicon, such as a plasmid, phage, virus, or cosmid, to which another DNA segment, (e.g., an "insert"), may be attached so as to bring about the replication and/or expression of the attached segment in a cell.
  • An "expression vector” is a vector having an expression cassette (e.g., having an insert that is an expression cassette).
  • An "expression cassette” includes a DNA sequence (coding or non-coding) operably linked to a promoter. "Operably linked” refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner.
  • a promoter is operably linked to a nucleotide sequence if the promoter affects transcription of the nucleotide sequence (e.g., expression of the nucleotide sequence).
  • the term "recombinant expression vector,” or "DNA construct” are used interchangeably herein to refer to an expression vector having an insert, where the expression vector is recombinant (i.e., includes sequences that are not naturally occuring). Recombinant expression vectors are usually generated for the purpose of expressing and/or propagating the insert(s), or for the construction of other recombinant nucleotide sequences.
  • compositions and methods for expressing a protein of interest (POI) on the surface of cell i.e., surface display
  • POI protein of interest
  • surface accessible fusion protein is used herein to describe a polypeptide having a signal polypeptide, a protein of interest (POI), a stalk polypeptide, and a surface anchor polypeptide.
  • signal polypeptide and “signal sequence” are used interchangeably herein to refer to the amino acid sequence that is present at or near the N-terminus of proteins of the secretory pathway (e.g., secreted proteins, GPI anchored proteins, etc.) that targets proteins for delivery into the lumen of the endoplasmic reticulum (ER)).
  • secretory pathway e.g., secreted proteins, GPI anchored proteins, etc.
  • ER endoplasmic reticulum
  • signal sequences are extremely variable, both in their length and in their amino acid composition. However, signal sequences tend to be approximately 15-30 amino acids long and usually include a block of 5-10 hydrophobic amino acids.
  • proteins of the secretory pathway translocate to the ER (e.g., enter the ER lumen) during translation (co-translational).
  • some small secretory proteins such as the yeast mating factor alpha (about 70 amino acids)
  • Signal sequences from different proteins can function interchangeably.
  • a signal sequence is cleaved during processing of the protein (e.g., is no longer present on the mature protein).
  • a subject signal polypeptide is cleaved during processing of the surface accessible fusion protein (e.g., is no longer present on the mature protein that is displayed on the surface of the cell).
  • a signal polypeptide is one that is not cleaved during processing of the protein (i.e., is present in the mature protein).
  • a subject signal polypeptide can be native to the host cell in which it is expressed, or can be heterologous to the host cell, as long as it is operable to effect transport of the surface accessible fusion protein into the secretory pathway.
  • a subject signal polypeptide can be a well characterized signal sequence, or can be any signal polypeptide derived from any protein of the secretory pathway.
  • a subject signal polypeptide is a synthetic signal polypeptide, i.e., the sequence is not present in (is modified relative to) a naturally existing protein.
  • a subject surface accessible fusion protein includes a signal polypeptide from a protein (or is derived from a protein) that enters the ER via a post- translational route (referred to herein as a post-translational signal polypeptide).
  • a subject surface accessible fusion protein includes a signal polypeptide from a protein (or is derived from a protein) that enters the ER via a pre-translational route (referred to herein as a pre-translational signal polypeptide).
  • signal sequences suitable for the subject compositions, kits, and methods are known to those of ordinary skill in the art, and any convenient signal polypeptide can be used.
  • any convenient signal polypeptide can be used that is functional in a host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, etc.). Selection of a signal sequence can take into account, for example, the desired level of protein to be displayed at the surface of the cell (e.g., the yeast cell).
  • the signal sequence from alpha mating factor can be useful when a high level of displayed protein is desired, but in some cases less protein is desired at the cell surface and in such cases, other signal polypeptides can be used (e.g., the signal peptides from Pho5p, Suc2p, etc.).
  • the signal polypeptide is a heterologous polypeptide relative to the cell type in which the surface accessible fusion protein will be expressed.
  • the signal polypeptide can be from (e.g., can be derived from) a cell type other than a yeast cell (e.g., a mammalian cell, a vertebrate cell, an invertebrate cell, etc.), or from a yeast cell of a different species from the species in which the surface accessible fusion protein will be expressed.
  • the signal polypeptide is from (e.g., derived from) the same cell type that the surface accessible fusion protein will be expressed (e.g., in some cases from the same species).
  • the signal polypeptide can be from a yeast protein (e.g., in some cases from the same species of yeast).
  • Example signal polypeptides include, but are not limited to those from (or derived from) the following yeast proteins: mating factor alpha, Aga2p, Pho5p, and Suc2p.
  • signal polypeptides include, but are not limited to, the following: Signal polypeptide from Mating factor alpha:
  • the signal polypeptide includes an amino acid sequence having 60% or more amino acid sequence identity ( 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, 99.8% or more, 99.9% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 1 1-17.
  • a surface accessible fusion protein includes a TM domain (e.g., a type II TM domain) that is positioned such that the surface accessible fusion protein is a type II membrane protein (i.e., the surface anchor polypeptide would be positioned near the N-terminus instead of the C-terminus of the surface accessible fusion protein).
  • a surface accessible fusion protein can include a signal polypeptide that is appropriate for type II membrane protein.
  • a POI protein of interest
  • a POI is an entire protein (e.g., an entire protein that is naturally existing, a modified version of an entire protein, etc.).
  • a POI is a fragment of a protein, and can be any fragment of interest. For example, if one desires to investigate the binding or function of a particular portion of a protein (e.g., a domain, an extracellular domain, a protein binding domain, an enzymatic domain, an epitope, a portion of a protein with no known function or suspected function, etc.), the particular portion of interest can be referred to as a POI.
  • the protein from which a POI is derived can be any protein (e.g., an antibody, a ligand, and receptor, a membrane protein, a secreted protein, an intracellular protein, an protein the localized to a particular organelle, a cytosolic protein, an enzyme, and the like).
  • a POI can be naturally existing sequence or a non-naturally existing sequence (e.g., a synthetic amino acid sequence, a mutated/modified version of a naturally existing sequence, etc.).
  • multiple POIs are used in a subject method.
  • at least two of the two or more different POIs are similar to each other.
  • the subject methods are screening methods that can be used to identify variants that bind with greater or weaker affinity to a particular compound.
  • multiple POIs can be used that are variants of one another (e.g., produced by mutagenesis).
  • At least two of the two or more POIs differ in amino acid sequence by 1 to 20 amino acids (e.g., 1 to 19 amino acids, 1 to 18 amino acids, 1 to 17 amino acids, 1 to 16 amino acids, 1 to 15 amino acids, 1 to 14 amino acids, 1 to 13 amino acids, 1 to 12 amino acids, 1 to 1 1 amino acids, 1 to 10 amino acids, 1 to 9 amino acids, 1 to 8 amino acids, 1 to 7 amino acids, 1 to 6 amino acids, 1 to 5 amino acids, 1 to 4 amino acids, 1 to 3 amino acids, 1 to 2 amino acids, or 1 amino acid).
  • 1 to 20 amino acids e.g., 1 to 19 amino acids, 1 to 18 amino acids, 1 to 17 amino acids, 1 to 16 amino acids, 1 to 15 amino acids, 1 to 14 amino acids, 1 to 13 amino acids, 1 to 12 amino acids, 1 to 1 1 amino acids, 1 to 10 amino acids, 1 to 9 amino acids, 1 to 8 amino acids, 1 to 7 amino acids, 1 to 6 amino acids, 1 to 5 amino acids, 1 to 4 amino acids, 1 to
  • a "stalk polypeptide”, also referred to herein as a “synthetic stalk polypeptide” is a synthetic sequence (a non-naturally occurring sequence) designed to provide clearance for the POI from the cell surface, and to be inert such that the POI and the stalk polypeptide do not interact.
  • the stalk polypeptide is meant to provide an attachment for a POI to the cell surface while allowing the POI to fold (and in some cases function) free of influence from the surface.
  • a synthetic stalk polypeptide e.g., in some cases in addition to a synthetic surface anchor polypeptide such as a synthetic GPI polypeptide
  • a synthetic surface anchor polypeptide such as a synthetic GPI polypeptide
  • the use of a synthetic stalk polypeptide can ensure that undesired recombination does not occur within the yeast genome between yeast genomic sequences and nucleotides sequences encoding the synthetic stalk (and/or the synthetic surface anchor polypeptide).
  • Design features that can be used in designing a stalk polypeptide include low complexity in amino acid sequence, overall acidic character of the polypeptide, high hydrophilicity of the polypeptide, an absence of defined secondary or tertiary structure features within the polypeptide, a high density of O-linked glycosylation sites, and low self- similarity in the nucleotide sequence encoding the stalk polypeptide.
  • a stalk polypeptide is characterized by low amino acid sequence complexity, overall acidic character, high hydrophilicity, an absence of defined secondary or tertiary structural features, a high density of O-linked glycosylation sites, and the nucleotide sequence encoding the stalk polypeptide is characterized by low self- similarity.
  • a stalk polypeptide comprises an amino acid sequence that is heavily O-glycosylated upon expression in a eukaryotic cell (e.g., a yeast cell).
  • a subject stalk polypeptide (and nucleotide sequences encoding the stalk polypeptide) can take into account (i.e., include) any or all of the above features (e.g., in any combination).
  • a stalk polypeptide comprises an amino acid
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 5 amino acids.
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 10 amino acids.
