WO2016070061A1 - Methods and compositions for modified t cells - Google Patents

Methods and compositions for modified t cells Download PDF

Info

Publication number
WO2016070061A1
WO2016070061A1 PCT/US2015/058339 US2015058339W WO2016070061A1 WO 2016070061 A1 WO2016070061 A1 WO 2016070061A1 US 2015058339 W US2015058339 W US 2015058339W WO 2016070061 A1 WO2016070061 A1 WO 2016070061A1
Authority
WO
WIPO (PCT)
Prior art keywords
cell
cells
modified
antigen
tcr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/058339
Other languages
English (en)
French (fr)
Inventor
Yangbing Zhao
Xiaojun Liu
Carl H. June
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Pennsylvania Penn
Original Assignee
University of Pennsylvania Penn
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2964958A priority Critical patent/CA2964958A1/en
Priority to AU2015338984A priority patent/AU2015338984A1/en
Priority to US15/518,922 priority patent/US20170258835A1/en
Priority to EP15855013.7A priority patent/EP3212225B1/en
Priority to CN201580071613.7A priority patent/CN107106670A/zh
Priority to KR1020177014658A priority patent/KR20170074243A/ko
Priority to HK18102826.6A priority patent/HK1243333A1/zh
Priority to JP2017523266A priority patent/JP7372728B2/ja
Application filed by University of Pennsylvania Penn filed Critical University of Pennsylvania Penn
Priority to EP25207728.4A priority patent/EP4653013A3/en
Publication of WO2016070061A1 publication Critical patent/WO2016070061A1/en
Anticipated expiration legal-status Critical
Priority to JP2023088510A priority patent/JP7757343B2/ja
Priority to JP2025169833A priority patent/JP2025188145A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N1/00Preservation of bodies of humans or animals, or parts thereof
    • A01N1/10Preservation of living parts
    • A01N1/16Physical preservation processes
    • A01N1/162Temperature processes, e.g. following predefined temperature changes over time
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/32T-cell receptors [TCR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/33Antibodies; T-cell engagers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/36Immune checkpoint inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4203Receptors for growth factors
    • A61K40/4204Epidermal growth factor receptors [EGFR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4203Receptors for growth factors
    • A61K40/4205Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4224Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4231Cytokines
    • A61K40/4232Tumor necrosis factors [TNF] or CD70
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4254Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
    • A61K40/4255Mesothelin [MSLN]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/43Protozoan antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/45Bacterial antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/46Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/04Antipruritics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/14Drugs for dermatological disorders for baldness or alopecia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/04Drugs for skeletal disorders for non-specific disorders of the connective tissue
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/14Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/38Drugs for disorders of the endocrine system of the suprarenal hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/08Vasodilators for multiple indications
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3053Skin, nerves, brain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N13/00Treatment of microorganisms or enzymes with electrical or wave energy, e.g. magnetism, sonic waves
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5156Animal cells expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5158Antigen-pulsed cells, e.g. T-cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/28Expressing multiple CARs, TCRs or antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/50Cell markers; Cell surface determinants
    • C12N2501/515CD3, T-cell receptor complex
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • Adoptive cell transfer (ACT) using chimeric antigen receptor (CAR) modified T cells has been shown to be a promising strategy for the treatment of cancers (Louis et al., 2011, Blood 118:6050-6056; Kochenderfer et al, 2010, Blood 116:3875-3886 and Porter et al, 2011, N Engl J Med 365:725-733).
  • RNA transfection of T cells with T cell receptor (TCR) or CAR RNA electroporation By minimizing dosage of both RNA and T cells, such methods efficiently permit the introduction of multiple genes.
  • TCR T cell receptor
  • CAR CAR RNA electroporation
  • the present invention relates to compositions and methods for modifying T cells.
  • the invention includes a modified T cell comprising an exogenous nucleic acid encoding a T cell receptor (TCR) comprising affinity for an antigen on a target cell and an electroporated RNA encoding a bispecific antibody, wherein the T cell expresses the TCR and bispecific antibody on a surface of the T cell.
  • TCR T cell receptor
  • the invention includes a method for generating a modified T cell comprising introducing a nucleic acid encoding a modified T cell receptor (TCR) comprising affinity for an antigen on a target cell into a T cell and a nucleic acid encoding a bispecific antibody, wherein the electroporated T cell is capable of expressing the TCR and bispecific antibody.
  • TCR modified T cell receptor
  • the invention includes a use of the T cell described herein in the manufacture of a medicament for the treatment of an immune response in a subject in need thereof.
  • the invention includes a method for stimulating a T cell-mediated immune response to a target cell or tissue in a subject comprising administering to a subject an effective amount of a modified T cell comprising an electroporated with RNA a modified T cell receptor (TCR) and RNA encoding a bispecific antibody, wherein the modified T cells express the modified TCR and bispecific antibody.
  • a modified T cell comprising an electroporated with RNA a modified T cell receptor (TCR) and RNA encoding a bispecific antibody, wherein the modified T cells express the modified TCR and bispecific antibody.
  • TCR modified T cell receptor
  • the invention includes a method for adoptive cell transfer therapy comprising administering a population of modified T cells to a subject in need thereof to prevent or treat an immune reaction that is adverse to the subject, wherein the modified T cells have been electroporated with RNA encoding a modified T cell receptor (TCR) and RNA encoding a bispecific antibody.
  • the invention includes a method of treating a disease or condition associated with enhanced immunity in a subject comprising administering a population of modified T cells to a subject in need thereof, wherein the modified T cells have been electroporated with RNA encoding a modified T cell receptor (TCR) and RNA encoding a bispecific antibody.
  • the invention includes a method of treating a condition in a subject, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising the modified T cell as described herein.
  • the invention includes a composition comprising the modified T cell.
  • the invention includes a pharmaceutical composition comprising the modified T cell of claim 1 and a pharmaceutically acceptable carrier.
  • the TCR comprises at least one disulfide bond. In one embodiment, the TCR comprises at least one murine constant region. In another embodiment, the TCR has higher affinity for the target cell antigen than a for a wildtype TCR. In yet another embodiment, the TCR comprises TCR alpha and beta chains. In one embodiment, the TCR comprises a co-stimulatory signaling domain, such as a a 4- IBB co-stimulatory signaling domain, at a C terminal of at least one of the chains. In one embodiment, the beta chain comprises at least one N-deglycosylation. In one
  • the alpha chain comprises at least one N-deglycosylation.
  • the target cell antigen is selected from the group consisting of a viral antigen, bacterial antigen, parasitic antigen, tumor cell associated antigen (TAA), disease cell associated antigen, and any fragment thereof.
  • the bispecific antibody comprises a bispecific antigen binding domain selected from the group consisting of a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof.
  • the bispecific antigen binding domain comprises a first and a second single chain variable fragment (scFv) molecules, such as the first scFv molecule is specific for at least one antigen on a target cell and the second scFv molecule is specific for an antigen on an activating T cell.
  • the activating T cell antigen selected from the group consisting of CD3, CD4, CD8, CD27, CD28, CD83, CD86, CD127, 4-lBB, 4- 1BBL, TCR, PDl and PD1L.
  • the T cell described herein further comprises an electroporated nucleic acid encoding a costimulatory molecule.
  • the T cell is obtained from the group consisting of peripheral blood mononuclear cells, cord blood cells, a purified population of T cells, and a T cell line.
  • the co-stimulatory molecule is selected from the group consisting of CD3, CD27, CD28, CD83, CD86, CD127, 4-lBB, 4-lBBL, PDl and PD1L.
  • the methods described herein further comprise electroporating a RNA encoding CD3 into the T cells.
  • the CD3 RNA is co-electroporated with the TCR nucleic acid.
  • the nucleic acids comprise in vitro transcribed RNA or synthetic RNA.
  • the nucleic acid encoding the TCR comprises a nucleic acid encoding a TCR alpha and a TCR beta chain.
  • the step of introducing the nucleic acid comprises co-electroporating a RNA encoding the TCR alpha chain and a separate RNA encoding the TCR beta chain.
  • the methods described herein further comprise expanding the T cell.
  • the expanding comprises culturing the T cell with a factor selected from the group consisting of flt3-L, IL-1, IL-2, IL-3 and c-kit ligand.
  • the expanding comprises electroporating the T cell with RNA encoding a chimeric membrane protein and culturing the electroporated T cell, such as a chimeric membrane protein comprising a single chain variable fragment (scFv) against CD3 and an intracellular domain comprising a fragment of an intracellular domain of CD28 and 4-lBB.
  • scFv single chain variable fragment
  • the methods described herein further comprise cryopreserving the T cell. In one embodiment, the methods described herein further comprise thawing the cryopreserved T cell prior to introducing the nucleic acids into the T cell. In yet another embodiment, the methods described herein further comprise cryopreserving the T cells after introducing the TCR nucleic acid. In still another embodiment, the methods described herein further comprise expressing the bispecific antibody as a membrane protein. In still another embodiment, the methods described herein further comprise cryopreserving the bispecific antibody introduced T cells. In yet another embodiment, the methods described herein further comprise inducing lysis of the target cell or tissue. In one embodiment, the induced lysis is antibody-dependent cell- mediated cytotoxicity (ADCC).
  • ADCC antibody-dependent cell- mediated cytotoxicity
  • the condition is an autoimmune disease, such as an autoimmune disease selected from the group consisting of Acquired
  • Immunodeficiency Syndrome (AIDS), alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease, cardiomyopathy, celiac sprue-dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy (CIPD), cicatricial pemphigoid, cold agglutinin disease, crest syndrome, Crohn's disease, Degos' disease, dermatomyositis-juvenile, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia-fibromyositis, Graves' disease, Guillain-Barre syndrome, Hashimoto's thyroid
  • the condition is a cancer, such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • a cancer such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • the invention includes a modified T cell comprising a nucleic acid encoding a bispecific antibody comprising bispecificity for an antigen on a target cell and an antigen on the T cell and a nucleic acid encoding a chimeric ligand engineered activation receptor (CLEAR), wherein the T cell expresses the bispecific antibody and CLEAR.
  • the invention includes a use of the T cell described herein in the manufacture of a medicament for the treatment of an immune response in a subject in need thereof.
  • the invention includes a method for generating a modified T cell comprising introducing a nucleic acid encoding a bispecific antibody and a nucleic acid encoding a chimeric ligand engineered activation receptor (CLEAR) into a T cell, wherein the T cell is capable of expressing the bispecific antibody and the chimeric ligand engineered activation receptor (CLEAR)
  • the invention includes a method for stimulating a T cell-mediated immune response to a target cell or tissue in a subject comprising administering to a subject an effective amount of a modified T cell comprising a nucleic acid encoding chimeric ligand engineered activation receptor (CLEAR) and a nucleic acid encoding a bispecific antibody with bispecificity for an antigen on the target cell and the CLEAR on the T cell, wherein the modified T cells express the CLEAR and bispecific antibody.
  • a modified T cell comprising a nucleic acid encoding chimeric ligand engineered activation receptor (CLEAR) and a nucleic acid encoding a bispecific antibody with bispecificity for an antigen on the target cell and the CLEAR on the T cell, wherein the modified T cells express the CLEAR and bispecific antibody.
  • CLEAR chimeric ligand engineered activation receptor
  • the invention includes a method for adoptive cell transfer therapy comprising administering a population of modified T cells to a subject in need thereof to prevent or treat an immune reaction that is adverse to the subject, wherein the modified T cells comprise a nucleic acid encoding a chimeric ligand engineered activation receptor (CLEAR) and a nucleic acid encoding a bispecific antibody with bispecificity for an antigen on the target cell and the CLEAR on the T cell.
  • a method for adoptive cell transfer therapy comprising administering a population of modified T cells to a subject in need thereof to prevent or treat an immune reaction that is adverse to the subject, wherein the modified T cells comprise a nucleic acid encoding a chimeric ligand engineered activation receptor (CLEAR) and a nucleic acid encoding a bispecific antibody with bispecificity for an antigen on the target cell and the CLEAR on the T cell.
  • CLEAR chimeric ligand engineered activation receptor
  • the invention includes a method of treating a disease or condition associated with enhanced immunity in a subject comprising administering a population of modified T cells to a subject in need thereof, wherein the modified T cells comprise a nucleic acid encoding chimeric ligand engineered activation receptor
  • the invention includes a method of treating a condition in a subject, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising the modified T cell described herein.
  • the invention includes a composition comprising the modified T cell described herein. In still another aspect, the invention includes a pharmaceutical composition comprising the modified T cell described herein and a pharmaceutically acceptable carrier.
  • the CLEAR comprises an intracellular activation domain and an extracellular domain.
  • the intracellular activation domain comprises a portion of an intracellular activation domain of CD3 zeta.
  • the extracellular domain is selected from the group consisting of an antigen binding domain of an antibody, a ligand binding domain of a receptor, an antigen, and a ligand. In one embodiment, the extracellular domain is selected from the group consisting of CD27, CD28, CD70, CD80, PD1, and PD-L1. In one embodiment, the extracellular domain is capable of binding to a tumor antigen.
  • the CLEAR further comprises a co-stimulatory domain.
  • the co-stimulatory domain is selected from the group consisting of CD4, CD8, and 4-1BB.
  • the target cell antigen is selected from the group consisting of a viral antigen, bacterial antigen, parasitic antigen, tumor cell associated antigen (TAA), disease cell associated antigen, and any fragment thereof.
  • the bispecific antibody comprises a bispecific antigen binding domain selected from the group consisting of a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof.
  • the bispecific antigen binding domain comprises a first and a second single chain variable fragment (scFv) molecules, such as the first scFv molecule is specific for at least one antigen on a target cell and the second scFv molecule is specific for the antigen on the T cell.