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 20 amino acids.
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 50 amino acids.
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 100 amino acids.
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more regions (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, or 7 or more regions) having 2 to 5 O-linked glycosylation sites (e.g., 2 to 4, 2 to 3, 3 to 5, 3 to 4, 4 to 5, 2, 3, 4, or 5 O-linked glycosylation sites) over a span of 200 amino acids.
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having one or more O-linked glycosylation sites (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, or 10 or more O- linked glycosylation sites).
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 to 10 O-linked glycosylation sites (e.g., 1 to 9, 1 to 8, 1 to 7, 2 to 10, 2 to 9, 2 to 8, or 2 to 7 O-linked glycosylation sites).
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 20 amino acids.
  • O-linked glycosylation sites e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 40 amino acids.
  • O-linked glycosylation sites e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 50 amino acids.
  • O-linked glycosylation sites e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 0.5 or more O-linked glycosylation sites (e.g., 0.6 or more, 0.7 or more, 0.8 or more, 0.9 or more, 1 or more, 1.1 or more, 1.2 or more, 1.3 or more, 1.5 or more, or 2 or more O-linked glycosylation sites) per 100 amino acids.
  • O-linked glycosylation sites e.g., 0.6 or more, 0.7 or more, 0.8 or more, 0.9 or more, 1 or more, 1.1 or more, 1.2 or more, 1.3 or more, 1.5 or more, or 2 or more O-linked glycosylation sites
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O- linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.7 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 100 amino acids.
  • O- linked glycosylation sites e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.7 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 0.5 or more O-linked glycosylation sites (e.g., 0.6 or more, 0.7 or more, 0.8 or more, 0.9 or more, 1 or more, 1.1 or more, 1.2 or more, 1.3 or more, 1.5 or more, or 2 or more O-linked glycosylation sites) per 200 amino acids.
  • O-linked glycosylation sites e.g., 0.6 or more, 0.7 or more, 0.8 or more, 0.9 or more, 1 or more, 1.1 or more, 1.2 or more, 1.3 or more, 1.5 or more, or 2 or more O-linked glycosylation sites
  • a stalk polypeptide (e.g., a synthetic stalk polypeptide) comprises an amino acid sequence having 1 or more O-linked glycosylation sites (e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.7 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites) per 200 amino acids.
  • O-linked glycosylation sites e.g., 1.2 or more, 1.4 or more, 1.6 or more, 1.7 or more, 1.8 or more, 2 or more, 2.2 or more, 2.4 or more, 2.6 or more, 2.8 or more, or 3 or more O-linked glycosylation sites
  • a stalk polypeptide can be of any desired length.
  • a stalk polypeptide comprises a polypeptide sequence having a length in a range of from 10 to 2000 amino acids (e.g., from 20 to 2000 amino acids, from 50 to 2000 amino acids, from 20 to 1500 amino acids, from 50 to 1500 amino acids, from 20 to 1000 amino acids, from 50 to 1000 amino acids, from 20 to 800 amino acids, from 50 to 800 amino acids, from 100 to 2000 amino acids, from 100 to 1500 amino acids, from 100 to 1000 amino acids, from 100 to 800 amino acids, from 10 to 100 amino acids, from 20 to 100 amino acids, from 40 amino acids to 100 amino acids, from 101 to 200 amino acids, from 201 to 300 amino acids, from 301 to 400 amino acids, from 401 to 500 amino acids, from 501 to 600 amino acids, from 601 to 700 amino acids, from 701 to 800 amino acids, from 801 to 900 amino acids, from 901 to 1000 amino acids, from 1001 to 1500 amino acids, or from 1501 to 2000 amino acids).
  • 10 to 2000 amino acids e.
  • a stalk polypeptide comprises a polypeptide sequence having a length of 10 or more amino acids (e.g., 20 or more, 30 or more, 40 or more, 50 or more, 60 or more, 70 or more, 80 or more, 90 or more, 100 or more, 125 or more, 150 or more, 200 or more, 250 or more, 300 or more, 350 or more, 400 or more, 450 or more, or 500 or more amino acids).
  • amino acids e.g., 20 or more, 30 or more, 40 or more, 50 or more, 60 or more, 70 or more, 80 or more, 90 or more, 100 or more, 125 or more, 150 or more, 200 or more, 250 or more, 300 or more, 350 or more, 400 or more, 450 or more, or 500 or more amino acids.
  • the length of the stalk polypeptide can be used to make the surface accessible fusion protein accessible to agents of a defined molecular weight. For example, if the stalk polypeptide is short (e.g, 100 amino acids or less), then a larger agent may not have access to the POI of the surface accessible fusion protein due to steric hindrance. Thus, the length of the stalk polypeptide can be "tuned" to match a desired agent.
  • a stalk polypeptide of a certain length can be chosen to provide steric hindrance to compounds above that threshold molecular weight.
  • steric accessibility to a given POI can be "tuned" to a desired molecular weight cutoff by selecting a stalk polypeptide of an appropriate length. The greater the length of the stalk polypeptide, the less steric hindrance, and the greater accessibility (i.e., as the length of the stalk polypeptide increases, so too does the size of agent that can be used to bind to the POI of the surface accessible fusion protein).
  • Fig. 1A-1 C and Fig. 2A-2B see the working examples below.
  • Suitable stalk polypeptides include, but are not limited to, the examples provided here:
  • a subject synthetic stalk polypeptide includes an amino acid sequence having 60% or more amino acid sequence identity ( 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, 99.8% or more, 99.9% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 31-35 (e.g., 32-35, 33-35, 34-35).
  • a subject synthetic stalk polypeptide includes an amino acid sequence having 60% or more amino acid sequence identity ( 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, 99.8% or more, 99.9% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 32-35.
  • a subject synthetic stalk polypeptide includes an amino acid sequence having 60% or more amino acid sequence identity ( 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more, 99.5% or more, 99.8% or more, 99.9% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 33-35.
  • a subject surface anchor polypeptide of a surface accessible fusion protein anchors the fusion protein to the cell surface.
  • the surface anchor polypeptide is (or is derived from) a Glycosylphosphatidylinisotol (GPI) anchor domain.
  • GPI Glycosylphosphatidylinisotol
  • GPI is a post-translationally added lipid anchor; therefore, unlike conventional polypeptide anchors which have different transmembrane domains and connect to specific cytoplasmic extensions, GPI anchors use a common lipid structure to attach to the membrane, which is irrespective of the proteins linked with it (Englund et al., Annul Rev. Biochem. 62:121 (1993)).
  • GPI-anchored proteins are synthesized as precursors with a cleavable, hydrophobic signal sequence at or near the N-terminus that targets the protein to the lumen of the endoplasmic reticulum (ER), and a cleavable signal sequence (GPI anchor domain) at or near the C-terminus that directs GPI anchoring.
  • ER endoplasmic reticulum
  • GPI anchor domain cleavable signal sequence
  • GPI anchored proteins have been identified throughout a broad range of eukaryotic species ranging from humans to insects, yeasts, bacteria, and fungi. GPI anchor domains have been identified for many proteins (for example, see Cares et al., Science 243:1 196 (1989)). The GPI anchor signals have been successfully engineered onto the C-terminus of other proteins, and these GPI anchored proteins are coated on the cell surface and are functional. (Anderson et al., P.N.A.S. 93:5894 (1996); Brunschwig et al., J. Immunother.
  • GPI anchor domains include, but are not limited to, those
  • Any convenient GPI anchor domain can be used as a surface anchor polypeptide.
  • GPI surface anchor polypeptides useful for the subject methods and compositions include, but are not limited to:
  • GKNGAKSQGSSKKMENSAPKNIFIDAFKMSVYAVFTVLFSIIF (SEQ ID NO: 61 )
  • TGSSSASSSSKSKGVGNIVNVSFSQSGYLALFAGLISALL (SEQ ID NO: 62)
  • Proteins from which a GPI surface anchor polypeptides can be from include, but are not limited to: mating type protein agglutinin-a-1 (Aga1 ), flocculin proteins (e.g., Flo1 ), Sed1 , Cwp1 , Cwp2, Tip1 , Tir1/Srp1 , CCW14, CIS3, CWP1 , PIR1 , and PIR3.
  • a subject surface anchor polypeptide comprises an amino sequence having 60% or more amino acid sequence identity (60% or more, 70% or more, 80% or more, 90% or more, 92% or more, 95% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in any of SEQ ID NOs: 51-64. In some cases, a subject surface anchor polypeptide comprises an amino sequence having 60% or more amino acid sequence identity (60% or more, 70% or more, 80% or more, 90% or more, 92% or more, 95% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in SEQ ID NO: 51.
  • the surface anchor polypeptide is heterologous (e.g., a GPI anchor domain from a different species or from a different organism relative to the host cell in which the surface accessible fusion protein will be expressed).
  • heterologous surface anchor polypeptide e.g., in some cases in addition to a synthetic stalk polypeptide
  • the surface anchor polypeptide is a synthetic polypeptide (i.e., the surface anchor polypeptide comprises an amino acid sequence that is not naturally occurring).
  • a synthetic surface anchor polypeptide e.g., a synthetic GPI anchor domain
  • the use of a synthetic surface anchor polypeptide can decrease the likelihood that undesired recombination will occur within the yeast genome between yeast genomic sequences and nucleotide sequences encoding the synthetic surface anchor polypeptide (and/or the synthetic stalk polypeptide).
  • Suitable synthetic (e.g., a hybrid) GPI surface anchor polypeptide is:
  • a subject surface anchor polypeptide (e.g., a GPI anchor domain) comprises an amino sequence having 60% or more amino acid sequence identity (60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 92% or more, 95% or more, or 100% amino acid sequence identity) with an amino acid sequence (GPI anchor domain amino acid sequence) set forth in any of SEQ ID NOs: 51-64 and 71.
  • a subject synthetic surface anchor polypeptide comprises an amino sequence having 60% or more amino acid sequence identity (60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 92% or more, 95% or more, or 100% amino acid sequence identity) with the amino acid sequence set forth in SEQ ID NO: 71. In some cases, a subject synthetic surface anchor polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 71.
  • a surface accessible fusion protein includes a GPI anchor
  • the components of the surface accessible fusion protein include, from N- terminal to C-terminal, a signal polypeptide, a POI, a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a surface anchor polypeptide (e.g,.
  • a display moiety (as discussed below) and/or a surface accessible fusion protein includes a GPI anchor domain as a surface anchor polypeptide.
  • the surface accessible fusion protein can also include one or more tags, as discussed in more detail below.
  • the surface anchor polypeptide comprises a transmembrane (TM) domain (e.g., a transmembrane helix) that inserts into the plasma membrane of a cell.
  • TM transmembrane
  • a surface accessible fusion protein is a type I membrane protein (e.g., has a type I TM domain as a surface anchor polypeptide).
  • a TM domain can be positioned C-terminal to both the signal polypeptide and the stalk polypeptide.
  • the POI would be positioned N-terminal to the stalk polypeptide and C-terminal to the signal polypeptide (e.g., between the signal polypeptide and the stalk polypeptide).
  • the TM domain would be positioned near the C-terminus of the surface accessible fusion protein, and the POI and stalk polypeptide would both be positioned N- terminal to the TM domain.
  • the components of the surface accessible fusion protein include, from N-terminal to C-terminal, a signal polypeptide, a POI, a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a surface anchor polypeptide (e.g,. a TM domain, a type I TM domain).
  • a display moiety (as discussed below) and/or a surface accessible fusion protein includes a type I TM domain as a surface anchor polypeptide.
  • the surface accessible fusion protein can also include one or more tags, as discussed in more detail below.
  • a surface accessible fusion protein is a type II membrane protein (e.g., has a type II TM domain as a surface anchor polypeptide).
  • a TM domain can be positioned C-terminal to the signal polypeptide, and N-terminal to the stalk polypeptide.
  • the POI would be positioned C-terminal to the stalk polypeptide.
  • the TM domain would be positioned near the N-terminus of the surface accessible fusion protein, and the stalk polypeptide and the POI would both be positioned C-terminal to the TM domain.
  • the components of the surface accessible fusion protein include, from N-terminal to C-terminal, a signal polypeptide, a surface anchor polypeptide (e.g,. a TM domain, a type II TM domain), a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a POI.
  • a display moiety (as discussed below) and/or a surface accessible fusion protein includes a type II TM domain as a surface anchor polypeptide.
  • the surface accessible fusion protein can also include one or more tags, as discussed in more detail below.
  • a subject surface accessible fusion protein includes a tag.
  • tag as used herein is a polypeptide comprising an amino acid sequence that is detectable (directly and/or indirectly) and provides for ease of tracking and/or purification.
  • suitable tags will be known to one of ordinary skill in the art and any convenient tag can be used.
  • suitable tags include, but are not limited to directly detectable tags (e.g., a fluorescent polypeptide, e.g., green fluorescent protein (GFP), YFP, RFP, CFP, mCherry, tdTomato, and the like); and affinity tags (e.g. a histidine tag, e.g., a 6XHis tag; a
  • a surface accessible fusion protein includes more than one tag.
  • a subject surface accessible fusion protein includes a one or more tags (2 or more, 3 or more, or 4 or more tags, or 1 , 2, 3, or 4 tags).
  • a tag can be positioned anywhere within a surface accessible fusion protein.
  • a tag can be positioned: (i) C-terminal to the signal polypeptide and N-terminal to the POI; and/or (ii) C-terminal to the POI and N-terminal to the synthetic stalk polypeptide.
  • the tags can be positioned on either end of the POI (e.g., one or more positioned C-terminal to the signal polypeptide and N-terminal to the POI, and one or more positioned C-terminal to the POI and N-terminal to the synthetic stalk polypeptide).
  • the tags are positioned in succession (i.e., next to one another).
  • a subject surface accessible fusion protein is a single protein that includes multiple components (e.g., a protein composed of polypeptide components that are modular and are linked together by peptide linkages, such that they constitute a single protein).
  • the various components e.g., signal polypeptide, POI, tag, stalk polypeptide, surface anchor polypeptide
  • linker amino acids e.g., any number of linker amino acids. For example, in some cases, there are no amino acids separating two given components of a subject surface accessible fusion protein.
  • amino acids there are one or more amino acids (e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 15 or more, 20 or more, 25 or more, 30 or more, or 40 or more amino acids) separating two given components of a subject surface accessible fusion protein.
  • amino acids e.g., 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 15 or more, 20 or more, 25 or more, 30 or more, or 40 or more amino acids
  • amino acids e.g., 15 or less, 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less amino acids
  • a subject surface accessible fusion protein consists of a signal
  • a subject surface accessible fusion consists of a signal polypeptide, a POI, a stalk polypeptide, a surface anchor polypeptide, and one or more tags.
  • a subject surface accessible fusion protein consists essentially of a signal polypeptide, a POI, a stalk polypeptide, and a surface anchor polypeptide.
  • a subject surface accessible fusion consists essentially of a signal polypeptide, a POI, a stalk polypeptide, a surface anchor polypeptide, and one or more tags.
  • CV1 is the POI to be displayed. It is a previously described engineered protein that binds CD47 with high affinity.
  • CV1 is displayed on yeast cells as a surface accessible fusion protein, tethered to a 649 amino acid stalk and one of two different GPI anchors:
  • Mating-factor alpha leader amino acids 1-87 (SEQ ID NO: 1 1 )
  • Protein of interest (amino acids 90-208) (SEQ ID NO: 7)
  • HA epitope tag amino acids 21 1-219 (SEQ ID NO: 8)
  • Hybrid GPI anchor domain (amino acids 871-907) (SEQ ID NO: 71 )
  • EISTYAGSANSVNAGAGAGALFLLLSLAII (SEQ ID NO: 9)
  • Mating-factor alpha leader amino acids 1-87 (SEQ ID NO: 1 1 )
  • Protein of interest (amino acids 90-208) (SEQ ID NO: 7)
  • HA epitope tag amino acids 21 1-219 (SEQ ID NO: 8)
  • Aggl p GPI anchor domain (amino acids 871-910) (SEQ ID NO: 51 )
  • nucleic acids for expressing a surface accessible fusion protein include nucleic acids for expressing a surface accessible fusion protein, nucleic acids encoding a surface accessible fusion protein, and methods of using the nucleic acids (e.g., to express a surface accessible fusion protein on the surface of a cell, for screening for compounds that bind to a surface accessible fusion protein, for screening for polypeptides that bind to a compound of interest, and the like).
  • a subject nucleic acid is a recombinant expression vector (e.g., for expressing a subject surface accessible fusion protein).
  • a subject nucleic acid for expressing a surface accessible fusion [0080] In some cases, a subject nucleic acid for expressing a surface accessible fusion
  • the protein does not include a nucleotide sequence encoding a protein of interest (POI).
  • the nucleic acid can be a pre-cursor for inclusion of a POI (e.g., between the nucleotide sequences encoding the signal polypeptide and the stalk polypeptide).
  • the nucleic acid can include a nucleotide sequence that encodes a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide (and in some cases a tag), all of which are operably linked to the same promoter where the promoter is functional in a eukaryotic host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.), but the nucleic acid might not include nucleotides encoding a POI. In some cases, such a nucleic acid is a recombinant expression vector.
  • a eukaryotic host cell of interest e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.
  • a nucleic acid is a recombinant expression vector.
  • the nucleic acid (e.g, a recombinant expression vector) includes an insert site for the insertion of a POI.
  • an insertion site for inserting nucleotides encoding a POI can exist between nucleotides encoding a signal polypeptide and a stalk polypeptide (signahstalk junction), a signal polypeptide and a tag (signahtag junction)a tag and a stalk polypeptide (tag:stalk junction), and/or a first tag and a second tag (tag:tag junction).
  • an insertion site for inserting nucleotides encoding a POI is positioned adjacent to nucleotide encoding a stalk polypeptide.
  • Insertion sites for use with various technologies are known to those of ordinary skill in the art and any convenient insertion site can be used.
  • an insertion site can be for any method for manipulating nucleic acid sequences.
  • the insertion site can be a multiple cloning site (e.g., a site including one or more restriction enzyme sites), a site for ligation independent cloning, a site for recombination based cloning (e.g., recombination based on att sites), a nucleotide sequence recognized by a CRISPR (e.g. Cas9) based technologies, and the like.
  • CRISPR e.g. Cas9
  • an insertion site can be defined by the junction of the nucleotides encoding one component of a subject surface accessible fusion protein with the nucleotides encoding another component of the subject surface accessible fusion protein (e.g., signahstalk junction, tag:stalk junction, and/or tag:tag junction) such that there exist no intervening nucleotides.
  • An insertion site can be of any desired length and does not have to be in frame with the 3' components (e.g., nucleotides encoding the stalk polypeptide and the surface anchor polypeptide) because the intent of an insertion site is that it will get modified (e.g., in some cases replaced) to include a nucleotide sequence encoding a protein of interest.
  • nucleotides encoding a POI are inserted at an insertion site, they need to be in frame with both the upstream sequences (e.g., sequences encoding the signal polypeptide) and the downstream sequences (e.g., sequences encoding the stalk polypeptide and the surface anchor polypeptide).
  • a subject nucleic acid for expressing a polypeptide of interest on the surface of a cell
  • a display moiety can include a signal polypeptide, a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a surface anchor polypeptide (not necessarily in that order).
  • a display moiety in order from N-terminal to C- terminal, includes a signal polypeptide, a stalk polypeptide (e.g., a synthetic stalk polypeptide), and a surface anchor polypeptide (e.g., a GPI anchor domain, a type I TM domain, etc.).