  • the bispecific antibody comprises bispecificity for an antigen on the target cell and the CLEAR on the T cell.
  • the T cell described herein further comprises a nucleic acid encoding a costimulatory molecule, such as a co-stimulatory molecule selected from the group consisting of CD3, CD27, CD28, CD83, CD86, CD127, 4-1BB, 4-1BBL, PD1 and PD1L.
  • a costimulatory molecule such as a co-stimulatory molecule selected from the group consisting of CD3, CD27, CD28, CD83, CD86, CD127, 4-1BB, 4-1BBL, PD1 and PD1L.
  • the T cell described herein is obtained from the group consisting of peripheral blood mononuclear cells, cord blood cells, a purified population of T cells, and a T cell line.
  • At least one of the nucleic acids is introduced by a method selected from the group consisting of transducing the T cell, transfecting the T cell, and electroporating the T cell.
  • at least one of the nucleic acids comprise in vitro transcribed R A or synthetic RNA.
  • the methods described herein further comprise expanding the T cell.
  • the expanding comprises culturing the T cell with a factor selected from the group consisting of flt3-L, IL-1, IL-2, IL-3 and c-kit ligand.
  • the expanding comprises electroporating the T cell with RNA encoding a chimeric membrane protein, such as a chimeric membrane protein comprising a single chain variable fragment (scFv) against CD3 and an intracellular domain comprising a fragment of an intracellular domain of CD28 and 4-1BB, and culturing the electroporated T cell.
  • a chimeric membrane protein such as a chimeric membrane protein comprising a single chain variable fragment (scFv) against CD3 and an intracellular domain comprising a fragment of an intracellular domain of CD28 and 4-1BB
  • the methods described herein further comprise cryopreserving the T cell. In one embodiment, the methods described herein further comprise thawing the cryopreserved T cell prior to introducing the nucleic acids into the T cell. In yet another embodiment, the methods described herein further comprise cryopreserving the T cells after introducing the CLEAR nucleic acid. In still another embodiment, the methods described herein further comprise expressing the bispecific antibody as a membrane protein. In still another embodiment, the methods described herein further comprise cryopreserving the bispecific antibody introduced T cells. In yet another embodiment, the methods described herein further comprise inducing lysis of the target cell or tissue. In one embodiment, the induced lysis is antibody-dependent cell- mediated cytotoxicity (ADCC).
  • ADCC antibody-dependent cell- mediated cytotoxicity
  • the condition is an autoimmune disease, such as an autoimmune disease selected from the group consisting of Acquired
  • AIDS Immunodeficiency Syndrome
  • alopecia areata, ankylosing spondylitis, antiphospholipid syndrome
  • autoimmune Addison's disease autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease, cardiomyopathy, celiac sprue-dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy (CIPD), cicatricial pemphigoid, cold agglutinin disease, crest syndrome,
  • CIDS chronic fatigue immune dysfunction syndrome
  • CIPD chronic inflammatory demyelinating polyneuropathy
  • the condition is a cancer, such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • a cancer such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • the invention includes a modified T cell comprising a nucleic acid encoding an affinity molecule chimeric receptor comprising a small molecule extracellular domain with affinity for an antigen on a target cell, wherein the T cell expresses the affinity molecule chimeric receptor.
  • the invention includes a modified cell comprising a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell, wherein at least one affinity domain comprises a small molecule antigen binding domain and the cell expresses the bispecific affinity molecule.
  • the invention includes a method for generating a modified T cell comprising introducing a nucleic acid encoding an affinity molecule chimeric receptor comprising a small molecule extracellular domain with affinity for an antigen on a target cell into a population of T cells, wherein the T cells are capable of expressing the affinity molecule chimeric receptor.
  • the invention includes a method for generating a modified cell comprising introducing a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell into a population of cells, wherein at least one affinity domain comprises a small molecule antigen binding domain and the cell expresses the bispecific affinity molecule.
  • the invention includes a use of the modified T cell described herein or the modified cell described herein in the manufacture of a
  • the invention includes a method for adoptive cell transfer therapy comprising administering a population of modified T cells to a subject in need thereof to prevent or treat an immune reaction that is adverse to the subject, wherein the modified T cells comprise a nucleic acid encoding an affinity molecule chimeric receptor comprising a small molecule extracellular domain with affinity for an antigen on a target cell.
  • the invention includes a method for adoptive cell transfer therapy comprising administering a population of modified cells to a subject in need thereof to prevent or treat an immune reaction that is adverse to the subject, wherein the modified cells comprise a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell, wherein at least one affinity domain comprises a small molecule antigen binding domain.
  • the invention includes a method of treating a disease or condition associated with enhanced immunity in a subject comprising administering a population of modified cells to a subject in need thereof, wherein the modified cells comprise a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell, wherein at least one affinity domain comprises a small molecule antigen binding domain.
  • the invention includes a method of treating a condition in a subject, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising the T cell described herein or the modified cell described herein.
  • the invention includes a method for stimulating a T cell- mediated immune response to a target cell or tissue in a subject comprising administering to a subject an effective amount of a modified T cell, wherein the T cell comprises a nucleic acid encoding an affinity molecule chimeric receptor comprising a small molecule extracellular domain with affinity for an antigen on a target cell.
  • the invention includes a method for stimulating a T cell-mediated immune response to a target cell or tissue in a subject comprising administering to a subject an effective amount of a modified cell, wherein the modified cell comprises a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell, wherein at least one affinity domain comprises a small molecule antigen binding domain.
  • the invention includes a composition comprising the modified T cell described herein or the modified cell described herein.
  • the invention includes a pharmaceutical composition comprising the modified T cell described herein or the modified cell described herein and a pharmaceutically acceptable carrier.
  • the target cell antigen is selected from the group consisting of viral antigen, bacterial antigen, parasitic antigen, tumor cell associated antigen (TAA), disease cell associated antigen, and any fragment thereof.
  • the small molecule extracellular domain comprises a helical structure lacking disulfide bridges. In another embodiment, the small molecule extracellular domain is less than about 10 kD.
  • the affinity molecule chimeric receptor further comprises an intracellular signaling domain, such as a CD3 signaling domain.
  • the affinity molecule chimeric receptor further comprises a co- stimulatory signaling domain, such as a a 4- IBB co-stimulatory signaling domain.
  • the affinity molecule chimeric receptor further comprises a transmembrane domain, such as a CD8 transmembrane domain.
  • the affinity molecule chimeric receptor further comprises a TCR variable domain, and a TCR constant domain.
  • the T cell described herein further comprises a nucleic acid encoding a costimulatory molecule, such as a co-stimulatory molecule is selected from the group consisting of CD3, CD27, CD28, CD83, CD86, CD127, 4-1BB, 4-1BBL, PD1 and PD1L.
  • the CD3 comprises at least two different CD3 chains, such as the CD3 zeta and CD3 epsilon chains.
  • the affinity domain capable of binding the target cell antigen is selected from the group consisting of the small molecule antigen binding domain, and an antigen binding domain of an antibody.
  • the affinity domain capable of binding the activating T cell antigen is selected from the group consisting of the small molecule antigen binding domain, and an antigen binding domain of an antibody.
  • the small molecule antigen binding domain comprises a helical structure lacking disulfide bridges. In yet another embodiment, the small molecule antigen binding domain are each less than about 10 kD.
  • the target cell antigen is selected from the group consisting of tumor associated antigen (TAA), bacterial antigen, parasitic antigen, viral antigen, and any fragment thereof.
  • the activating T cell antigen is a co -stimulatory molecule selected from the group consisting of CD3, CD4, CD8, T cell receptor (TCR), CD27, CD28, 4- IBB (CD137), OX40, CD30, CD40, PD-1,
  • ICOS lymphocyte function-associated antigen-1
  • CD2 CD7
  • LIGHT lymphocyte function-associated antigen-1
  • NKG2C lymphocyte function-associated antigen-1
  • B7-H3 a ligand that specifically binds with CD83, and any fragment thereof.
  • the T cell described herein is used in a method of treating an immune response in a subject in need thereof. In yet another embodiment, the cell described herein is used in a method of treating an immune response in a subject in need thereof.
  • the nucleic acid is introduced by a method selected from the group consisting of transducing the population of T cells, transfecting the population of T cells, and electroporating the population of T cells.
  • the introduction of the nucleic acid comprises electroporating a R A encoding the affinity molecule chimeric receptor.
  • the nucleic acid is introduced by a method selected from the group consisting of transducing the population of cells, transfecting the population of cells, and electroporating the population of cells.
  • the introduction of the nucleic acid comprises electroporating a RNA encoding the bispecific affinity molecule.
  • the cell described herein is selected from the group consisting of a T cell, B cell, a natural killer cell, and an antigen presenting cell.
  • the T cell is obtained from the group consisting of peripheral blood mononuclear cells, cord blood cells, a purified population of T cells, and a T cell line.
  • the methods described herein further comprise electroporating a RNA encoding CD3 into the T cells.
  • the CD3 RNA is co-electroporated with the nucleic acid encoding the affinity molecule chimeric receptor.
  • the methods described herein further comprise cryopreserving the T cell after introducing the affinity molecule chimeric receptor nucleic acid.
  • the methods described herein further comprise cryopreserving the T cells.
  • the methods described herein further comprise thawing the cryopreserved T cells prior to introducing the affinity molecule chimeric receptor nucleic acid into the T cells.
  • the methods described herein further comprise expanding the T cell.
  • the expanding comprises culturing the T cell with a factor selected from the group consisting of flt3-L, IL-1, IL-2, IL-3 and c-kit ligand.
  • the expanding comprises electroporating the T cell with a factor selected from the group consisting of flt3-L, IL-1, IL-2, IL-3 and c-kit ligand.
  • the expanding comprises electroporating the T cell with
  • R A encoding a chimeric membrane protein, such as a chimeric membrane protein comprises a single chain variable fragment (scFv) against CD3 and an intracellular domain comprising a fragment of an intracellular domain of CD28 and 4-1BB, and culturing the electroporated T cell.
  • scFv single chain variable fragment
  • the methods described herein further comprise binding the activating T cell and the target cell with the bispecific affinity molecule.
  • the condition is an autoimmune disease, such as an autoimmune disease selected from the group consisting of Acquired
  • AIDS Immunodeficiency Syndrome
  • alopecia areata, ankylosing spondylitis, antiphospholipid syndrome
  • autoimmune Addison's disease autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease, cardiomyopathy, celiac sprue-dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy (CIPD), cicatricial pemphigoid, cold agglutinin disease, crest syndrome,
  • CIDS chronic fatigue immune dysfunction syndrome
  • CIPD chronic inflammatory demyelinating polyneuropathy
  • the condition is a cancer, such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • a cancer such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • the methods described herein further comprise inducing lysis of the target cell or tissue.
  • the induced lysis is antibody-dependent cell-mediated cytotoxicity (ADCC).
  • the invention includes a modified T cell comprising an electroporated RNA encoding a bispecific T-cell engager (BiTE) molecule, wherein the BiTE molecule comprises bispecificity for an antigen on a target cell and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and TCR.
  • BiTE bispecific T-cell engager
  • the invention includes a method for generating a modified T cell comprising expanding a population of T cells, and electroporating the expanded T cells with RNA encoding a bispecific antibody, wherein the electroporated T cells are capable of expressing the bispecific antibody.
  • the invention includes a method for stimulating a T cell-mediated immune response to a target cell or tissue in a subject comprising administering to a subject an effective amount of a modified T cell comprising an electroporated RNA encoding a bispecific T-cell engager (BiTE) molecule comprising bispecificity for an antigen on a target cell and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and TCR.
  • a modified T cell comprising an electroporated RNA encoding a bispecific T-cell engager (BiTE) molecule comprising bispecificity for an antigen on a target cell and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and TCR.
  • BiTE bispecific T-cell engager
  • the invention includes a method for adoptive cell transfer therapy comprising administering a population of modified T cells to a subject in need thereof to prevent or treat an immune reaction adverse to the subject, wherein the modified T cells have been expanded and electroporated with RNA encoding a bispecific T-cell engager (BiTE) molecule comprising bispecificity for an antigen on a target cell, and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and TCR.
  • BiTE bispecific T-cell engager
  • the invention includes a method of treating a disease or condition associated with enhanced immunity in a subject comprising administering a population of modified T cells to a subject in need thereof, wherein the modified T cells have been expanded and electroporated with RNA encoding a bispecific T-cell engager (BiTE) molecule comprising bispecificity for an antigen on a target cell, and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and TCR.
  • BiTE bispecific T-cell engager
  • the invention includes a method of treating a condition in a subject, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising the modified T cell described herein.
  • the invention includes a use of the modified T cell of claim 145 in the manufacture of a medicament for the treatment of an immune response in a subject in need thereof.
  • the invention includes a composition comprising the modified T cell described herein. In yet another aspect, the invention includes a pharmaceutical composition comprising the modified T cell described herein and a pharmaceutically acceptable carrier.
  • the target cell antigen is selected from the group consisting of a viral antigen, bacterial antigen, parasitic antigen, tumor cell associated antigen (TAA), disease cell associated antigen, and any fragment thereof.
  • the bispecific antibody comprises a bispecific antigen binding domain selected from the group consisting of a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof.
  • a bispecific antigen binding domain selected from the group consisting of a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof.
  • the bispecific antigen binding domain comprises a first and a second single chain variable fragment (scFv) molecules, such as the first scFv molecule is specific for at least one antigen on a target cell and the second scFv molecule is specific for an antigen on an activating T cell.
  • scFv single chain variable fragment
  • the T cell is obtained from the group consisting of peripheral blood mononuclear cells, cord blood cells, a purified population of T cells, and a T cell line.