  • a display moiety in order from N-terminal to C-terminal, includes a signal polypeptide, a surface anchor polypeptide (e.g., a type II TM domain, a TM domain from a type II membrane protein, etc.), and a stalk polypeptide (e.g., a synthetic stalk polypeptide).
  • nucleotides encoding the components of the display moiety need not be in frame with one another prior to the insertion of the nucleotide sequence encoding the PO.
  • the nucleic acid can still be referred to as a nucleic acid that includes nucleotide sequences encoding a display moiety.
  • a subject display moiety includes a signal polypeptide, a stalk
  • a subject display moiety includes a signal polypeptide, a stalk polypeptide, a surface anchor polypeptide, and one or more tags.
  • a subject display moiety consists of a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide.
  • a subject display moiety consists of a signal polypeptide, a stalk polypeptide, a surface anchor polypeptide, and one or more tags.
  • a subject display moiety consists essentially of a signal polypeptide, a stalk polypeptide, and a surface anchor polypeptide.
  • a subject display moiety consists essentially of a signal polypeptide, a stalk polypeptide, a surface anchor polypeptide, and one or more tags.
  • a subject nucleic acid for expressing a polypeptide of interest on the surface of a cell
  • includes a nucleotide sequence that encodes (i) a first nucleotide sequence that encodes a signal polypeptide; (ii) a second nucleotide sequence that encodes a synthetic stalk polypeptide; and (iii) a third nucleotide sequence that encodes a surface anchor polypeptide.
  • the nucleic acid includes an insertion site (described above) for inserting a nucleotide sequence that encodes a protein of interest (POI), where the insertion site is positioned 3' of (i) and 5' of (ii).
  • POI protein of interest
  • the nucleic acid also includes a nucleotide sequence that encodes a tag (e.g., positioned such that it is in frame with at least one of the nucleotide sequences that encode the other components [(i), (ii), and (iii)].
  • a tag e.g., positioned such that it is in frame with at least one of the nucleotide sequences that encode the other components [(i), (ii), and (iii)].
  • (i), (ii), and (iii) above are positioned relative to one another in a 5' to 3' orientation, in the order: (i), (iii), and (ii) (e.g., when the surface anchor polypeptide is a TM domain and the surface accessible fusion protein will be a type II membrane protein) and are operably linked to the same promoter, where the promoter is functional in a host cell (e.g., a eukaryotic cell, a vertebrate cell, an invertebrate cell, a mammalian cell, a fungal cell, a yeast cell, etc.).
  • a host cell e.g., a eukaryotic cell, a vertebrate cell, an invertebrate cell, a mammalian cell, a fungal cell, a yeast cell, etc.
  • the nucleic acid includes an insertion site (described above) for inserting a nucleotide sequence that encodes a protein of interest (POI), where the insertion site is positioned 3' of (ii).
  • the nucleic acid also includes a nucleotide sequence that encodes a tag (e.g., positioned such that it is in frame with at least one of the nucleotide sequences that encode the other components [(i), (ii), and (iii)].
  • Nucleic acids encoding a surface accessible fusion protein include a nucleotide
  • a surface accessible fusion protein a fusion protein having a signal polypeptide, a protein of interest (POI), a stalk polypeptide, and a surface anchor
  • the nucleotide sequence that encodes a surface accessible fusion protein is operably linked to a promoter that is functional in a eukaryotic host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.).
  • a eukaryotic host cell of interest e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.
  • a subject nucleic acid (e.g., encoding a surface accessible fusion protein) includes (i) a first nucleotide sequence that encodes a signal polypeptide; (ii) a second nucleotide sequence that encodes a protein of interest (POI); (iii) a third nucleotide sequence that encodes a synthetic stalk polypeptide; and (iv) a fourth nucleotide sequence that encodes a surface anchor polypeptide.
  • POI protein of interest
  • a third nucleotide sequence that encodes a synthetic stalk polypeptide
  • a fourth nucleotide sequence that encodes a surface anchor polypeptide.
  • (i), (ii), (iii), and (iv) are positioned, from 5' to 3', in order [(i), (ii), (iii), and (iv)], and are in frame with one another such that they collectively encode a surface accessible fusion protein that includes the signal polypeptide, the POI, the stalk polypeptide, and the surface anchor polypeptide (e.g., in some cases in that order).
  • the encoded surface accessible fusion protein also includes a tag such that the nucleic acid includes a nucleotide sequence that encodes that tag.
  • nucleotide sequence encoding the surface accessible fusion protein is operably linked to a promoter that is functional in a eukaryotic host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.).
  • a eukaryotic host cell of interest e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.
  • a subject nucleic acid (e.g., encoding a surface accessible fusion protein) includes (i) a first nucleotide sequence that encodes a signal polypeptide; (ii) a second nucleotide sequence that encodes a surface anchor polypeptide (e.g., a TM domain when the surface accessible fusion protein is a type II membrane protein); (iii) a third nucleotide sequence that encodes a synthetic stalk polypeptide; and (iv) a fourth nucleotide sequence that encodes a protein of interest (POI).
  • a first nucleotide sequence that encodes a signal polypeptide e.g., a second nucleotide sequence that encodes a surface anchor polypeptide (e.g., a TM domain when the surface accessible fusion protein is a type II membrane protein); (iii) a third nucleotide sequence that encodes a synthetic stalk polypeptide; and (iv) a fourth nucleo
  • (i), (ii), (iii), and (iv) are positioned, from 5' to 3', in order [(i), (ii), (iii), and (iv)], and are in frame with one another such that they collectively encode a surface accessible fusion protein that includes the signal polypeptide, the surface anchor polypeptide, the stalk polypeptide, and the POI (e.g., in some cases in that order).
  • the encoded surface accessible fusion protein also includes a tag such that the nucleic acid includes a nucleotide sequence that encodes that tag.
  • nucleotide sequence encoding the surface accessible fusion protein is operably linked to a promoter that is functional in a eukaryotic host cell of interest (e.g., a eukaryotic cell, a mammalian cell, a fungal cell, a yeast cell, a S. cerevisiae cell, etc.).
  • a "promoter sequence” or “promoter” is a DNA regulatory region capable of binding RNA polymerase and initiating transcription of a downstream (3' direction) coding or non-coding sequence.
  • the promoter sequence is bounded at its 3' terminus by the transcription initiation site and extends upstream (5' direction) to include at least the minimum number of bases or elements necessary to initiate transcription at levels detectable above background.
  • protein binding domains responsible for the binding of RNA polymerase Eukaryotic promoters will often, but not always, contain "TATA" boxes and "CAT” boxes.
  • Various promoters, including inducible promoters may be used to drive the various vectors of the present invention.
  • a promoter can be a constitutively active promoter (i.e., a promoter that is constitutively in an activefON" state).
  • a promoter can be an inducible promoter (i.e., a promoter whose state, active/ON" or inactive/OFF", is controlled by an external stimulus, e.g., the presence of a particular temperature, compound, or protein).
  • any convenient promoter can be used and many promoters are readily available to one of ordinary skill in the art. It will be appreciated that a promoter must be functional in the cell in which the surface accessible fusion protein is to be expressed (e.g., eukaryotic cell, fungal cell, yeast cell, vertebrate cell, mammalian cell, invertebrate cell, etc.). Examples of promoters useful in yeast expression vectors, include but are not limited to: AOX1 promoter, galactose inducible promoters (e.g., pGAL1 , pGAL1-10, pGal4, pGaM O, etc.),
  • pPGK phosphoglycerate kinase
  • pCYC1 cytochrome c
  • pADH1 alcohol dehydrogenase I
  • Additional exemplary promoters include, but are not limited to the SV40 early
  • LTR long terminal repeat
  • Ad MLP adenovirus major late promoter
  • HSV herpes simplex virus
  • CMVIE cytomegalovirus
  • RSV rous sarcoma virus
  • U6 small nuclear promoter U6 small nuclear promoter
  • inducible promoters include, but are not limited toT7 RNA polymerase promoter, T3 RNA polymerase promoter, Isopropyl-beta-D-thiogalactopyranoside (IPTG)- regulated promoter, lactose induced promoter, heat shock promoter, Tetracycline-regulated promoter, Steroid-regulated promoter, Metal-regulated promoter, estrogen receptor-regulated promoter, etc.
  • Inducible promoters can therefore be regulated by molecules including, but not limited to, doxycycline; RNA polymerase, e.g., T7 RNA polymerase; an estrogen receptor; an estrogen receptor fusion; etc.
  • any of the above described nucleic acids can be a recombinant expression vector (which can include any convenient promoter for expressing a subject surface accessible fusion protein, including, but not limited to, any of the promoters described above).
  • a subject recombinant expression vector is operable in a host cell to direct the expression and display of a surface accessible fusion protein.
  • a subject recombinant expression vector is operable in a yeast cell to direct the expression and display of a surface accessible fusion protein.
  • yeast vectors are shuttle vectors, which contain sequences permitting them to be selected and propagated in bacteria (e.g, E. coli), thus allowing for convenient amplification and subsequent alteration in vitro.
  • E. coli e.g., E. coli
  • Many common yeast shuttle vectors originated from pBR322. They contain an origin of replication promoting high copy-number maintenance in E. coli (e.g., ColE1 origin of replication), and a selectable antibiotic marker (e.g., the .beta.- lactamase gene, tetracycline resistance gene conferring resistance to, respectively, ampicillin and tetracycline).
  • yeast shuttle vectors include, but are not limited to those described in U.S. Pat. Nos. 5,866,404 and 6,897,353. Additional yeast vectors useful for practicing the methods described herein, for example, but not limited to, the expression of a subject surface accessible fusion protein in a species such as Pichia pastoris (i.e. , a Pichia pastoris host cell), are described in U.S. Pat. Nos. 5,707,828, 6,730,499, U.S. Patent Publication No.
  • Yeast vectors can contain marker genes that allow selection of transformants
  • yeast marker genes include, but are not limited to, URA3, HIS3, LEU2, TRP1 and LYS2, which complement specific auxotrophic mutations in the host cell.
  • the URA3 and LYS2 yeast marker genes have an additional advantage because they allow the use of both positive and negative selection schemes.
  • Selectable marker genes conferring dominant drug resistant phenotype to the yeast host cell such as the hph and nat genes conferring resistance to hygromycin B and nourseothricin, respectively (see, Sato et al., Yeast 22:583-591 (2005)) may also be used.
  • Most currently used yeast shuttle vectors fall into one of the following three broad categories: (i) integrative vectors, (ii) autonomously replicating high copy-number vectors, or (iii) autonomously replicating low copy-number vectors.
  • Suitable expression vectors are known to those of skill in the art, and many are commercially available.
  • the following vectors are provided by way of example; for eukaryotic host cells: pXT1 , pSG5 (Stratagene), pSVK3, pBPV, pMSG, and pSVLSV40 (Pharmacia).
  • any other vector may be used so long as it is compatible with the host cell.
  • the recombinant expression vector is a viral construct, e.g., a recombinant adeno-associated virus construct (see, e.g., U.S. Patent No. 7,078,387), a recombinant adenoviral construct, a recombinant lentiviral construct, a recombinant retroviral construct, etc.
  • Suitable expression vectors include, but are not limited to, viral vectors (e.g.
  • viral vectors based on vaccinia virus; poliovirus; adenovirus see, e.g., Li et al., Invest Opthalmol Vis Sci 35:2543 2549, 1994; Borras et al., Gene Ther 6:515 524, 1999; Li and Davidson, PNAS 92:7700 7704, 1995; Sakamoto et al., H Gene Ther 5: 1088 1097, 1999; WO 94/12649, WO 93/03769; WO 93/19191 ; WO 94/28938; WO 95/1 1984 and WO 95/00655); adeno-associated virus (see, e.g., AN et al., Hum Gene Ther 9:81 86, 1998, Flannery et al., PNAS 94:6916 6921 , 1997; Bennett et al., Invest Opthalmol Vis Sci 38:2857 2863, 1997; Jomary et al., Gene
  • SV40 herpes simplex virus
  • human immunodeficiency virus see, e.g., Miyoshi et al., PNAS 94: 10319 23, 1997; Takahashi et al., J Virol 73:7812 7816, 1999
  • a retroviral vector e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, and mammary tumor virus
  • retroviral vector e.g., Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, mye
  • any of a number of suitable transcription and translation control elements including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. may be used in an expression vector (see e.g., Bitter et al. (1987) Methods in Enzymology, 153:516-544).
  • nucleotides encoding the components of a subject surface are provided.
  • a subject recombinant expression vector includes a terminator sequence.
  • transcription termination elements include, but are not limited to, the termination sequences of several yeast genes, such as CYC1 , ADH 1 , AR04, TRP1 , ACT1 , AND YPT1 . Any convenient termination sequence can be used.
  • One illustrative example of a subject DNA nucleic acid having a nucleotide sequence that encodes a subject surface accessible fusion protein is the 8584 nucleotide (nt) vector set forth in SEQ ID NO: 6.
  • the signal polypeptide is mating factor alpha leader, which is encoded by nucleotides 856-1 1 13 (SEQ ID NO: 1 ); the protein of interest (POI) is CV1 , which is encoded by nucleotides 1 123-1479 (SEQ ID NO: 2); the synthetic stalk polypeptide (649 amino acids) is encoded by nucleotides 1513-3459 (SEQ ID NO: 4); and the surface anchor polypeptide is a synthetic hybrid GPI sequence, which is encoded by nucleotides 3466-3576 (SEQ ID NO: 5).
  • This example nucleic acid also has nucleotides that encode an HA epitope tag (nucleotides 1486-1512) (SEQ ID NO: 3).
  • aspects of the disclosure include cells (i.e., host cells) that include the above
  • host cell is used herein to refer to a cell in which a subject surface accessible fusion protein is to be expressed and displayed; or to refer to a cell in which a nucleic acid is to be propagated.
  • a host cell can be used to express a subject surface accessible fusion protein from a subject nucleic acid such as a recombinant expression vector (e.g., a eukaryotic host cell) and/or to propagate a subject recombinant expression vector (e.g., a eukaryotic host cell or a prokaryotic host cell).
  • a subject nucleic acid such as a recombinant expression vector (e.g., a eukaryotic host cell) and/or to propagate a subject recombinant expression vector (e.g., a eukaryotic host cell or a prokaryotic host cell).
  • a subject host cell is a prokaryotic cell.
  • a subject recombinant expression vector (having nucleotides that encode a surface accessible fusion protein) is inside of a prokaryotic cell for the purposes of propagation and/or purification of the recombinant expression vector.
  • a prokaryotic cell e.g., a bacterial cell such as an E. coli cell
  • includes a nucleic acid e.g. a recombinant expression vector
  • a suitable host cell is a cell of a single-cell eukaryotic organism, a fungal cell, a yeast cell, an animal cell, a cell from an invertebrate animal (e.g. fruit fly, cnidarian, echinoderm, nematode, etc.), a cell from a vertebrate animal (e.g., fish, amphibian, reptile, bird, mammal), a cell from a mammal (e.g., a pig, a cow, a goat, a sheep, a rodent, a rat, a mouse, a non-human primate, a human, etc.), etc.
  • an invertebrate animal e.g. fruit fly, cnidarian, echinoderm, nematode, etc.
  • a cell from a vertebrate animal e.g., fish, amphibian, reptile, bird, mammal
  • a cell from a mammal
  • a suitable host cell is a fungal cell.
  • Any fungal cell e.g., any fungal cell (e.g., any fungal cell (e.g., any fungal cell (e.g., any fungal cell (e.g., any fungal cell (e.g., any fungal cell (e.g., any fungal cell (e.g., any fungal cell (e.g., any fungal cell (e.g., any fungal cell).
  • a suitable host cell is a yeast cell. Any convenient species of yeast cell can be used.
  • suitable yeast species include, but are not limited to: Saccharomyces cerevisiae, Schizosaccharomyces pombe, Saccharomyces uvaruium, Pichia pastoris (syn. Komagataella pastoris), Hansenula polymorpha (syn. Ogataea parapolymorpha), Yarrowia lipolytica, Pichia stipitis (syn. Scheffersomyces stipitis), Kluyveromyces marxianus,
  • Pachysolen tannophilus Candida boidinii, Candida albicans, and Candida sorenensi.
  • Suitable methods for introducing nucleic acids include e.g., viral infection, transfection, lipofection, nucleofection, electroporation, calcium phosphate precipitation, polyethyleneimine (PEI)-mediated transfection, DEAE-dextran mediated transfection, liposome-mediated transfection, particle gun technology, calcium phosphate precipitation, direct micro injection, nanoparticle-mediated nucleic acid delivery (see, e.g., Panyam et., al Adv Drug Deliv Rev. 2012 Sep 13. pii: S0169-409X(12)00283-9. doi:
  • the choice of method of introducing nucleic acid is generally dependent on the type of cell being transformed and the circumstances under which the transformation is taking place. For example, when transforming fungal cells such as yeast, protocols such as those utilizing lithium acetate, single-stranded carrier DNA, and/or PEG (in some cases coupled with heat shock) can be used.
  • protocols such as those utilizing lithium acetate, single-stranded carrier DNA, and/or PEG (in some cases coupled with heat shock) can be used.
  • PEG in some cases coupled with heat shock
  • retroviruses for example, lentiviruses, are particularly suitable.
  • retroviral vectors are "defective", i.e. unable to produce viral proteins required for productive infection. Rather, replication of the vector requires growth in a packaging cell line.
  • the retroviral nucleic acids comprising the nucleic acid are packaged into viral capsids by a packaging cell line.
  • Different packaging cell lines provide a different envelope protein (ecotropic, amphotropic or xenotropic) to be incorporated into the capsid, this envelope protein determining the specificity of the viral particle for the cells (ecotropic for murine and rat; amphotropic for most mammalian cell types including human, dog and mouse; and xenotropic for most mammalian cell types except murine cells).
  • the appropriate packaging cell line may be used to ensure that the cells are targeted by the packaged viral particles.
  • Methods are provided for: (i) expressing a protein of interest (POI) in a eukaryotic cell (e.g., displaying a POI on the surface of a eukaryotic cell); (ii) measuring the binding of an agent to a POI (e.g., in some cases determining whether an agent can bind to a POI); (iii) identifying an agent (a compound) that binds to a POI (e.g., screening test compounds for an agent that binds to a POI);
  • POI protein of interest
  • identifying a polypeptide that binds to an agent e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g., to identify a polypeptide that binds to an agent with an affinity greater than or equal to a pre-determined value
  • generating a variant polypeptide that binds to an agent with an affinity that is different (e.g., greater) than the affinity of the polypeptide from which the variant was derived and the like.
  • the subject method is a method of expressing a protein of interest (POI) in a eukaryotic cell (e.g., displaying a POI on the surface of a eukaryotic cell).
  • POI protein of interest
  • Such methods include introducing into a cell (e.g., any desired host cell) a subject surface accessible fusion protein that includes the POI.
  • such a method can include introducing into a eukaryotic cell (e.g., a host cell, as described above, such as a fungal cell, a yeast cell, a mammalian cell, etc.) a nucleic acid having a nucleotide sequence that encodes a surface accessible fusion protein, where the surface accessible fusion protein includes a signal polypeptide, a POI, a stalk polypeptide, and a surface anchor polypeptide (and in some cases a tag).
  • a eukaryotic cell e.g., a host cell, as described above, such as a fungal cell, a yeast cell, a mammalian cell, etc.
  • a nucleic acid having a nucleotide sequence that encodes a surface accessible fusion protein where the surface accessible fusion protein includes a signal polypeptide, a POI, a stalk polypeptide, and a surface anchor polypeptide (and in some cases a tag).
  • a surface accessible fusion protein that includes the POI can be introduced into a cell: (i) directly as a protein (e.g., in some cases using a protein transduction domain); (ii) as an RNA encoding the protein; (iii) or as a DNA encoding the protein.
  • the nucleotides encoding a surface accessible fusion protein are operably linked to a promoter that is operable in the cell.
  • a method of expressing a protein of interest (POI) in a eukaryotic cell further includes any combination of steps of the methods described below.