  • the RNA comprises in vitro transcribed RNA or synthetic RNA.
  • the expanding comprises culturing the T cell with a factor selected from the group consisting of flt3-L, IL-1, IL-2, IL-3 and c-kit ligand.
  • the expansion comprises electroporating the T cells with RNA encoding a chimeric membrane protein, such as a chimeric membrane protein comprises a single chain variable fragment (scFv) against CD3 and an intracellular domain comprising a fragment of an intracellular domain of CD28 and 4-1BB, and culturing the electroporated T cells.
  • scFv single chain variable fragment
  • the methods described herein further comprise cryopreserving the expanded T cells. In yet another embodiment, the methods described herein further comprise thawing the cryopreserved T cells for electroporation with the
  • RNA encoding the bispecific antibody further comprise expressing the bispecific antibody as a membrane protein. In yet another embodiment, the methods described herein further comprise cryopreserving the bispecific antibody electroporated T cells.
  • the methods described herein further comprise inducing lysis of the target cell or a tissue comprising the target cell.
  • the induced lysis is antibody-dependent cell-mediated cytotoxicity (ADCC).
  • the condition is an autoimmune disease, such as an autoimmune disease selected from the group consisting of Acquired
  • Immunodeficiency Syndrome (AIDS), alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease, cardiomyopathy, celiac sprue-dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy (CIPD), cicatricial pemphigoid, cold agglutinin disease, crest syndrome, Crohn's disease, Degos' disease, dermatomyositis-juvenile, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia-fibromyositis, Graves' disease, Guillain-Barre syndrome, Hashimoto's thyroid
  • the condition is a cancer, such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • a cancer such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • the invention includes a modified T cell comprising an exogenous nucleic acid encoding a T cell receptor (TCR) comprising affinity for a surface antigen on a target cell; and a nucleic acid encoding a costimulatory molecule, wherein the T cell expresses the TCR and the co-stimulatory molecule.
  • TCR T cell receptor
  • the invention includes a method for generating a modified T cell comprising introducing a nucleic acid encoding a T cell receptor (TCR) comprising affinity for a surface antigen on a target cell into a T cell, and introducing a nucleic acid encoding a co-stimulatory molecule into the T cell, wherein the T cell is capable of expressing the TCR and the co -stimulatory molecule
  • TCR T cell receptor
  • the invention includes a use of the modified T cell of claim 173 in the manufacture of a medicament for the treatment of an immune response in a subject in need thereof.
  • the invention includes a method for stimulating a T cell-mediated immune response to a target cell or tissue in a subject comprising administering to a subject an effective amount of a modified T cell, wherein the T cell has been expanded and electroporated with a RNA encoding a modified T cell receptor
  • TCR TCR comprising affinity for a surface antigen on a target cell.
  • the invention includes a method for adoptive cell transfer therapy comprising administering a population of modified T cells to a subject in need thereof to prevent or treat an immune reaction that is adverse to the subject, wherein the modified T cells have been expanded and electroporated with RNA encoding a modified T cell receptor (TCR) comprising affinity for a surface antigen on a target cell.
  • TCR modified T cell receptor
  • the invention includes a method of treating a disease or condition associated with enhanced immunity in a subject comprising administering a population of modified T cells to a subject in need thereof, wherein the modified T cells have been expanded and electroporated with RNA encoding a modified T cell receptor (TCR) comprising affinity for a surface antigen on a target cell.
  • TCR modified T cell receptor
  • the invention includes a method of treating a condition in a subject, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising the modified T cell described herein.
  • the invention includes a composition comprising the modified T cell described herein. In yet another aspect, the invention includes a pharmaceutical composition comprising the modified T cell described herein and a pharmaceutically acceptable carrier.
  • the TCR comprises at least one disulfide bond.
  • the TCR comprises at least one murine constant region.
  • the TCR has higher affinity for the target cell antigen than a for a wildtype TCR.
  • the TCR comprises TCR alpha and beta chains.
  • the TCR comprises a co-stimulatory signaling domain, such as a 4- IBB co- stimulatory signaling domain, at a C terminal of at least one of the chains.
  • the beta chain comprises at least one N-deglycosylation.
  • the alpha chain comprises at least one N-deglycosylation.
  • the nucleic acid encoding a costimulatory molecule is electroporated into the T cell.
  • the co-stimulatory molecule is selected from the group consisting of CD3, CD27, CD28, CD83, CD86, CD127, 4-1BB, 4-1BBL, PD1 and PD1L.
  • the CD3 comprises at least two different CD3 chains.
  • the different CD3 chains are CD3 zeta and epsilon chains.
  • the target cell antigen is selected from the group consisting of viral antigen, bacterial antigen, parasitic antigen, tumor cell associated antigen (TAA), disease cell associated antigen, and any fragment thereof.
  • At least one of the nucleic acids is introduced by a method selected from the group consisting of transducing the T cell, trans fecting the T cell, and electroporating the T cell.
  • at least one of the nucleic acids comprises in vitro transcribed RNA or synthetic RNA.
  • the T cell is obtained from the group consisting of peripheral blood mononuclear cells, cord blood cells, a purified population of T cells, and a T cell line.
  • the methods described herein further comprise expanding the T cell.
  • the expanding comprises culturing the T cell with a factor selected from the group consisting of flt3-L, IL-1, IL-2, IL-3 and c-kit ligand.
  • the expanding comprises electroporating the T cells with RNA encoding a chimeric membrane protein, such as a chimeric membrane protein comprises a single chain variable fragment (scFv) against CD3 and an intracellular domain comprising a fragment of an intracellular domain of CD28 and 4-1BB, and culturing the electroporated T cells.
  • scFv single chain variable fragment
  • the methods described herein further comprise cryopreserving the T cells. In yet another embodiment, the methods described herein further comprise thawing the cryopreserved T cells prior to introducing the nucleic acid encoding the TCR into the T cells. In still another embodiment, the methods described herein further comprise cryopreserving the T cells after introducing the TCR nucleic acid.
  • the nucleic acid encoding the TCR comprises a nucleic acid encoding a TCR alpha and a TCR beta chain. In one embodiment, introducing the nucleic acid comprises co-electroporating a RNA encoding the TCR alpha chain and a separate RNA encoding the TCR beta chain. In yet another embodiment, introducing the nucleic acid encoding the co-stimulatory molecule comprises
  • the CD3 RNA is co-electroporated with the TCR nucleic acid.
  • the methods described herein further comprise inducing lysis of the target cell or tissue.
  • the induced lysis is antibody-dependent cell-mediated cytotoxicity (ADCC).
  • the condition is an autoimmune disease, such as an autoimmune disease selected from the group consisting of Acquired
  • Immunodeficiency Syndrome (AIDS), alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease, cardiomyopathy, celiac sprue-dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy (CIPD), cicatricial pemphigoid, cold agglutinin disease, crest syndrome, Crohn's disease, Degos' disease, dermatomyositis-juvenile, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia-fibromyositis, Graves' disease, Guillain-Barre syndrome, Hashimoto's thyroid
  • the condition is a cancer, such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • a cancer such as a cancer selected from the group consisting of breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, and any combination thereof.
  • FIG. 1 is panel of graphs showing transgene expression in T cells co- electroporated with TCR and BiTEs.
  • T cells were co-electroporated with CD19.CD3 (upper panel) or 4D5.CD3 (ErbB2) (middle panel) BiTEs with or without CD3zeta and epsilon.
  • Eighteen hours post electroporation T cells were stained for TCR vbl3.1 and mlgG Fab (or Her2-Fc). Lower panel shows TCR (vbl3.1) expression 3 days after electroporation.
  • Figure 2 is a panel of graphs showing CD 107a up-regulated in T cells stimulated with tumors. T cells were co-electroporated with RNA as shown and stimulated with tumor cell lines having single or double positivity for CD 19 and NY-ESO-1 (ESO). CD 107a up-regulation was assessed after 4 hours.
  • Figure 3 is a panel of graphs showing CD 107a up-regulated in T cells stimulated with tumors. T cells were co-electroporated with RNA as shown and stimulated with tumor cell lines having single or double positivity for CD 19 and NY-ESO-1 (ESO). CD 107a up-regulation was assessed after 4 hours.
  • Figure 4 is a graph showing IFN-gamma production in RNA electroporated T cells stimulated with tumor cell lines.
  • Figure 5 is a graph showing IL-2 production in RNA electroporated T cells stimulated with tumor cell lines.
  • Figure 6 is a panel of graphs showing CD 107a up-regulation in T cells expressing NY-ESO-1 TCR (1G4) and mesothelin BiTEs (ssl .CD3) and stimulated by tumor cells.
  • Figure 7 is a panel of images showing tumor growth in mice intravenously injected with Naml6-ESO-CBG cells (2xl0 6 cells). Five days after tumor cell injection, mice were treated with RNA electroporated T cells as indicated (5 mice/group). Tumor growth was imaged with bioluminescent imaging.
  • Figure 8 is a graph showing T cells expressing bispecific RNA to target tumor- associated antigens with enhanced T cell function.
  • Figure 9 is a panel of graphs showing TCR on T cells recognized both cognate and MHC/peptide and surface tumor antigens without HLA restriction by combining bispecific antibodies in the T cells.
  • Figure 10 comprising Figure 10A and 10B, shows a list of the constructs of bi- specific antibody RNAs and TCR RNAs electroporated into T cells.
  • Figure 11 is a panel of graphs showing T cells recognized both cognate antigen (HLA-A2/NY-ESO-1) and CD 19 or Her2 by a modified NY-ESO-1 TCR and bi-specific antibodies.
  • Figure 12 is a diagram illustrating engagement of an enhanced chimeric ligand engineered activation receptor (CLEAR) between a T cell and target tumor cell and a bispecific antibody on another T cell engaging the same target tumor cell.
  • CLEAR enhanced chimeric ligand engineered activation receptor
  • Figure 13 is a list of the constructs of CLEARs and bi-specific antibodies generated in the invention.
  • Figure 14 is a panel of graphs showing CD27 express in T cells or K562 cells eighteen hours after electroporation with CD27-BBZ or CD27-Z CLEARs RNA (upper panel) and CD70 expression in cells lines (lower panel).
  • Figure 15 is a panel of graphs showing CD 107a up-regulation in CD27 CLEARs RNA electroporated T cells stimulated with CD70 positive tumor cell lines.
  • Figure 16 is a panel of graphs showing PD1 expression in PD1 CLEARs RNA electroporated T cells (upper panel) and CD 107a up-regulation in the T cells after stimulation with PD-L1 positive tumor cells, Nalm6-PD-Ll .
  • Figure 17 is a graph showing cytokine production in PD1 CLEARs RNA electroporated T cells stimulated with PD-L1 positive tumor cells, Nalm6-PD-Ll .
  • Figure 18 is a panel of graphs showing transgene expression in T cells co- electroporated with PD1-Z and aPD-ameso bi-specific antibody RNA.
  • Figure 19 is a panel of graphs showing CD 107a up-regulation in PD1-Z and aPD- ameso bi-specific antibody RNA co-electroporated T cells stimulated with MESO positive tumor cells (K562-meso, SK-OV3 and PC3), or MESO/PD-L1 double positive tumor cells (PC3-PDL1).
  • MESO positive tumor cells K562-meso, SK-OV3 and PC3
  • PC3-PDL1 MESO/PD-L1 double positive tumor cells
  • Figure 20 is a panel of graphs showing cytokine production of PD1-Z and aPD- ameso bi-specific antibody RNA co-electroporated T cells stimulated with MESO positive tumor cells (K562-meso and SK-OV3).
  • Figure 21 is a panel of graphs showing transgene expression in T cells co- electroporated with CD27-Z and aCD27-aErbB2 bi-specific antibody RNAs (upper panel) or CD 19 bi-specific antibody RNA (lower panel).
  • Figure 22 is a panel of graphs showing CD 107a up-regulation in CD27-Z and aCD27-aErbB2 bi-specific antibody RNAs electroporated T cells stimulated with tumor cell lines expressing CD70 and/or ErbB2.
  • Figure 23 is a panel of graphs showing CD 107a up-regulation in CD27-Z and aCD27-aCD19 bi-specific antibody RNAs electroporated T cells stimulated with tumor cell lines expressing CD70 and/or CD 19.
  • Figure 24 is a panel of graphs showing T cells electroporated with RNA for PD1- Z and anti-PDl/anti-ErbB2 bis-specific antibodies, as indicated. Eighteen hours later, the electroporated T cells were stained for anti-PDl and anti-mlgG Fab.
  • Figure 25 is a panel of graphs showing tumor cell lines (upper panel) and ErbB2 or Pd-Ll RNA electroporated K562 cells (lower panel, 18 hrs post electroporation). Cells were stained for PD-L1 and ErbB2 expression.
  • Figure 26 is a panel of graphs showing electroporated T cells were stimulated with tumor lines for 4 hrs. CD 107a up-regulation was detected by flow cytometry.
  • Figure 27 is a panel of graphs showing electroporated T cells were stimulated with tumor lines for 4 hrs. CD 107a up-regulation was detected by flow cytometry.
  • Figure 28 is an image showing illustrations of the affinity antibody mimetic constructs.
  • Figure 29 is a panel of graphs showing expression of affinity antibody mimetic redirected T cells (ARTs) by staining with anti-His antibody.
  • ARTs affinity antibody mimetic redirected T cells
  • T cells were stained by an anti-His tag antibody for flow cytometry detection of ART expression (lower panel) and showed that T cells electroporated with all the ART RNA were stained positive, comparing with the T cells that were no electroporated (No EP).