  • the subject method is a method of measuring the binding of an agent to a POI (e.g., in some cases determining whether an agent can bind to a POI).
  • Methods of measuring the binding of an agent to a POI can include displaying the POI on the surface of a eukaryotic cell (e.g., any eukaryotic host cell of interest, e.g., a mammalian cell, a fungal cell, a yeast cell, etc.)(e.g., see "methods of expressing" above).
  • a eukaryotic cell e.g., any eukaryotic host cell of interest, e.g., a mammalian cell, a fungal cell, a yeast cell, etc.
  • Methods of measuring the binding of an agent to a POI include contacting the
  • an agent can be any agent that can bind to a POI.
  • suitable agents include any chemical entity, pharmaceutical, drug, peptide, antibody, antibody binding fragment, small molecule compound, including both known and potential therapeutic compounds, that can be tested (e.g., screened) for its potential binding to one or more POIs.
  • the POI includes an antigen binding domain of an antibody and the agent (e.g., test agent) is a peptide (in some cases a variant of a peptide known to bind to the antibody).
  • the POI is an epitope (or a variant of a known epitope) for an antibody and the agent is the antibody or an antigen binding domain from the antibody. In some cases, the POI is the binding region of a ligand or receptor (or a variant thereof) of a ligand/receptor pair.
  • the agent includes a detectable label (e.g., the agent can be directly or indirectly detectable).
  • the agent is directly labeled (e.g., the agent can include a directly detectable adduct, such as a fluorescent adduct).
  • the agent is indirectly labeled (e.g, the agent can include an indirectly detectable adduct, such as biotin).
  • measuring the amount of the agent bound to the POI can be accomplished by measuring the amount of the agent (e.g., quantitatively or qualitatively, as described below) bound to the cell expressing the surface accessible fusion protein.
  • measuring an amount can provide qualitative or quantitative results, and thus, the phrase as used herein encompasses quantitative as well as qualitative measures. For example, in some cases where measuring an amount is qualitative, measuring the amount of an agent bound to a POI includes determining whether an agent is bound or not bound to the POI (e.g., bound or not bound to a cell expressing a surface accessible fusion protein that includes the POI; present or not present at the end of the protocol, etc.). In some cases, measuring the amount of agent bound to a POI includes determining whether an agent is bound or not bound to the POI above a particular threshold of binding.
  • a step of measuring an amount includes is a step of determining whether an agent is bound or not bound to a POI (e.g., to a surface accessible fusion protein, to a cell expressing a surface accessible fusion protein, etc.). In some cases, measuring an amount provides a simple "yes” or "no" determination of whether an agent is present.
  • measuring an amount includes determining a quantitative measure of the amount of agent bound to a surface accessible fusion protein (e.g., using flow cytometry, ELISA, or any other method that can quantitatively measure the amount of agent present at the end of a given protocol, e.g., present after a final washing step).
  • the amount (level) of agent bound can be expressed in arbitrary units associated with a particular assay (e.g., fluorescence units, e.g., mean fluorescence intensity (MFI)), or can be expressed as an absolute value with defined units (e.g., number of molecules (e.g., moles), number of protein molecules, concentration of agent, etc.).
  • a quantitatively measured amount can be compared to the amount of a reference value to derive a normalized value that represents a normalized measured amount.
  • a step of measuring an amount can be a detecting in a qualitative manner ("present” vs "absent”; “yes, above a predetermined threshold” vs "no, not above a predetermined threshold”; etc.) or a quantitative manner.
  • Techniques such as flow cytometry and ELISA can be used in both qualitative and quantitative steps of measuring. For example, both of the techniques can be used to determine a quantitative amount (e.g., in fluorescent units such as mean fluorescent intensity (MFI)) of an agent that is present, but can also be used to simply determine if the amount present is present above a particular threshold.
  • MFI mean fluorescent intensity
  • the subject method is a method of identifying an agent (a
  • Methods of identifying an agent that binds to a POI include displaying the POI on the surface of a eukaryotic cell (e.g., any eukaryotic host cell of interest, e.g., a mammalian cell, a fungal cell, a yeast cell, etc.), contacting the cell with an agent, and measuring the amount (quantitatively and/or qualitatively) of agent that is bound to the cell.
  • a eukaryotic cell e.g., any eukaryotic host cell of interest, e.g., a mammalian cell, a fungal cell, a yeast cell, etc.
  • a given surface accessible fusion protein can be displayed on the
  • two or more agents e.g., a library of agents
  • each cell e.g., each separate population of cells
  • two or more agents can be screened to identify which, if any, of the agents binds to the cells expressing the POI as a surface accessible fusion protein.
  • the POI includes an antigen binding domain of an antibody and the agent (e.g., test agent) is a peptide (in some cases a variant of a peptide known to bind to the antibody); in some cases, the POI is an epitope (or a variant of a known epitope) for an antibody and the agent is the antibody or an antigen binding domain from the antibody; and in some cases, the POI is the binding region of a ligand or receptor (or a variant thereof) of a ligand/receptor pair.
  • a method can include a step of mutagenesis (e.g., using any convenient method, such as random or site-directed PCR protocols).
  • test agents e.g., a library of test agents
  • the agents can be used to contact cells expressing a subject surface accessible fusion protein, and those agents that bind to the cells can be identified.
  • the concentration of an agent can be controlled so that only those agents that bind with a particular affinity (or better) will be identified.
  • different concentrations of a given agent can be used to contact each cell (e.g., separate populations of cells).
  • the methods can be used to determine whether the binding of an agent to a given POI is maintained at different concentrations of agent (which, for example, can be used to estimate an affinity of the agent for the POI).
  • an agent can be used at 10nM, 100nM, and 1000nM to contact three different cell populations, each expressing the same surface accessible fusion protein. Whether or not the agent is bound can be determined for each concentration, and an estimate of binding affinity can be made. For example, an agent that binds at all three concentrations can be said to bind to a given POI with a higher affinity than an agent that binds at l OOOnM but does not bind at 100nM or 10nM.
  • a cell expressing a surface accessible fusion protein can be contacted at the same time (simultaneously) with two or more agents, where the agents are
  • each agent has a different detectable label.
  • a given cell or population of cells can be contacted with 10 different agents, where each agent includes a different detectable label (e.g., a different fluorescent label).
  • the amount of each detectable label can be measured (quantitatively and/or qualitatively). For example, one may use such a method to pool multiple different agents to identify those that bind to the surface accessible fusion protein from those that don't.
  • the subject method is a method of identifying a polypeptide that binds to an agent (e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g., to identify a polypeptide that binds to an agent with an affinity greater than or equal to a p re-determined value).
  • an agent e.g., a polypeptide that binds to agent when the agent is present at a particular concentration, e.g., to identify a polypeptide that binds to an agent with an affinity greater than or equal to a p re-determined value.
  • Methods of identifying a polypeptide that binds to an agent include displaying the POI on the surface of a eukaryotic cell (e.g., any eukaryotic host cell of interest, e.g., a mammalian cell, a fungal cell, a yeast cell, etc.).
  • Such methods can be identical to those above for methods of identifying an agent, but this case the used may be held constant (or used at particular concentrations), but the agent is used to contact two or more cells, where at least two of the two or more cells expresses (is displaying) a different POI in the form of a different surface accessible fusion protein. For each cell (or each population of cells), binding of the agent can be measured (qualitatively or
  • the subject method is a method of generating a variant
  • polypeptide that binds to an agent with an affinity that is different (e.g., greater) than the affinity of the polypeptide from which the variant was derived Such methods include a step generating one or more variant polypeptides (e.g., using any convenient method to generate a variant, e.g., PCR based mutagenesis).
  • the variant polypeptides would be identical to the starting surface accessible fusion protein, with the exception that they would different by one or more amino acids at the POI portion of the surface accessible fusion protein. Measuring the amount of binding of an agent with one or more of the generated variants would then be used to identify which of the variants bind to the agent.
  • a POI includes an antigen binding domain of an antibody and the agent (e.g., test agent) is a peptide (in some cases a variant of a peptide known to bind to the antibody); in some cases, the POI is an epitope (or a variant of a known epitope) for an antibody and the agent is the antibody or an antigen binding domain from the antibody; and in some cases, the POI is the binding region of a ligand or receptor (or a variant thereof) of a ligand/receptor pair.
  • a method can include a step of mutagenesis (e.g., using any convenient method, such as random or site-directed PCR protocols).
  • two or more POIs can be generated (e.g., to generate a library of surface accessible fusion proteins) (e.g., where the POIs are variants of one another and/or variants of a staring POI).
  • An agent can then be used to contact cells (e.g., different populations of cells) expressing the two or more surface accessible fusion proteins (the variants), and those POIs that bind to the agent can then be identified.
  • the concentration of an agent can be controlled so that only those POIs that bind with a particular affinity (or better) to the agent will be identified.
  • different concentrations of a given agent can be used to contact the each cell (e.g., separate populations of cells, multiple copies of a library of cells, etc.).
  • the methods can be used to identify only those POIs that can bind to a given agent when the agent is present at a given concentration.
  • the POIs could then be re-screened using a lower concentration of agent (e.g., 10nM), to limit the number of POIs identified.
  • control may be used.
  • a surface accessible fusion protein having a control POI (or no POI) can be used to provide a control for the amount of signal expected in the absence of binding.
  • control POI or no POI
  • Various such controls would be readily contemplated by one of ordinary skill in the art and any convenient control can be used.
  • kits for use in the methods can include any of above described surface accessible fusion proteins and/or nucleic acids.
  • a suitable kit includes a nucleic acid (e.g., a recombinant expression vector) for expressing a surface accessible fusion protein, or a nucleic acid (e.g., a recombinant expression vector) encoding a surface accessible fusion protein, as described above.
  • a kit includes two or more DNA nucleic acids (e.g., recombinant expression vectors).
  • kits includes two or more subject DNA nucleic acids (e.g., recombinant expression vectors) for expressing a surface accessible fusion protein.
  • the kits can include nucleic acids that include nucleotides encoding a POI, nucleic acids that do not include nucleotides encoding a POI, nucleic acids that include an insertion site for inserting nucleotides encoding a POI, etc.
  • at least two of the two or more DNA nucleic acids include an insertion site for inserting a POI.
  • the synthetic stalk polypeptides encoded by at least two of the two or more DNA nucleic acids are of different lengths.
  • the stalk polypeptides (e.g., synthetic stalk polypeptides) encoded by at least two of the two or more DNA nucleic acids have a length in a range of: from 20 to 100 amino acids, from 40 amino acids to 100 amino acids, from 101 to 200 amino acids, from 201 to 300 amino acids, from 301 to 400 amino acids, from 401 to 500 amino acids, from 501 to 600 amino acids, from 601 to 700 amino acids, from 701 to 800 amino acids, from 801 to 900 amino acids, from 901 to 1000 amino acids, or from 1001 to 1500 amino acids.
  • the synthetic stalk polypeptides encoded by at least two of the two or more DNA nucleic acids are of different lengths and each have a length in a range of: from 20 to 100 amino acids, from 40 amino acids to 100 amino acids, from 101 to 200 amino acids, from 201 to 300 amino acids, from 301 to 400 amino acids, from 401 to 500 amino acids, from 501 to 600 amino acids, from 601 to 700 amino acids, from 701 to 800 amino acids, from 801 to 900 amino acids, from 901 to 1000 amino acids, or from 1001 to 1500 amino acids.
  • a kit can include multiple DNA nucleic acids (e.g., for expressing a subject surface accessible fusion protein), where the stalk polypeptides encoded by multiple DNA nucleic acids span a range of lengths.
  • the synthetic stalk polypeptides encoded by at least two of the two or more DNA nucleic acids have different sequences (e.g., even if they are of the same length).
  • one nucleic acid (e.g., recombinant expression) of a kit might encode a stalk polypeptide with a length in a range of from 20 to 100 amino acids, and another might encode a stalk polypeptide with a length in a range of from 101 to 200 amino acids.
  • a kit may have multiple nucleic acids (e.g., recombinant expression vectors) encoding multiple different stalk polypeptides (e.g, differing by length and/or by sequence).
  • Such a kit would allow one to perform the subject methods using multiple different surface accessible fusion proteins, even if in some cases the POI was the same for different fusion proteins.
  • At least two of the two or more DNA nucleic acids encode different signal polypeptides, different tags (and/or a different arrangement of tags, i.e., different positioning of the nucleotides encoding the tags relative to the other encoded components), and/or different surface anchor polypeptides (e.g., different GPI anchors).
  • at least two of the two or more DNA nucleic acids have different insertion sites. Any or all combinations of the above are contemplated.
  • kits can further include one or more additional reagents, where such additional reagents can be selected from: a dilution buffer; a reconstitution solution; a wash buffer; a control reagent; a control expression vector; a reagent; a host cell having a subject nucleic acid; a host cell not having a subject nucleic acid (e.g. a nucleic acid for expressing a surface accessible fusion protein, a nucleic acid encoding a surface accessible fusion protein, etc.), and the like.
  • Components of a subject kit can be in separate containers (e.g., different tubes, different wells of a multiwell plate, etc.), and can in some cases be combined in a single container.
  • the subject kits may further include (in certain embodiments) instructions for practicing the subject methods.
  • These instructions may be present in the subject kits in a variety of forms, one or more of which may be present in the kit.
  • One form in which these instructions may be present is as printed information on a suitable medium or substrate, e.g., a piece or pieces of paper on which the information is printed, in the packaging of the kit, in a package insert, and the like.
  • Yet another form of these instructions is a computer readable medium, e.g., diskette, compact disk (CD), flash drive, and the like, on which the information has been recorded.
  • Yet another form of these instructions that may be present is a website address which may be used via the internet to access the information at a removed site.
  • compositions and methods described herein can be used to develop new fungal cells (e.g., new yeast strains) for various purposes, including but not limited to fermentative production of chemicals and polypeptides.
  • the compositions and methods described herein may be used for a variety of research purposes, including the expression of mutagenized proteins or other combinatorial libraries on yeast.
  • the compositions and methods described herein use monocistronic vectors, enabling use in a wide variety of yeast strains and species.
  • the compositions and methods described herein allow selective ("tunable") accessibility to a protein of interest (e.g., by varying the length of the stalk polypeptide), which can controlled to limit the molecular weight of a substrate or binding partner.
  • Fig. 1A-1 C depicts experiments performed to determine whether accessibility could be "tuned” using variable-length GPI-anchored "stalk polypeptides.”
  • the yeast strain used for these experiments was BJ5465.
  • Fig. 1 A depicts a schematic of one embodiment of peptide linkage to the yeast cell surface: a protein of interest (POI) (here, the engineered SIRPa variant CV1 ) is secreted as a surface accessible fusion protein in which the POI is fused to (i) a signal polypeptide (which directs the protein to the secretory pathway, but which can be cleaved from the protein via post-translational processing), (ii) a stalk polypeptide (a synthetic sequence, the length of which can be modified over a wide range of lengths), (iii) a GPI anchor (e.g. a synthetic GPI anchor), and optionally (iv) an epitope tag (depicted is an HA epitope tag).
  • POI protein of interest
  • Fig. 1 B depicts experimental results showing the relationship between stalk length (in amino acids) and surface staining for 3 labeled probes of different size (different molecular weight): anti-HA antibody (-150 kD), CD47-streptavidin tetramers (-100 kD)(which bind to CV1 , the POI used in these experiments), and CD47-biotin monomers (-15 kDa) (which also bind to CV1 ).
  • Fig. 1 C depicts representative flow cytometry plots of yeast displaying CV-1 attached to different length stalks stained simultaneously with Anti-HA antibodies (Alexa488) and CD47-biotin monomers (Alexa647).
  • the length of the tested stalk sequences, in number of amino acids, is listed above each plot.
  • the data show that stalk length can be used to "select" for compounds of a particular molecular weight.
  • depicted on the Y-axis is binding of the 150 kD anti-HA antibody, which did not bind very well to the surface accessible fusion polypeptide when the stalk polypeptide was 19 or 41 amino acids in length, but did bind when the stalk polypeptide was 232, 465, or 649 amino acids in length.
  • CD47-biotin (x-axis) bound to the surface accessible fusion polypeptide even when the stalk polypeptide was 19 amino acids in length, but bound stronger when the stalk polypeptide was 41 , 232, 465, or 649 amino acids in length.
  • Fig. 2A-2B depicts experiments performed to determine whether the subject
  • compositions and methods are compatible with additional yeast strains.
  • the engineered SIRPA variant CV1 was secreted as a fusion to the HA epitope tag and a 649 amino-acid long synthetic stalk with a synthetic GPI anchor (i.e, CV1 was the protein of interest (POI), which was expressed as a surface accessible fusion polypeptide).
  • POI protein of interest
  • the yeast strain used for these experiments was YVH10, in contrast to BJ5465 used in Fig. 1A-1 C.
  • YVH10 yeast overexpress yeast protein disulfide isomerase (PDI), enabling greater folding capacity for secreted, disulfide-bond containing proteins.
  • PDI yeast protein disulfide isomerase
  • Example 3 Directed evolution of a soluble fragment of human IL2R3 for high-affinity binding to IL-2
  • Example 4 Yeast surface display of human antibody libraries
  • Fab antigen binding
  • scFv single chain variable fragments
  • Approach By gene synthesis, generate a library of piasmids that encode variants of human antibody binding regions (either in Fab or scFv format) fused to a GPi-linked anchor (as per the primary technoiogy described in the patent); e!ectroporate library of piasmids into yeast or fungal strain; induce surface display of antibody fragments; select for high-affinity binders by assessing interaction with a tagged, soluble, recombinant protein corresponding to the desired region of protein binding (for example, to generate a therapeutic antibody which would bind PD-1 and block its interaction with PD-L1 .
  • Example 5 Yeast surface display of alternative scaffold libraries
  • fibronectins fibronectins, immunoglobulins, krtottins, DARPins, anticalins, on the surface of yeast for the purpose of generating high-affinity, high-specificity therapeutic human monoclonal antibodies against any known ceil surface or secreted protein,
  • Example 6 Yeast surface display of translated cDNAs to identify interacting proteins of a target of interest in an unbiased fashion