  • Figure 30 is a panel of graphs showing specific CD 107a up-regulation of EGFR and ErbB2 ARTs. Electroporated T cells as shown in Figure 29 were stimulated with 4 different tumor cell lines that express EGFR and/or ErbB2 as indicated below the name of each tumor. After 4h incubation, CD 107a upregulation was measured by staining the cell with CD107a-PE, CD3-APC and CD8-FITC. As shown in the Figure 29, all the EGFR ARTs only strongly reactive to the tumor lines that are EGFR positive (SK-OV3,
  • Figure 31 is a graph showing specific IFN-gamma production of EGFR and
  • Electroporated T cells as shown in Figure 29 were stimulated with 4 different tumor cell lines that express EGFR and/or ErbB2 as indicated below the name of each tumor. After overnight incubation, supernatant was used to measure INF-gamma production by ELISA. As shown in the figure, IFN-gamma could be detected at different levels for all the EGFR ARTs stimulated by the tumor lines that are EGFR positive (SK-
  • FIG. 32 is a graph showing specific IL-2 production of EGFR and ErbB2 ARTs. Electroporated T cells as shown in Figure 29 were stimulated with four different tumor cell lines that express EGFR and/or ErbB2 as indicated below the name of each tumor. After overnight incubation, supernatant was used to measure IL-2 production by ELISA.
  • IL-2 could be detected at different levels for all the EGFR ARTs stimulated by the tumor lines that are EGFR positive (SK-OV3, MDA231 and MDA468), but not EGFR negative tumor MCF7. While all the ErbB2 ARTs strongly reactive to the tumor lines that are ErbB2 positive (SK-OV3, MDA231 and MCF7), but not
  • Figure 33 is a graph showing specific lytic activities of EGFR and ErbB2 ARTs.
  • ART T cells killed the tumor cells as efficiently as relevant CAR T cells.
  • Figure 34 is a panel of images showing affinity antibody mimetic modified TCR.
  • Figure 34A is a diagrammatic sketch of affinity antibody mimetic modified TCR (Affi-TCR) by adding affinity antibody mimetic and His -tag sequence to the N' of either alpha or beta chain of a TCR.
  • Figure 34B is a panel of graphs showing VM3.1 TCR and His-tag detection of affinity antibody mimetic redirected TCR ( Affi-TCR) RNA electroporated T cells.
  • T cells were co -electroporated with NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or their ErbB2 affinity antibody mimetic (342, 342.15, 342 or 342.4) modification . After overnight, vbl3.1 and His-Tag were detected by flow cytometry.
  • Figure 34C shows the ErbB2 affinity antibody mimetic sequences.
  • FIG 35 is a panel of graphs showing CD 107a up-regulation of Affi-TCR RNA electroporated T cells.
  • T cells were co-electroporated with TCR alpha (a) and beta (b), or their ErbB2 affinity antibody mimetic (342, 342.15, 342 or 342.4) modification as indicated in Figure 34B and stimulated with tumor line Nalm-6-ESO (NY-eso-1 +, ErbB2- ), A549-ESO (NY-eso-l+, ErbB2+), SK-OV3 (NY-eso-1-, ErbB2+), A549 (NY-eso-1-,
  • Figure 36 is a panel of images showing affinity antibody mimetic modified CD3 epsilon.
  • Figure 36A is a diagrammatic sketch of affinity antibody mimetic modified CD3 epsilon by adding affinity antibody mimetic and G4S linker to the N' of either CD3 epsilon.
  • Figure 36B is a table showing electroporation of T cells.
  • T cells were co-electroporated with NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or together with ErbB2 affinity antibody mimetic (342, 342.15, 342 or 342.4) modified CD3 epsilon (e).
  • Figure 36C is a panel of graphs showing the maintainenance of TCR expression and dual tageting by co-delivering affinity antibody mimetic modified CD3 epsilon. After overnight of the T cells of Figure 36B, vbl3.1 expression was detected by flow cytometry.
  • FIG 37 is a panel of graphs showing CD 107a up-regulation of Affi-TCR RNA electroporated T cells.
  • T cells were co-electroporated with NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or together with ErbB2 affinity antibody mimetic (342, 342.15, 342 or 342.4) modified CD3 epsilon (e) as indicated in Figure 36B and stimulated with tumor line Nalm-6-ESO (NY-eso-l+, ErbB2-), Nalm6 (NY-eso-1-, ErbB2-), SK-OV3 (NY-eso-
  • Figure 38 comprising Figures 38A-38C, demonstrates that bi-specifc
  • RNA encoding a bispecific antibody can be secreted by RNA encoding a bispecific antibody (Bis-RNA) electroporated into T cells.
  • T cells were electroporated with RNA encoding CD 19 CAR (CAR RNA), Blinatumomab Bis-RNA (Bis-RNA), GFP or co-electroporated with both CD 19 CAR and Blinatumomab Bis-RNA (CAR RNA/Bis-RNA).
  • the T cells were stained with a goat anti-mouse IgG Fab (mlgG Fab) to detect either the CD 19 CAR expressed on the T cells, or bi-specific antibody engaged on the T cell surface via binding to CD3 ( Figure 38 A, upper panel shows both mlgG Fab staining and GFP expression of the electroporated T cells).
  • mlgG Fab goat anti-mouse IgG Fab
  • T cells for 18 h (GFP T, 18h) or 0 h (GFP T, Oh) and then stimulated with cell lines that express CD 19 (Nalm6, K562-CD19 and Raji) or K562 cells that are CD 19 negative. The mixtures were then assessed for CD 107a staining (Figure 38B). Eighteen hours after electroporation, T cells electroporated with either CD 19 CAR RNA (CAR RNA) or Bis-RNA alone or mixed with an equal number of GFP RNA electroporated T cells (GFP-T) were analyzed for lytic activity after a four hour flow based cytotoxic T lymphocyte assay at an effector:target ratio of 5: 1 ( Figure 38C).
  • CAR RNA CD 19 CAR RNA
  • GFP-T GFP RNA electroporated T cells
  • Figure 39 highlights the increase in T cell activation and tumor killing ability of Bis-RNA electroporated T cells.
  • T cells were electroporated with a different amount ⁇ g RNA /0.1 ml T cells) of either
  • Blinatumomab Bis-RNA (Bis-RNA) or CD 19 CAR RNA (CAR RNA) as indicated.
  • the T cells with either Bis-RNA or CAR RNA were stimulated with CD 19 positive cell lines with or without adding an equal number of GFP RNA electroporated T cells (GFP-T) and assessed for CD 107a expression (Figure 39A).
  • GFP-T GFP RNA electroporated T cells
  • Figure 39A Eighteen hours after electroporation of the T cells described above, the electroporated T cells were subjected to intracellular staining of IFN-gamma and
  • RNA and CAR RNA (Bis-RNA+CAR RNA). Eighteen hours after electroporation, lytic activity was assessed with a four hour flow based cytotoxic T lymphocyte assay at the indicated effector:target ratios ( Figure 39D).
  • Figure 40 comprising Figures 40A-40D, demonstrates the prolonged tumor reactivity of Bis-RNA electroporated T cells and the sensitivity of CAR RNA T cells and
  • T cells were electroporated with different amounts of Blimatumomab Bis-RNA at 1, 5 and 10 ⁇ g/0.1 ml of T cells and compared with T cells electroporated with CD19BBZ CAR RNA at a dose of 10 ⁇ g of RNA.
  • CD 107a staining was conducted on different days after electroporartion and the results were plotted either as the dot plot for CD107a/CD8 expression at day 3, day 8 and day 12 ( Figure 40A), the value of mean fluorescence intensity (MFI) ( Figure 40B, upper panel), or the percentage of CD 107a expressing cells ( Figure 40B, lower panel) days post electroporation.
  • T cells were electroporated with different amounts of Blimatumomab Bis-RNA at 1, 5 and 10 ⁇ g/0.1 ml of T cells and compared with T cells electroporated with CD19BBZ CAR RNA at a dose of 10 ⁇ g of RNA.
  • CD 107a staining was conducted on different
  • Figure 41 comprising Figures 41A-41D, highlights the Bis-RNA electroporated T cells decreased dependence on co -stimulation and enhanced division and proliferation.
  • CFSE labeled resting CD4+ T cells were electroporated with Blinatumomab Bis-RNA or CD19BBZ RNA (CAR RNA) at different RNA doses and stimulated with either irradiated K562-CD19 cells (mixed with an equal number of irradiated K562 cells as a control for K562-CD86 cells), or irradiated K562-CD19 cells (mixed with an equal number of irradiated K562-CD86 cells).
  • Blinatumomab Bis-RNA or CD19BBZ RNA CAR RNA
  • CFSE staining at day 6 ( Figure 41 A) and the number of T cells at different days after stimulation ( Figure 4 IB) were monitored.
  • CFSE labeled CD45RO+ (memory cells) or CD45RO- (Naive cells) resting CD4 T cells were electroporated with Blinatumomab Bis-RNA or CD 19BBZ RNA (CAR RNA) at different RNA doses and stimulated with either irradiated K562- CD 19 eels (mixed with an equal number of irradiated K562 cells as a control for K562-CD86 cells), or irradiated K562-CD19 cells (mixed with an equal number of irradiated K562-CD86 cells).
  • CFSE staining at day 6 ( Figure 41C) and the number of T cells at different days after stimulation ( Figure 4 ID) were monitored
  • Figure 42 displays the enhanced anti-tumor activity of Bis-RNA T cells in a Nalm-6 xenograft model.
  • NSG NOD/scid/yc(-/-) mice
  • mice were randomized and treated with either Blinatumomab Bis-RNA or CD19BBZ RNA electroporated T cells.
  • the mice treated with anti-mesothelin RNA CAR T cells (sslBBZ) were served as a control.
  • T cells were injected intravenously either as a single injection with 25 e 6 (IX) or injected once a week for three weeks (3X) with T cells at a dosage of 20e 6 for the 1 st injection and 5e 6 for the 2 nd and 3 rd injections. Animals were imaged at the indicated time points post injection ( Figure 42 A). BLI data for the experiment are plotted with total photon flux -
  • K562-CD19 for 18 hours (CD 137 and IFN-gamma secretion) and 4 hours (CD 107a), respectively.
  • Figure 43 comprising Figures 43A-43E, illustrates different Bis-RNAs against different tumor antigens.
  • T cells were electroporated with one of seven different constructs for Bis-RNA encoding a fully human CD19-CD3 using single chain variable fragments (scFvs) from fully human anti-CD 19 (21D4) antibody and a fully human anti- CD3 scFv (28F11) antibody, respectively.
  • CD 107a up-regulation was monitored by flow cytometery after the electroporated T cells were stimulated by the CD 19 positive cell line, K562-CD19, for 4 hours (Figure 43 A).
  • IFN-gamma production was detected by ELISA after the electroporated T cells were stimulated by the CD 19 positive cell lines,
  • FIG. 43B shows the detection of scFv on T cells electroporated with Bis-RNA or CAR RNA against mesothelin, cMet, PSCA and GD2 using anti-mouse IgG Fab antibody (for scFv against mesothelin and GD2) or anti-human IgG Fab (for cMet and PSCA).
  • T cells electroporated with Bis-RNA or CAR RNA against mesothelin, cMet, PSCA and GD2 Bis-RNA or CAR RNA (CAR) were stimulated with cell lines expressing mesothelin (K562-meso, SK-OV3)), PSCA (K562-PSCA), cMet (SK-OV3) or GD2 (LY5Y) for 4 hours and CD 107a up-regulation was monitored by flow cytomtry ( Figure 43D).
  • the mice treated with T cells electroporated with sslBBZ CAR RNA served as controls.
  • the mice injected with RNA electroporated T cells were
  • CD19BBZ RNA, or CD 19- CD3 Bis-RNA and 5 ug or 10 ug of PD1 RNA were stimulated with CD 19 positive cell lines, K652- CD 19 or Raji.
  • CD 107a expression was measured by flow cytometry ( Figure 44A) and IFN-gamma production production was detected by ELISA ( Figure 44B).
  • Tregs purified from fresh resting CD4 T cells were added to CFSE labeled Blinatumomab Bis-RNA or CD19BBZ RNA (19BBZ) electroporated resting CD4+ T cells at different T effector:Treg ratios and stimulated with K562-CD19 cells. Six days after the stimulation, the cells were stained with anti-
  • Figure 45 shows the expression of T cells pulsed with supernatant from Bis-RNA electroporated T cells.
  • T cells were electroporated with CD19BBZ RNA (CAR RNA) or Bis- RNA for Blinatumomab (Blina-Bis-RNA) or D4F11 RNA (D4F11 -Bis-RNA).
  • CAR RNA CD19BBZ RNA
  • Blina-Bis-RNA Bis- RNA for Blinatumomab
  • D4F11 -Bis-RNA D4F11 RNA
  • FIG 46 is a graph showing Bis-RNA electroporated T cells have significantly enhanced lytic activity.
  • T cells were electroporated with either Blinatumomab Bis-RNA (Bis-RNA) or CD19bbz CAR RNA at RNA doses of 1, 5 or ⁇ . ⁇ ml of T cells. After 18 hours, lytic activity was measured using a four hour flow based cytotoxic T lymphocyte assay at a 30: 1 T effector :target ratio.
  • Bis-RNA Blinatumomab Bis-RNA
  • CD19bbz CAR RNA CD19bbz CAR RNA
  • Figure 47 is a panel of graphs showing CD 107a upregulation in Bis-RNA electroporated T cells.
  • T cells were electroporated with either 10 ⁇ g 4D5BBZ or 4D5- CD3 RNA and stimulated with a K562 cell line electroporated with decreasing amounts of ErbB2 (Her2) mRNA as indicated by co-culturing them for 4 hours.
  • CD 107a upregulation was detected by flow cytometry.
  • Figure 48 comprising Figures 48A-48H, show Bis-RNA electroporated T cells.
  • Figure 48A is a panel of graphs showing CFSE labeling of resting CD4+ T cells that were electroporated with Blinatumomab Bis-RNA or CD19BBZ RNA (CAR RNA) at different RNA doses and stimulated with either irradiated K562-CD19 cells (mixed with an equal number of irradiated K562 cells as a control for K562-CD86 cells)(W/0 CD86), or irradiated K562-CD19 cells (mixed with an equal number of irradiated K562-CD86 cells) (W/ CD86).
  • CFSE dilution at day 6 was shown.
  • MFI mean fluorescence intensity
  • Figure 48B is a graph showing CFSE labeling of resting CD4+ T cells that were electroporated with Blinatumomab Bis-RNA or CD19BBZ RNA (CAR RNA) at different RNA doses and stimulated with either irradiated K562-CD19 cells (mixed with an equal number of irradiated K562 cells as a control for K562-CD86 cells)(K562-CD 19/K562), or irradiated
  • K562-CD19 cells mixed with an equal number of irradiated K562-CD86 cells
  • K562- CD19/K562-CD86 Relative CFSE dilution starting at day 3 was shown (T cells electroporated with 1 ⁇ g Bis-RNA and stimulated with K562-CD19/K562 cells at day 6 was set as 50%).
  • Figure 48C is a panel of graphs showing CFSE labeling of CD45RO+ (memory cells) or CD45RO- (Naive cells) resting CD4 T cells that were electroporated with Blinatumomab Bis-RNA or CD19BBZ RNA (CAR RNA) at different RNA doses and stimulated with either irradiated K562-CD19 cells (mixed with an equal number of irradiated K562 cells as a control for K562-CD86 cells)(K562-CD19/K562), or irradiated K562-CD19 cells (mixed with an equal number of irradiated K562-CD86 cells) (K562- CD 19/K562-CD86).
  • CFSE dilution starting at day 3 was shown as MFI of CFSE or
  • FIG. 48D is a panel of graphs showing CFSE labeling of resting CD4+ T cells that were electroporated with Blinatumomab Bis-RNA or CD19BBZ RNA (CAR RNA) at different RNA doses and stimulated with either irradiated K562-CD19 cells (mixed with an equal number of irradiated K562 cells as a control for K562-CD86 cells)(K19/K562), or irradiated K562- CD19 cells (mixed with an equal number of irradiated K562-CD86 cells) (K19/K86).
  • CAR RNA CD19BBZ RNA
  • Figure 48E is a graph showing CFSE labeling of CD45RO+ (memory cells) or CD45RO- (Naive cells) resting CD4 T cells that were electroporated with Blinatumomab Bis-RNA or CD19BBZ RNA (CAR RNA) at different RNA doses and stimulated with Raji (CD 19+) or K562 (Cdl9-) cells for 18 hours.
  • IL-2 secretion was assayed by ELISA.
  • Figure 48F is a graph showing T cells that were CFSE labeled and electroporated with either 1 or 5 ⁇ g CD19BBZ (19BBZ), or CD19-28Z (19-28Z) or Blinatumomab (Blina) RNA were stimulated irradiated K562, or 1 : 1 mixture of K562 with K562-CD19 or 1 : 1 mixture of K562-CD19 and K562-CD86.
  • the T cells were subjected to flow cytometry analysis for CFSE dilution.
  • Figure 48G is a graph showing total viability at day 6 of 5x10 5 T cells that were electroporated with 5 ⁇ g CD19BBZ (19BBZ), or CD19-28Z (19-28Z) or Blinatumomab
  • FIG. 48H is a graph showing T cells that were electroporated with 5 ⁇ g CD19BBZ (19BBZ), or CD19-28Z (19-28Z) or Blinatumomab (Blina) RNA and analyzed in a flow based 4 hour cytotoxic T lymphocyte assay.
  • Figure 49 shows the level of expression of T cells electroporated with various constructs of Bis-RNA.
  • Figure 49A is a graph showing T cells electroporated with one of seven different Bis-RNA constructs encoding a fully human CD19-CD3 using scFvs from fully human anti-CD 19 antibody (21D4) and a fully human anti-CD3 scFv antibody (28F11), respectively.
  • IL-2 production was detected by ELISA after the electroporated T cells were stimulated with CD 19 positive cell lines, Nalm6, K562-CD19 and Raji, for 18 hours.
  • Figure 49B is a graph showing T cells electroporated with CD 19BBZ RNA (CAR RNA) or Blinatumomab Bis-RNA (Blina-
  • the T cells were stimulated with K562-CD19 for 18 hours and the supernatant was subjected to Luminex for multiple cytokine/chemokine detection.
  • Figure 49C is a graph showing T cells electroporated with either CD19BBZ, Blinatumomab Bis- RNA,
  • FIG. 49D is a graph showing T cells electroporated with either CD19BBZ, Blinatumomab Bis- RNA, D4BBZ or D4F11 Bis-RNA at RNA doses of 1, 5 or 10 ug.
  • the cells were stimulated with CD 19 positive cell lines, K562-CD19, Raji or Nalm6, and a CD 19 negative line K562-meso as a control.
  • CD 107a expression was detected by flow cytometry.
  • Figure 49E is a graph showing CD 107a upregulation of T cells electroporated with RNA encoding EGFRviii CAR (MR1-BBZ or 139-BBZ) or EGFRviii Bis-RNA (MR1 -Bis-RNA or 139-Bis- RNA) and stimulated with EGFRviii RNA electroporated K562 cells or K562 cells.
  • Figure 49F is a graph showing CD 107a upregulation of T cells electroporated with RNA encoding a CD 19 CAR (CD19BBZ) or ErBB2 CAR (4D5-BBZ) or ErBB2 Bis- RNA (4D5-OKT3).
  • the upper panel shows the staining of T cells with a ErBB2 fusion protein (Her2-Fc) 18 hours post electroporation.
  • the lower panel shows CD 107a staining of T cells stimulated with either a ErBB2 positive/CD19 negative tumor cell line, (SK-OV3) or CD 19 positive/ErBB2 negative tumor cell line (Nalm6).
  • Figure 49G is a panel of graphs showing ErBB2 fusion protein (Her2-Fc) expression.
  • Figure 49H is a panel of graphs showing CD 107a expression in CD8+ cells.
  • Figure 50 is a graph showing T cells that were co-electroporated with different amounts of CD19BBZ RNA, or CD19-CD3 Bis-RNA and 5 ug or 10 ug of PDl RNA.
  • the cells were stimulated with a CD 19 positive cell line Raji, and IFN-gamma secretion was detected by ELISA. Data was plotted as a percentage of cytokine production of T cells relative to cells without co-introducion of PDl .
  • Figure 51 is a panel of graphs characterizing co- electroporated T cells.
  • Figure 51 A is a panel of flow graphs showing the increase of T cell activation and tumor killing ability of Bis-RNA electroporated T cells. T cells were electroporated with different amounts ⁇ g RNA /0.1 ml T cells) of either
  • Figure 5 IB is a panel of graphs showing IFN-gamma and Granzyme B expression after Bis-RNA electroporation. Eighteen hours after electroporation of the T cells described above, the electroporated T cells were subjected to intracellular staining of IFN-gamma and Granzyme B ( Figure 2B).
  • Figure 51C is a graph showing ELISA detection of IFN- gamma.
  • ELISA for IFN-gamma was performed after overnight stimulation of the T cells with CD 19 positive cells (Nalm6, K562-CD19 and Raji) or CD 19 negative (K562) cell lines.
  • Figure 5 ID is a graph showing specificity of T cells after electroporation and expression of Bis-RNA. T cells were electroporated with either
  • Blinatumomab Bis-RNA Bis-RNA
  • CD19bbz CAR RNA CAR RNA at RNA doses of 1, 5 or 10 ⁇ g/0.1 ml of T cells, or co-electroporated with 5 ⁇ g of each Bis- RNA and CAR RNA (Bis-RNA+CAR RNA).
  • Figure 52 is a table listing the soluble fusion-proteins RNAs electroporated into
  • Figure 53 is an illustration showing construction of bi-specific antibodies using anti-PD-Ll and anti-CD28 scFvs.
  • Figure 54 is a panel of graphs showing cytokine production in electroporated T cells.
  • Figure 54A is a graph showing IL-2 production by T cells electroporated with the different RNAs and activated by incubation with tumor cells.
  • Figure 54B is a graph showing IFN-gamma production by T cells electroporated with the different RNAs and activated by incubation with tumor cells.
  • Figure 55 is an illustration showing construction of bi-specific antibodies using anti-TGFb receptor II and anti-CD28 scFvs.
  • Figure 56 is a panel of graphs showing reactivity of electroporated T cells.
  • Figure 56A is a graph showing T cells electroporated with
  • 4D5-CD3 Bis-RNA were reactive to ErbB2 over expressing tumor cells.
  • T cells electroporated with ErbB2 CARs or Bis-RNA were stimulated with tumor lines expressing high levels of ErbB2, SK-OV3 and N87, or low levels, MFC-7, MDA-231, PC3 and A549.
  • a CD 107a assay showed that T cells expressing 4D5-6.CD3 were only reactive to ErbB2 over expressing tumor cells.
  • Figure 56B is a panel of graphs showing results of a repeat of the experiment of Figure 56 A.
  • Figure 57 is a panel of graphs showing lytic activity of T cells electroporated with 4D5-CD3 Bis-RNA to ErbB2 over expressing tumor cells.
  • T cells electroporated with ErbB2 CARs or Bis-RNA were tested for their lytic activity against ErbB2 over- expressing tumor cells, SK-OV3-CBG, or ErbB2 low expressing tumor cells, mel624
  • the luciferase based CTL assay showed that, like affinity tuned BebB2 CAR, 4D5-5.BBZ and 4D5-3.BBZ, T cells expressing 4D5-6.CD3 were only reactive to ErbB2 over expressing tumor cells, SK-OV3.
  • Figure 58 is a panel of graphs showing T cells lenti-virally transduced with 4D5-CD3 Bis-RNA were reactive to ErbB2 over expressing tumor cells.
  • T cells transduced with ErbB2 CARs or Bis-RNA were stimulated with tumor lines expressing high levels of ErbB2, SK-OV3 and N87, or low levels, MDA-231, PC3 and A549.
  • a CD 107a assay showed that T cells expressing 4D5-CD3 were only reactive to ErbB2 over expressing tumor cells.
  • Figure 59 is a panel of graphs showing T cells lenti-virally transduced with 4D5-CD3 Bis-R A were reactive to ErbB2 over expressing tumor cells.
  • T cells transduced with ErbB2 CARs or Bis-RNA as indicated were stimulated with tumor lines expressing high levels of ErbB2, SK-OV3 and N87, or low levels, MDA-231, PC3 and A549. Cytokine production as assayed by ELISA indicates T cells expressing
  • T4D5-CD3 were only reactive to ErbB2 over expressing tumor cells.
  • Figure 60 is a panel of images showing regression of advanced vascularized tumors in T cell treated mice.
  • Figure 60A is a panel of images showing affinity -tuned ErbB2 BiTE cells increase the therapeutic index and induce regression of advanced vascularized tumors in mice.
  • FIG. 60B is a graph showing SK-OV3 tumor size in dual-tumor grafted NSG mice model. Tumor sizes were measured, and the tumor volume was calculated and plotted.
  • Figure 60C is a graph showing PC3 tumor sizes in dual-tumor grafted NSG mice model. Tumor sizes were measured, and the tumor volume was calculated and plotted.
  • Figure 61 is a panel of images showing the PD1- CD28 switch receptors.
  • Figure 61 A is an illustration of constructs for co-expressing PD1-CD28 switch receptor and affinity tuned T4D5-6.CD3 BiTEs.
  • Figure 61B is a panel of graphs showing detection of PD1-CD28 switch receptor of T cells lentivirally transduced with PD1-CD28 and T4D5-CD3 co-expression vectors.
  • Figure 62 is a panel of images.
  • Figure 62A is a graph showing increased lytic activity of T cells co-expressing both PD1-CD28 switch receptor and T4D5-6.CD3 affinity tuned BiTEs.
  • Figures 62B-62G are a panel of images showing Bis-RNA electroporated T cells generated by rapid expansion protocol (REP) further improved in vivo anti-leukemia activity. The phenotype of T cells expanded by REP or anti-CD3/anti-CD28 beads (Beads) was assessed ( Figure 62B).
  • REP rapid expansion protocol
  • Beads anti-CD3/anti-CD28 beads
  • REP T cells or anti-CD3/anti-CD28 bead T cells were electroporated with different amounts of CAR RNA or Bis-RNA and stimulated with different cell lines for 18 hr.
  • CD 137 up-regulation was analyzed by flow cytometry (gated on CD3+ T cells) ( Figure 62C). Lytic activity was measured in REP T cells ( Figure 62D, left panel) or anti- CD3/anti-CD28 beads T cells ( Figure 62D, right panel) electroporated with different amounts of CAR RNA or Blinatumomab Bis-RNA.
  • mice were injected with lxl 0 6 Nalm6-CBG intravenously and 5 days later treated with 30xl0 6 CAR RNA or Blinatumomab Bis-RNA (Blina) T cells for the first treatment, followed by 5xl0 6 each, twice a week for three weeks starting day at 8 after Nalm6-CBG injection.
  • Blina Blinatumomab Bis-RNA
  • Figures 62H-62I are a panel of images showing the generation of K562 based artificial antigen presenting cells (aAPC) expressing membrane bound OKT3.
  • aAPC artificial antigen presenting cells
  • pLENS Lentiviral vectors (pLENS) expressing chimeric protein for membrane forms of OKT3 with either CD8 hinge and transmembrane (OKT3.8) or with CD8 hinge and CD28 transmembrane (OKT3.8.28) are illustrated in Figure 62H.
  • FIG. 62 CD86-CD137L (KT) or K562-CD137L (2D11) cell lines were transduced with lentiviral OKT3.8 or OKT3.8.28 and the expression of the membrane bound OKT3 was detected using an antibody against murine IgG Fab ( Figure 621).
  • Figure 62 J is a panel of images showing characterization of membrane bound OKT3 transduced K562 aAPC clones. Selection of the clones by limiting dilution was based on expression of membrane band OKT3 from OKT3.8.28 transduced KT aAPC.
  • Figure 62K-62M are a panel of graphs showing REP with K562 based artificial aAPC.
  • Figure 62K is a graph showing OKT3 loaded K562-CD86-CD137L (KT) or K562-CD137L (2D11), or KT expressing membrane bound OKT3 (KT.OKT) were irradiated and cultured for one day (Dl) or two days (D2) before being used to stimulated T cells at T cell: aAPC ratio of 1 :250.
  • Figure 62L is a panel of graphs showing the expanded T cells, independently expanded in the REP, stained for CD62L and CD28.
  • Figure 62M is a graph showing different B cell lines in a REP experiment, as compared with KT cells.
  • Figure 63 is a graph showing NSG mice with established leukemia by intravenous injection of lxlO 6 Naml6-CBG cells. Seven days later, the mice were treated with 20xl0 6
  • Figure 65 is a graph showing TCR RNA electroporated T cells controlled tumor growth better than lenti-transduced T cells.
  • 2.5xl0 6 A549-ESO/A2 tumor cells were injected intravenously at day 0. Treatment started at day 5.
  • Lenti-T cells were administered in a single dose of lOxlO 6 at day 5 and RNA electroporated T cells were injected four doses of 30xl0 6 , lOxlO 6 , lOxlO 6 , and lOxlO 6 starting at day 5, twice a week.
  • Figure 66 is a panel of images showing TCR RNA electroporated T cells controlled tumor cell growth.
  • Figure 67 is a panel of images showing that lenti-transduced T cells did not control tumor growth as efficiently as TCR RNA electroporated T cells.
  • Figure 68 is a graph showing that controlled tumor growth in a tumor model more efficiently than lenti-transduced T cells.
  • Figure 69 is a panel of images showing an illustration of a CD3 construct and graphs showing TCR and CD3 expression in TCR and CD3 RNA electroporated T cells.
  • Figure 70 is a graph showing expression levels of TCR (vbl3.1), CD3 and TCR
  • Figure 71 is a panel of graphs expression of electroporated TCR RNA in T cells.
  • Figure 72 is a table showing titer of the lenti-viral vector for 1G4 wildtype (lG4wt) and high affinity (lG4.LY95a) NY-ESO-1 TCR.
  • Figure 73 is a table showing titer of the different lenti-viral vectors for 1G4 wildtype (lG4wt) and high affinity (lG4.LY95a) NY-ESO-1 TCR.
  • Figure 74 is a table showing viral infection efficiency of T cells.
  • Figure 75 is panel of graphs showing transgene expression in T cells co- electroporated with TCR and CD3.
  • Figure 76 is panel of graphs showing transgene expression in T cells
  • Figure 77 is panel of graphs showing transgene expression in T cells co- electroporated with TCR and CD3 or T cells electroporated with TCR and stimulated with CD3 beads.
  • Figure 78 is a panel of flow diagrams showing T cells electroporated with TCR RNA (y-axis) with or without CD3 and incubated with Naml6 tumor cells (x-axis).
  • Figure 79 is a panel of flow diagrams showing T cells electroporated with TCR RNA (y-axis) with or without CD3 and incubated with OKT expressing Naml6 tumor cells (x-axis).
  • Figure 80 is a panel of flow diagrams showing T cells electroporated with TCR RNA (y-axis) with or without CD3 and incubated with ND340 expressing Naml6 tumor cells (x-axis).
  • Figure 81 is a panel of flow graphs showing TCR and CD3 expression in T cells electroporated with CD3 delta, gamma, epsilon and zeta, either with all the units (4 subunits), or less (3 subunits, 2 subunits, or 1 subunit), together with NY-ESO- 1 TCR (1G4) alpha and beta chain RNA.
  • CD3 and TCR (vbl3.1) were detected by flow cytometry 18 hours post electroporation.
  • Figure 82 is a bar graph showing the mean fluorescence intensity (MFI) of CD3 and TCR expression after CD3 RNA electroporated into 293 cell lines.
  • Figure 83 is a panel of flow graphs showing CD 107a up-regulation in TCR RNA and CD3 RNA co-electroporated T cells stimulated with tumor cells.
  • Figure 84 is a panel of graphs showing IFN-gamma expression in RNA
  • T cells incubated with different tumor cell lines. T cells were
  • NY-ESO- 1 TCR alpha and beta RNA together with different combinations of CD3 RNA.
  • the cells were co-cultured with Naml6-ESO or 624mel tumor cells that are NY-ESO- 1/HLA-A2 positive. IFN-gamma production levels were measured after 18 hours.
  • Figure 85 is a graph showing IFN-gamma expression of different RNAs electroporated T cells incubated with tumor cell lines.
  • Figure 86 is a panel of graphs showing IL-2 expression in RNA electroporated T cells incubated with different tumor cell lines.
  • T cells were electroporated with NY-ESO- 1 TCR alpha and beta RNA together with different combinations of CD3 RNA.
  • the cells were co-cultured with Naml6-ESO or 624mel tumor cells that are NY-ESO-1/HLA-A2 positive. IL-2 production levels were measured after 18 hours.
  • Figure 87 is a panel of graphs showing that the TCR was expressed by T cells electroporated with 4- IBB containing TCR or CD3 RNA constructs.
  • T cells were co- electroporated with 1G4 TCR alpha (or alpha.BB) and beta (alpha/beta or alpha.BB/beta), or alpha/beta with CD3 zeta or epsilon with or without 4- IBB (zeta, zeta.BB, epsilon, or epsilon.BB).
  • Figure 88 is a panel of graphs showing RNA electroporated T cells incubated with different tumor cell lines were affective against multiple tumor cell lines.
  • Providing co- stimulatory signals to the C terminal of either the TCR or CD3 maintained T cell function and potentially provided T cells with a direct co-stimulatory signal.
  • T cells were stimulated by tumor cell lines, Naml6- ESO(HLA-A2+/NY-ESO-l+), A549ENA(HLA-A2+/NY-ESO-l+), 624mel(HLA- A2+/NY-ESO-1+), 526mel(HLA-A2+/NY-ESO-l+), or 888mel(HLA-A2+/NY-ESO-l+) and CD 107a production was measured.
  • Figure 89 is a panel of flow diagrams showing Naml6 tumor cells (x-axis) and T cells electroporated with RNA encoding different TCR chains (y-axis) with or without CD3 chains.
  • Figure 90 is a panel of flow diagrams showing 624 tumor cells (x-axis) and T cells electroporated with RNA encoding different TCR chains (y-axis) with or without CD3 chains.
  • Figure 91 is a panel of flow diagrams showing 526 tumor cells (x-axis) and T cells electroporated with RNA encoding different TCR chains (y-axis) with or without CD3 chains.
  • Figure 92 is a panel of flow diagrams showing 888 tumor cells (x-axis) and T cells electroporated with RNA encoding different TCR chains (y-axis) with or without CD3 chains.
  • Figure 93 is a panel of graphs that show the maximum transgene expression (Figure 93 A) achieved and function of electroporated T cells using TCR with a disulfide bond and beta chain having both a disulfide bond and N- deglycosylation. N-deglycosylation of the TCR alpha chain impaired the function of electroporated T cells ( Figures 93A-93D).
  • WtlG4 wildtype 1G4 TCR
  • mlG4 second disulfide bond alpha/second disulfide bond alpha and N-deglycosylation beta
  • CD 19 CD19BBZ CAR
  • meso sslBBZ CAR
  • saline saline.
  • Figure 95 is a panel of images showing N-deglycosylation in the TCR alpha chain impaired function of RNA electroporated T cells.
  • Figure 96 is a panel of images showing transgene expression and functionality of
  • T cells electroporated with RNA encoding hybrid TCR containing murine constant regions T cells electroporated with RNA encoding hybrid TCR containing murine constant regions.
  • Figure 97 is a panel of images showing fluorescence of injected tumor and hybrid
  • Figure 98 is a panel of images showing the addition of disulfide bonds to the alpha and beta chains, or N-deglycosylation of the beta chain of the TCR enhanced transgene expression and function of electroporated T cells as compared to adding disulfide bonds to the TCR or hybrid TCRs.
  • Figure 99 is a panel of images showing TCR expressed by T cells electroporated with 4- IBB containing TCR or CD3. T cells were co -electroporated with 1G4 TCR alpha
  • Figure 100 is a panel of images showing T cells co -electroporated with 1G4 TCR alpha (or alpha.BB) and beta (a/b or a.BB/b), or a/b with CD3 zeta or epsilon with or without 4-1BB (z , z.BB, e or e.BB).
  • the T cells were stimulated with tumor lines, Nalm6-ESO (HLA-A2+/NY-ESO-1+), A549-ESO(HLA-A2+/NY- ESO-1+), 624mel (HLA-A2+/NY-ESO-1+), 526mel (HLA-A2+/NY-ESO-1-), or 888mel (HLA-A2-/NY-ESO-1-) and assessed in a CD 107a assay.
  • Nalm6-ESO HLA-A2+/NY-ESO-1+
  • 624mel HLA-A2+/NY-ESO-1+
  • 526mel HLA-A2+/NY-ESO-1-
  • 888mel HLA-A2-/NY-ESO-1-
  • Figure 101 is a panel of images showing T cells co-electroporated with 1G4 TCR alpha and beta, or a/b with CD3 epsilon (E) and/or zeta (Z) with or without CD27 (or CD28). Eighteen hours later, the T cells were stimulated with tumor lines, Nalm6-ESO (HLA-A2+/NY-ESO-1+), 624mel (HLA-A2+/NY-ESO-1+), U266 (HLA-A2+/NY-ESO- 1+), or 888mel (HLA-A2-/NY-ESO-1-) and assessed in a CD107a assay.
  • Nalm6-ESO HLA-A2+/NY-ESO-1+
  • 624mel HLA-A2+/NY-ESO-1+
  • U266 HLA-A2+/NY-ESO- 1+
  • 888mel HLA-A2-/NY-ESO-1-
  • Figure 102 is a panel of images showing the PD1 constructs and detection of PD1 and vbl3.1 in T cells lentivirally transduced with PD1-CD28 switch receptor and 1G4 TCR with or without CD27.
  • Figure 103 is a graph showing 5E6 A549-ESO (HLA-A2 and NY-ESO-1 transduced A549) were injected subcutaneously at day 0. lxlO 6 transduced T cells were injected at day 14 and the tumor size was measured. The preliminary results indicated no effect for TCR alone (1G4), while tumor growth was delayed for CD27 co-stimulatory signal (1G4.CD27), or PD1-CD28 switch receptor (PD1-CD28.1G4), or both CD27 co- stimulatory signal and PD1-CD28 switch receptor (PD1-CD28.1G4.CD27).
  • CD27 co-stimulatory signal (1G4.CD27
  • PD1-CD28.1G4 PD1-CD28 switch receptor
  • PD1-CD28.1G4.CD27 both CD27 co- stimulatory signal and PD1-CD28 switch receptor
  • Figure 104 is a schematic drawing of a modified TCR capable of non-MHC restricted tumor antigen recognition with functional cognate antigen recognition.
  • Figure 105 is a panel of images showing transgene expression of co- electroporated T cells.
  • Seven amino acid flu (HAl) peptide sequence was added to the N' -terminus of either the TCR alpha chain or CD3 zeta or epsilon chains to generate HAl .alpha (HAl .a), HAl .zeta (HAl .z) and HAl .epsilon (HAl .e).
  • T cells were co- electroporated with the modified TCR along with RNA encoding a bi-specific antibody against Flu, HAl (17-9 or 26-9), and tumor antigen (CD19 or Her2 (4D5)).
  • Eighteen hours post electroporation transgeneic TCR (vbl3.1) expression was examined by flow cytometry.
  • Figure 106 is a panel of images showing the T cells with a modified NY-ESO-1
  • TCR recognized cognate antigen HLA-A2/NY-ESO-1 along with CD 19 or Her2.
  • Figure 107 is a graph showing IFN-gamma secretion of T cells transferred with modified TCR co-introduced with bis-RNA.
  • Figure 108 is a graph showing IL-2 secretion of T cells transferred with modified TCR co-introduced with bis-RNA.
  • Figure 109 is a panel of images showing anti-tumor activity of T cells with modified TCR and bis-RNA administered to tumor bearing mice. Mice were injected with Nalm6-ESO (i.v.) and treated with T cells electroporated with RNA as indicated.
  • Figure 110 is a panel of images showing T cells with a modified TCR.
  • Figure 110A is diagrammatic sketch of a small molecule
  • FIG. 110B is a panel of images showing T cells were co-electroporated with NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or their ErbB2 small molecule (342, 342.15, 342 or 342.4) modification. After overnight, vbl3.1 and His-Tag were detected by flow cytometry.
  • Figure 111 is a panel of images showing CD 107 up-regulation of Affi-TCR RNA electroporated T cells.
  • Figure 112 is a panel of images showing TCR expression and dual targeting by co-delivering small molecule modified CD3 epsilon.
  • Figure 112A is a diagrammatic sketch of small molecule modified CD3 epsilon by adding the small molecule and G4S linker to the N' terminus of either CD3 epsilon chain.
  • Figure 112B is a table showing T cells co-electroporated with NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or together with ErbB2 small molecule (342, 342.15, 342 or 342.4) modified CD3 epsilon (e).
  • Figure 112C is a panel of images showing expression of vb 13.1 detected by flow cytometry after overnight incubation.
  • Figure 113 is a panel of images showing CD 107a up-regulation of Affi-TCR RNA electroporated T cells.
  • T cells were co-electroporated with NY-ESO-1 (1G4) TCR alpha(a) and beta(b), or together with ErbB2 small molecule (342, 342.15, 342 or 342.4) modified CD3 epsilon(e) as indicated in Figure 101 and stimulated with tumor cells, Nalm-6-ESO (NY-eso-l+, ErbB2-), Nalm6 (NY-eso-1-, ErbB2-), SK-OV3 (NY-eso-1-, ErbB2+) or MDA231 (NY-eso-1-, ErbB2+), and assessed for CD 107a expression.
  • NY-ESO-1 1G4
  • TCR alpha(a) and beta(b) or together with ErbB2 small molecule (342, 342.15, 342 or 342.4) modified CD3 ep
  • an element means one element or more than one element.
  • “About” as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ⁇ 20% or ⁇ 10%, more preferably ⁇ 5%, even more preferably ⁇ 1%, and still more preferably ⁇ 0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.
  • Activation refers to the state of a T cell that has been sufficiently stimulated to induce detectable cellular proliferation. Activation can also be associated with induced cytokine production, and detectable effector functions.
  • activated T cells refers to, among other things, T cells that are undergoing cell division.
  • affinity molecule chimeric receptor refers to recombinant receptor comprising an affinity molecule, such as a small molecule, antibody mimetic,
  • the affinity molecule chimeric receptor comprises a transmembrane domain and intracellular domain. In some other embodiments, the affinity molecule chimeric receptor comprises T cell receptor domains, such as constant and variable domains.
  • antibody refers to an immunoglobulin molecule which specifically binds with an antigen.
  • Antibodies can be intact immunoglobulins obtained from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins.
  • Antibodies are typically tetramers of immunoglobulin molecules. Tetramers may be naturally occurring or reconstructed from single chain antibodies or antibody fragments.
  • Antibodies also include dimers that may be naturally occurring or constructed from single chain antibodies or antibody fragments.
  • the antibodies in the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab') 2 , as well as single chain antibodies (scFv), humanized antibodies, and human antibodies (Harlow et al, 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al, 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al, 1988,
  • antibody fragment refers to a region of an intact antibody and refers to the antigenic determining variable regions of an intact antibody.
  • antibody fragments include, but are not limited to, Fab, Fab', F(ab') 2 , and Fv fragments, linear antibodies, scFv antibodies, single-domain antibodies, such as camelid antibodies
  • the antibody fragment also includes a human antibody or a humanized antibody or a fragment of a human antibody or a humanized antibody thereof.
  • antibody heavy chain refers to the larger of the two types of polypeptide chains present in all antibody molecules in their naturally occurring conformations.
  • antibody light chain refers to the smaller of the two types of polypeptide chains present in all antibody molecules in their naturally occurring conformations, a and ⁇ light chains refer to the two major antibody light chain isotypes.
  • bispecific antibody refers to an antibody having binding specificities for at least two different antigenic epitopes.
  • the epitopes are from the same antigen.
  • the epitopes are from two different antigens.
  • Methods for making bispecific antibodies are known in the art. For example, bispecific antibodies can be produced recombinantly using the co-expression of two immunoglobulin heavy chain/light chain pairs. See, e.g., Milstein et al. (1983) Nature 305: 537-39. Alternatively, bispecific antibodies can be prepared using chemical linkage.
  • Bispecific antibodies include bispecific antibody fragments. See, e.g., Holliger et al. (1993) Proc. Natl. Acad. Sci. U.S.A.
  • synthetic antibody an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage as described herein.
  • the term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and well known in the art.
  • antigen or "Ag” as used herein is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
  • any macromolecule including virtually all proteins or peptides, can serve as an antigen.
  • antigens can be generated from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an "antigen" as that term is used herein.
  • an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a "gene” at all. It is readily apparent that an antigen can be generated, synthesized or originate from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid.
  • anti-tumor effect refers to a biological effect which can be manifested by a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in the number of metastases, an increase in life expectancy, or amelioration of various physiological symptoms associated with the cancerous condition.
  • An "anti-tumor effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies of the invention in prevention of the occurrence of tumor in the first place.
  • auto-antigen means, in accordance with the present invention, any self-antigen which is recognized by the immune system as being foreign.
  • Auto-antigens comprise, but are not limited to, cellular proteins, phosphoproteins, cellular surface proteins, cellular lipids, nucleic acids, glycoproteins, including cell surface receptors.
  • autoimmune disease as used herein is defined as a disorder that results from an autoimmune response.
  • An autoimmune disease is the result of an inappropriate and excessive response to a self-antigen.
  • autoimmune diseases include but are not limited to, Addision's disease, alopecia areata, ankylosing spondylitis,
  • autoimmune hepatitis autoimmune parotitis, Crohn's disease, diabetes (Type I), dystrophic epidermolysis bullosa, epididymitis, glomerulonephritis, Graves' disease,
  • Guillain-Barr syndrome Hashimoto's disease, hemolytic anemia, systemic lupus erythematosus, multiple sclerosis, myasthenia gravis, pemphigus vulgaris, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathies, thyroiditis, vasculitis, vitiligo, myxedema, pernicious anemia, ulcerative colitis, among others.
  • autologous is meant to refer to any material originating from the same individual to which it is later to be re -introduced into the individual.
  • Allogeneic refers to a graft derived from a different animal of the same species.
  • Xenogeneic refers to a graft derived from an animal of a different species.
  • the phrase "bispecific affinity molecule” refers to a molecule comprising two different binding specificities and thus is capable of binding two targets, molecules, or antigens at the same time.
  • the bispecific affinity molecule includes an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell.
  • one or more affinity domains is a small molecule antigen binding domain, which may comprise a small molecule, antibody mimetic, AffibodyTM, or any fragment thereof.
  • Binspecificity refers to a molecule having binding specificities for at least two different binding epitopes.
  • the epitopes are from the same binding partner.
  • the epitopes are from two different binding partners.
  • the molecule with bispecificity to different epitopes may include a bispecific antibody.
  • cancer as used herein is defined as disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, thyroid cancer, and the like.
  • chimeric antigen receptor refers to an artificial T cell receptor that is engineered to be expressed on an immune effector cell and specifically bind an antigen.
  • CARs may be used as a therapy with adoptive cell transfer. T cells are removed from a patient and modified so that they express the receptors specific to a particular form of antigen. In some embodiments, the CARs have been expressed with specificity to a tumor associated antigen, for example.
  • CARs may also comprise an intracellular activation domain, a transmembrane domain and an
  • CARs comprise fusions of single-chain variable fragments (scFv) derived monoclonal antibodies, fused to CD3-zeta transmembrane and intracellular domain.
  • the specificity of CAR designs may be derived from iigands of receptors (e.g., peptides).
  • a CAR can target cancers by redirecting the specificity of a T cell expressing the CAR specific for tumor associated antigens.
  • chimeric ligand engineered activation receptor refers to an engineered receptor comprising of at least an extracellular domain for ligand recognition and an intracellular domain for activation signal transduction within a T cell.
  • the CLEAR may be engineered to include an extracellular domain that binds to either a tumor or viral antigen or other molecule, while the intracellular domain provides an activation signal within the T cell after binding of ligand or antigen to the extracellular domain of the receptor.
  • chimeric membrane protein refers to an engineered membrane protein having an extracellular domain and intracellular domain derived from or capable of activating one or more signaling and/or receptor molecules.
  • the chimeric membrane protein described herein comprises a single chain variable fragment (scFv) directed against CD3 and an intracellular domain comprising a fragment of an intracellular domain of CD28 and 4- IBB.
  • conservative sequence modifications is intended to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody of the invention by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • Co-stimulatory ligand includes a molecule on an antigen presenting cell (e.g., an aAPC, dendritic cell, B cell, and the like) that specifically binds a cognate co-stimulatory molecule on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
  • an antigen presenting cell e.g., an aAPC, dendritic cell, B cell, and the like
  • a co-stimulatory ligand can include, but is not limited to, CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD- L2, 4-1BBL, OX40L, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM), CD30L, CD40, CD70, CD83, HLA-G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, HVEM, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
  • a co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co- stimulatory molecule present on a T cell, such as, but not limited to, CD27, CD28, 4- 1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA- 1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83.
  • a co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co- stimulatory molecule present on a T cell, such as, but not limited to, CD27, CD28, 4- 1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA- 1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83.
  • a "co-stimulatory molecule” refers to the cognate binding partner on a T cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the T cell, such as, but not limited to, proliferation.
  • Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA and a Toll ligand receptor.
  • a “co-stimulatory signal”, as used herein, refers to a signal, which in combination with a primary signal, such as TCR/CD3 ligation, leads to T cell proliferation and/or upregulation or downregulation of key molecules.
  • an antigen is derived from a protein.
  • a single-chain variable fragment is derived from a monoclonal antibody.
  • a “disease” is a state of health of an animal wherein the animal cannot maintain homeostasis, and wherein if the disease is not ameliorated then the animal's health continues to deteriorate.
  • a “disorder” in an animal is a state of health in which the animal is able to maintain homeostasis, but in which the animal's state of health is less favorable than it would be in the absence of the disorder. Left untreated, a disorder does not necessarily cause a further decrease in the animal's state of health.
  • results may include, but are not limited to, anti-tumor activity as determined by any means suitable in the art.
  • Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mR A, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rR A, tR A and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
  • a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • endogenous refers to any material from or produced inside an organism, cell, tissue or system.
  • exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • ex vivo refers to cells that have been removed from a living organism, (e.g., a human) and propagated outside the organism
  • expression is defined as the transcription and/or translation of a particular nucleotide sequence driven by its promoter.
  • “Expression vector” refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
  • An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
  • Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
  • CDR complementary-determining region
  • humanized antibodies can comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and optimize antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence.
  • the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • Fully human refers to an immunoglobulin, such as an antibody, where the whole molecule is of human origin or consists of an amino acid sequence identical to a human form of the antibody.
  • Identity refers to the subunit sequence identity between two polymeric molecules particularly between two amino acid molecules, such as, between two polypeptide molecules. When two amino acid sequences have the same residues at the same positions; e.g., if a position in each of two polypeptide molecules is occupied by an Arginine, then they are identical at that position. The identity or extent to which two amino acid sequences have the same residues at the same positions in an alignment is often expressed as a percentage.
  • the identity between two amino acid sequences is a direct function of the number of matching or identical positions; e.g., if half ⁇ e.g., five positions in a polymer ten amino acids in length) of the positions in two sequences are identical, the two sequences are 50% identical; if 90% of the positions ⁇ e.g., 9 of 10), are matched or identical, the two amino acids sequences are 90% identical.
  • immunoglobulin or "Ig,” as used herein is defined as a class of proteins, which function as antibodies. Antibodies expressed by B cells are sometimes referred to as the BCR (B cell receptor) or antigen receptor. The five members included in this class of proteins are IgA, IgG, IgM, IgD, and IgE.
  • IgA is the primary antibody that is present in body secretions, such as saliva, tears, breast milk, gastrointestinal secretions and mucus secretions of the respiratory and genitourinary tracts.
  • IgG is the most common circulating antibody.
  • IgM is the main immunoglobulin produced in the primary immune response in most subjects.
  • IgD is the immunoglobulin that has no known antibody function, but may serve as an antigen receptor.
  • IgE is the immunoglobulin that mediates immediate hypersensitivity by causing release of mediators from mast cells and basophils upon exposure to allergen.
  • immune response is defined as a cellular response to an antigen that occurs when lymphocytes identify antigenic molecules as foreign and induce the formation of antibodies and/or activate lymphocytes to remove the antigen.
  • an immunologically effective amount refers to the amount of the composition of the present invention to be used.
  • a subject which amount is determined by a physician, optionally in consultation with a scientist, in consideration of individual differences in age, weight, immune response, type of disease/condition, and the health of the subject (patient) so that the desired result is obtained in the subject.
  • an "instructional material” includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the compositions and methods of the invention.
  • the instructional material of the kit of the invention may, for example, be affixed to a container which contains the nucleic acid, peptide, and/or composition of the invention or be shipped together with a container which contains the nucleic acid, peptide, and/or composition.
  • the instructional material may be shipped separately from the container with the intention that the instructional material and the compound be used cooperatively by the recipient.
  • isolated means altered or removed from the natural state.
  • a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
  • An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • a “lentivirus” as used herein refers to a genus of the Retroviridae family.
  • Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses. Vectors derived from lentiviruses offer the means to achieve significant levels of gene transfer in vivo.
  • modified is meant a changed state or structure of a molecule or cell of the invention.
  • Molecules may be modified in many ways, including chemically, structurally, and functionally.
  • Cells may be modified through the introduction of nucleic acids.
  • moduleating mediating a detectable increase or decrease in the level of a response in a subject compared with the level of a response in the subject in the absence of a treatment or compound, and/or compared with the level of a response in an otherwise identical but untreated subject.
  • the term encompasses perturbing and/or affecting a native signal or response thereby mediating a beneficial therapeutic response in a subject, preferably, a human.
  • A refers to adenosine
  • C refers to cytosine
  • G refers to guanosine
  • T refers to thymidine
  • U refers to uridine.
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleotide sequence that encodes a protein or an R A may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. Nucleotide sequences that encode proteins and RNA may include introns.
  • operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
  • tumor antigen or overexpression of a tumor antigen is intended to indicate an abnormal level of expression of a tumor antigen in a cell from a disease area like a solid tumor within a specific tissue or organ of the patient relative to the level of expression in a normal cell from that tissue or organ.
  • Patients having solid tumors or a hematological malignancy characterized by overexpression of the tumor antigen can be determined by standard assays known in the art.
  • parenteral administration of an immunogenic composition includes, e.g. , subcutaneous (s.c), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques.
  • nucleotide as used herein is defined as a chain of nucleotides.
  • nucleic acids are polymers of nucleotides.
  • nucleic acids and polynucleotides as used herein are interchangeable.
  • nucleic acids are polynucleotides, which can be hydro lyzed into the monomeric "nucleotides.” The monomeric nucleotides can be hydrolyzed into nucleosides.
  • polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCRTM, and the like, and by synthetic means.
  • recombinant means i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCRTM, and the like, and by synthetic means.
  • polypeptide As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
  • Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
  • Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified
  • polypeptides derivatives, analogs, fusion proteins, among others.
  • the polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
  • promoter as used herein is defined as a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
  • promoter/regulatory sequence means a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
  • the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
  • a “constitutive" promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
  • an “inducible" promoter is a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
  • tissue-specific promoter is a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
  • a “signal transduction pathway” refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
  • the phrase "cell surface receptor” includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the plasma membrane of a cell.
  • An example of a “cell surface receptor” is human FSHR.
  • Similarity refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two R A molecules, or between two polypeptide molecules.
  • two nucleic acid molecules such as, two DNA molecules or two R A molecules
  • two polypeptide molecules or between two polypeptide molecules.
  • a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are similar at that position.
  • the similarity between two sequences is a direct function of the number of matching or similar positions; e.g., if half ⁇ e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are similar, the two sequences are 50% similar; if 90%> of the positions ⁇ e.g., 9 of 10), are matched or similar, the two sequences are 90%> similar.
  • Single chain antibodies refer to antibodies formed by recombinant DNA techniques in which immunoglobulin heavy and light chain fragments are linked to the Fv region via an engineered span of amino acids. Various methods of generating single chain antibodies are known, including those described in U.S. Pat. No. 4,694,778; Bird (1988) Science 242:423-442; Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-
  • small molecule refers to a peptide having about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids with the capacity to bind a target, such as a molecule, or antigen.
  • the small molecule comprises a low molar mass, such as less than about 12 kD, 11 kD, 10 kD, 9 kD, 8 kD, 7 kD, 6 kD, 5 kD, or any molar mass therebetween or less.
  • the small molecule is a small molecule extracellular domain of an affinity molecule chimeric receptor.
  • the small molecule is a small molecule binding domain of a bispecific affinity molecule.
  • Small molecule may be characterized by their ability to bind a target and their structure.
  • the small molecule comprises at least one helix, such an alpha-helix, or two helices, three helices or more.
  • the small molecule may also be chemically inert and withstand high temperatures, such as 85°C or higher.
  • an antibody which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample.
  • an antibody that specifically binds to an antigen from one species may also bind to that antigen from one or more species. But, such cross-species reactivity does not itself alter the classification of an antibody as specific.
  • an antibody that specifically binds to an antigen may also bind to different allelic forms of the antigen. However, such cross reactivity does not itself alter the classification of an antibody as specific.
  • the terms “specific binding” or “specifically binding,” can be used in reference to the interaction of an antibody, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody is specific for epitope "A”, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled "A” and the antibody, will reduce the amount of labeled A bound to the antibody.
  • a particular structure e.g., an antigenic determinant or epitope
  • stimulation is meant a primary response induced by binding of a stimulatory molecule (e.g. , a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex.
  • a stimulatory molecule e.g. , a TCR/CD3 complex
  • Stimulation can mediate altered expression of certain molecules, such as downregulation of TGF-beta, and/or reorganization of cytoskeletal structures, and the like.
  • a "stimulatory molecule,” as the term is used herein, means a molecule on a T cell that specifically binds with a cognate stimulatory ligand present on an antigen presenting cell.
  • a “stimulatory ligand,” as used herein, means a ligand that when present on an antigen presenting cell (e.g., an aAPC, a dendritic cell, a B-cell, and the like) can specifically bind with a cognate binding partner (referred to herein as a "stimulatory molecule") on a T cell, thereby mediating a primary response by the T cell, including, but not limited to, activation, initiation of an immune response, proliferation, and the like.
  • an antigen presenting cell e.g., an aAPC, a dendritic cell, a B-cell, and the like
  • a cognate binding partner referred to herein as a "stimulatory molecule”
  • Stimulatory ligands are well-known in the art and encompass, inter alia, an MHC Class I molecule loaded with a peptide, an anti-CD3 antibody, a superagonist anti-CD28 antibody, and a superagonist anti-CD2 antibody.
  • subject is intended to include living organisms in which an immune response can be elicited (e.g., mammals).
  • a "subject” or “patient,” as used therein, may be a human or non-human mammal.
  • Non-human mammals include, for example, livestock and pets, such as ovine, bovine, porcine, canine, feline and murine mammals.
  • the subject is human.
  • substantially purified cell is a cell that is essentially free of other cell types.
  • a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
  • a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state.
  • the cells are cultured in vitro. In other
  • the cells are not cultured in vitro.
  • T cell receptor refers to a complex of membrane proteins that participate in the activation of T cells in response to the presentation of antigen.
  • the TCR Is responsible for recognizing antigens bound to major histocompatibility complex molecules.
  • TCR is composed of a lieterodimer of an alpha (a) and beta ( ⁇ ) chain, although in some cells the TCR consists of gamma and delta ( ⁇ / ⁇ ) chains.
  • TCRs may exist in alpha/beta and gamma/delta forms, which are structurally similar but have distinct anatomical locations and functions. Each chain is composed of two extracellular domains, a variable and constant domain.
  • the TCR may be modified on any cell comprising a TCR, including, for example, a helper T ceil, a cytotoxic T cell, a memory T ceil, regulatory T cell, natural killer T cell, and gamma delta T ceil.
  • terapéutica as used herein means a treatment and/or prophylaxis.
  • a therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
  • transfected or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • transfected or transformed or transduced cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
  • the cell includes the primary subject cell and its progeny.
  • a disease as the term is used herein, means to reduce the frequency or severity of at least one sign or symptom of a disease or disorder experienced by a subject.
  • under transcriptional control or "operatively linked” as used herein means that the promoter is in the correct location and orientation in relation to a polynucleotide to control the initiation of transcription by RNA polymerase and expression of the polynucleotide.
  • a “vector” is a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
  • vector includes an autonomously replicating plasmid or a virus.
  • the term should also be construed to include non-plasmid and non- viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compounds, liposomes, and the like.
  • viral vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lenti viral vectors, and the like. Ranges: throughout this disclosure, various aspects of the invention can be presented in a range format.
  • range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
  • the present invention includes methods and compositions for generating a modified T cell capable of expressing a bispecific antibody.
  • the invention includes a method for generating the modified T cell.
  • Other embodiments include a modified T cell or a population of modified T cells.
  • the bispecific antibody comprises bispecificity for an antigen on a target cell and an antigen on an activating T cell, such as CD3, CD4, CD8, and TCR.
  • the present invention includes a T cell with an exogenous T cell receptor (TCR).
  • the invention includes a method for generating a modified T cell comprising expanding a population of T cells, and introducing a nucleic acid encoding a modified T cell receptor (TCR) comprising affinity for an antigen on a target cell into the expanded T cells.
  • the T cells are capable of expressing the modified TCR.
  • the invention includes a method for generating a modified T cell comprising expanding a population of T cells, and introducing a nucleic acid encoding a modified T cell receptor (TCR) comprising affinity for a surface antigen on a target cell into the expanded T cells.
  • TCR modified T cell receptor
  • the T cells are capable of expressing the modified TCR.
  • a T cell receptor is a complex of membrane proteins that participate in the activation of T cells in response to the presentation of antigen. Stimulation of the TCR is triggered by major histocompatibility complex molecules (MHC) on antigen presenting cells that present antigen peptides to the T cells and bind to the TCR complexes to induce a series of intracellular signaling cascades.
  • MHC major histocompatibility complex molecules
  • the TCR is generally composed of six different membrane bound chains that form the TCR heterodimer responsible for ligand recognition.
  • TCRs exist in alpha/beta and gamma/delta forms, which are structurally similar but have distinct anatomical locations and functions.
  • the TCR comprises a TCR alpha and beta chain, such as the nucleic acid encoding the TCR comprises a nucleic acid encoding a TCR alpha and a TCR beta chain.
  • an alpha or beta chain or both comprises at least one N-deglycosylation.
  • Each chain is composed of two extracellular domains, a variable and constant domain.
  • the TCR comprises at least one murine constant region.
  • the constant domain is proximal to the cell membrane, followed by a transmembrane domain and a short cytoplasmic tail.
  • the co-stimulatory signaling domain is a 4- IBB co-stimulatory signaling domain.
  • the variable domain contributes to the determination of the particular antigen and MHC molecule to which the TCR has binding specificity. In turn, the specificity of a T cell for a unique antigen-MHC complex resides in the particular TCR expressed by the T cell.
  • Each of the constant and variable domains may include an intra-chain disulfide bond.
  • TCR comprises at least one disulfide bond.
  • the variable domains include the highly polymorphic loops analogous to the complementarity determining regions (CDRs) of antibodies. The diversity of TCR sequences is generated via somatic rearrangement of linked variable (V), diversity (D), joining (J), and constant genes.
  • Functional alpha and gamma chain polypeptides are formed by rearranged V-J-C regions, whereas beta and delta chains consist of V-D-J-C regions.
  • the extracellular constant domain includes a membrane proximal region and an immunoglobulin region.
  • the TCR includes a wildtype TCR, a high affinity TCR, and a chimeric TCR. When the TCR is modified, it may have higher affinity for the target cell antigen than a wildtype TCR.
  • the TCR may include chimeric domains, such as the TCR comprises a co-stimulatory signaling domain at a C terminal of at least one of the chains.
  • the TCR may include a modified chain, such as a modified alpha or beta chain.
  • Such modifications may include, but are not limited to, N-deglycosylation, altered domain (such as an engineered variable region to target a specific antigen or increase affinity), addition of one or more disulfide bonds, entire or fragment of a chain derived from a different species, and any combination thereof.
  • target cell associated antigens are described elsewhere herein, all of which may be targeted by the TCR of the present invention.
  • the invention includes a population of modified T cells comprising an electroporated RNA encoding a modified T cell receptor (TCR) comprising affinity for an antigen on a target cell, wherein the population of T cells was expanded prior to electroporation with the TCR RNA.
  • TCR modified T cell receptor
  • the invention in another aspect, includes a modified T cell comprising an exogenous nucleic acid encoding a T cell receptor (TCR) comprising affinity for an antigen on a target cell; and an electroporated nucleic acid encoding a costimulatory molecule, wherein the T cell expresses the TCR and co-stimulatory molecule.
  • TCR T cell receptor
  • the co- stimulatory molecule may be selected from the group consisting of CD3, CD27, CD28, CD83, CD86, CD127, 4-1BB, 4-1BBL, PD1 and PD1L.
  • the invention in another aspect, includes a modified T cell comprising an exogenous nucleic acid encoding a T cell receptor (TCR) comprising affinity for a surface antigen on a target cell; and an electroporated nucleic acid encoding a costimulatory molecule, wherein the T cell expresses the TCR and co-stimulatory molecule.
  • TCR T cell receptor
  • the invention includes a modified T cell comprising an electroporated RNA encoding a modified T cell receptor (TCR), wherein the modified T cell receptor (TCR) comprises affinity for an antigen on a target cell and the T cell was expanded prior to electroporation with the TCR RNA.
  • TCR modified T cell receptor
  • the invention includes a modified T cell comprising an electroporated RNA encoding a modified T cell receptor (TCR), wherein the modified T cell receptor (TCR) comprises affinity for a surface antigen on a target cell and the T cell was expanded prior to electroporation with the TCR RNA.
  • TCR modified T cell receptor
  • the invention includes introducing a nucleic acid encoding a modified T cell receptor (TCR) comprising affinity for an antigen on a target cell into the expanded T cells.
  • TCR modified T cell receptor
  • the T cells are capable of expressing the modified TCR.
  • T cell receptors include, but are not limited to, the production of TCR heterodimers which include the native disulphide bridge which connects the respective subunits (Garboczi, et al, (1996), Nature
  • the TCR comprises specificity to a target cell antigen.
  • the target cell antigen may include any type of protein associated with a target cell.
  • the target cell antigen may be chosen to recognize a particular disease state of the target cell.
  • cell surface markers that may act as ligands for the antigen binding domain of the TCR including those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
  • the target cell antigen includes any tumor associated antigen (TAA) and viral antigen, or any fragment thereof.
  • TAA tumor associated antigen
  • the target cell antigen may include any protein that may be processed and presented by major histocompability complexes.
  • the target antigen may be associated with a particular disease state.
  • cell markers that may act as targets of the TCR include those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
  • the target antigen includes any of tumor associated antigens (TAA) and viral antigens, or any fragment thereof
  • the present invention includes a bispecific antibody.
  • a bispecific antibody comprises two different binding specificities and thus binds to two different antigens.
  • the bispecific antibody comprises a first antigen binding domain that binds to a first antigen and a second antigen binding domain that binds to a second antigen.
  • the bispecific antibody comprises an antigen binding domain comprising a first and a second single chain variable fragment (scFv) molecules.
  • the first and second scFv bind an antigen on a target cell and an antigen on an activating T cell.
  • the first scFv molecule is specific for at least one antigen on a target cell and the second scFv molecule is specific for an antigen on an activating T cell.
  • the activating T cell antigen can bind CD3, CD