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pathology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Plant Pathology (AREA)
  • Toxicology (AREA)
  • Mycology (AREA)
  • Virology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
PCT/US2015/059787 2014-11-10 2015-11-09 Compositions and methods for expressing polypeptides on the surface of cells Ceased WO2016077249A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
EP15859426.7A EP3218477A4 (en) 2014-11-10 2015-11-09 Compositions and methods for expressing polypeptides on the surface of cells
US15/525,397 US10829771B2 (en) 2014-11-10 2015-11-09 Compositions and methods for expressing polypeptides on the surface of cells
JP2017524052A JP7235436B2 (ja) 2014-11-10 2015-11-09 細胞の表面上にポリペプチドを発現させるための組成物および方法
CN201580059777.8A CN107075507B (zh) 2014-11-10 2015-11-09 用于在细胞表面上表达多肽的组合物和方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462077756P 2014-11-10 2014-11-10
US62/077,756 2014-11-10

Publications (1)

Publication Number Publication Date
WO2016077249A1 true WO2016077249A1 (en) 2016-05-19

Family

ID=55954905

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/059787 Ceased WO2016077249A1 (en) 2014-11-10 2015-11-09 Compositions and methods for expressing polypeptides on the surface of cells

Country Status (5)

Country Link
US (1) US10829771B2 (https=)
EP (1) EP3218477A4 (https=)
JP (2) JP7235436B2 (https=)
CN (1) CN107075507B (https=)
WO (1) WO2016077249A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN108085332A (zh) * 2017-12-27 2018-05-29 中国科学院青岛生物能源与过程研究所 一种细胞表面展示有豆壳过氧化物酶的重组酵母菌及其构建方法与应用
JP2022163080A (ja) * 2016-12-12 2022-10-25 エクセラ・バイオサイエンシーズ・インコーポレイテッド マイクロキャピラリーアレイを使用したスクリーニングのための方法およびシステム
US11668021B2 (en) 2017-05-09 2023-06-06 Yale University Basehit, a high-throughput assay to identify proteins involved in host-microbe interaction
US12228584B2 (en) 2016-12-30 2025-02-18 xCella Biosciences, Inc. Multi-stage sample recovery system
EP4236985A4 (en) * 2020-10-28 2025-03-05 The Board of Trustees of the Leland Stanford Junior University CD47 BLOCKADE AND COMBINATION THERAPIES FOR REDUCING VASCULAR INFLAMMATION
US12318775B2 (en) 2018-12-06 2025-06-03 xCella Biosciences, Inc. Lateral loading of microcapillary arrays

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2020004559A (es) * 2017-10-31 2020-10-05 Encodia Inc Kits para análisis utilizando codificación y/o etiqueta de ácido nucleico.
WO2020061389A1 (en) * 2018-09-20 2020-03-26 Washington University Engineered microorganisms and methods of making and using same
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
CN110551644A (zh) * 2019-07-19 2019-12-10 天津科技大学 通过调控细胞壁组成蛋白构建的低产高级醇酿酒酵母菌株
WO2021168388A1 (en) * 2020-02-21 2021-08-26 3T Biosciences, Inc. Yeast display libraries, associated compositions, and associated methods of use
EP4241789A4 (en) 2020-12-08 2025-04-02 Nona Biosciences (Shanghai) Co., Ltd. Protein-drug conjugate and site-specific conjugation method
IL309179A (en) * 2021-06-10 2024-02-01 Janssen Biotech Inc Nucleic acid coding for KLK2-GPI fusion protein, recombinant cells and their uses
CN118546912A (zh) * 2024-05-29 2024-08-27 浙江毓昌生物技术有限公司 一种高稳定性双碱基酶Kex2突变体的表达纯化方法
CN118726441B (zh) * 2024-06-20 2025-06-03 广州大学 一种灵芝表面展示系统及其制备方法和应用

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110076752A1 (en) * 2007-02-09 2011-03-31 Medimmune, Llc Antibody library display by yeast cell plasma membrane
US20110086768A1 (en) * 2006-12-12 2011-04-14 Biorexis Pharmaceutical Corporation Transferrin fusion protein libraries
US20110230374A1 (en) * 2008-12-01 2011-09-22 Zeev Pancer High affinity recombinant sea lamprey antibodies selected by a yeast surface display platform
US20120208769A1 (en) * 2005-12-02 2012-08-16 Peter Jon Nelson Chemokine-Mucin Fusions Linked to Glycosylphosphatidylinositol (GPI)-Anchors in Tissue Regeneration and as Tumour Immune Adjuvants

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2003235579A (ja) * 2002-02-19 2003-08-26 Bio Energy Kk 凝集タンパク質Flo1を用いる細胞表層発現系の最適化
US8343752B2 (en) * 2011-05-03 2013-01-01 Verdezyne, Inc. Biological methods for preparing adipic acid

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120208769A1 (en) * 2005-12-02 2012-08-16 Peter Jon Nelson Chemokine-Mucin Fusions Linked to Glycosylphosphatidylinositol (GPI)-Anchors in Tissue Regeneration and as Tumour Immune Adjuvants
US20110086768A1 (en) * 2006-12-12 2011-04-14 Biorexis Pharmaceutical Corporation Transferrin fusion protein libraries
US20110076752A1 (en) * 2007-02-09 2011-03-31 Medimmune, Llc Antibody library display by yeast cell plasma membrane
US20110230374A1 (en) * 2008-12-01 2011-09-22 Zeev Pancer High affinity recombinant sea lamprey antibodies selected by a yeast surface display platform

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
BALDWIN ET AL.: "Analysis of Glycosylphosphatidylinositol Protein Anchors: The Prion Protein", METHODS IN ENZYMOLOGY, vol. 405, 13 January 2006 (2006-01-13), pages 172 - 187, XP009502879 *
See also references of EP3218477A4 *

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2022163080A (ja) * 2016-12-12 2022-10-25 エクセラ・バイオサイエンシーズ・インコーポレイテッド マイクロキャピラリーアレイを使用したスクリーニングのための方法およびシステム
US12024705B2 (en) 2016-12-12 2024-07-02 xCella Biosciences, Inc. Methods and systems for screening using microcapillary arrays
JP7633212B2 (ja) 2016-12-12 2025-02-19 エクセラ・バイオサイエンシーズ・インコーポレイテッド マイクロキャピラリーアレイを使用したスクリーニングのための方法およびシステム
US12228584B2 (en) 2016-12-30 2025-02-18 xCella Biosciences, Inc. Multi-stage sample recovery system
US11668021B2 (en) 2017-05-09 2023-06-06 Yale University Basehit, a high-throughput assay to identify proteins involved in host-microbe interaction
CN108085332A (zh) * 2017-12-27 2018-05-29 中国科学院青岛生物能源与过程研究所 一种细胞表面展示有豆壳过氧化物酶的重组酵母菌及其构建方法与应用
CN108085332B (zh) * 2017-12-27 2020-11-27 中国科学院青岛生物能源与过程研究所 一种细胞表面展示有豆壳过氧化物酶的重组酵母菌及其构建方法与应用
US12318775B2 (en) 2018-12-06 2025-06-03 xCella Biosciences, Inc. Lateral loading of microcapillary arrays
EP4236985A4 (en) * 2020-10-28 2025-03-05 The Board of Trustees of the Leland Stanford Junior University CD47 BLOCKADE AND COMBINATION THERAPIES FOR REDUCING VASCULAR INFLAMMATION

Also Published As

Publication number Publication date
EP3218477A4 (en) 2018-07-18
US10829771B2 (en) 2020-11-10
JP2018500009A (ja) 2018-01-11
EP3218477A1 (en) 2017-09-20
US20180037898A1 (en) 2018-02-08
JP2021101712A (ja) 2021-07-15
JP7235436B2 (ja) 2023-03-08
CN107075507B (zh) 2021-08-24
CN107075507A (zh) 2017-08-18

Similar Documents

Publication Publication Date Title
US10829771B2 (en) Compositions and methods for expressing polypeptides on the surface of cells
US10301616B2 (en) Yeast display systems
US11795579B2 (en) Yeast display of proteins in the periplasmic space
CN110003333B (zh) 多肽、pd-l1单域抗体、核苷酸序列及试剂盒
CN111801446A (zh) 一种用于分离G蛋白偶联受体(GPCRs)的功能性抗体的酵母表型筛选方法
US20220154174A1 (en) Method of Selecting for Antibodies
US10093920B2 (en) Protein display
US20100324271A1 (en) Phage-displaying single-chain antibody capable of recognizing non-reduced mannose residue
US20220186209A1 (en) Methods of antibody panning against target proteins
WO2023051972A1 (en) Method for the generation and selection of a producer cell
US20250059561A1 (en) Method for screening a signal peptide for efficient expression and secretion of a heterologous polypeptide in mammalian cells
RU2802770C2 (ru) Дрожжевой дисплей белков в периплазматическом пространстве
CN117384936A (zh) 一种酵母展示载体及酵母展示双特异Fab的方法
CN117384937A (zh) 一种高效酵母展示载体及酵母展示方法
CN117836308A (zh) 用于选择特异性结合剂的手段和方法
HK40043087A (en) Yeast display of proteins in the periplasmic space

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15859426

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2015859426

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015859426

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2017524052

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 15525397

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE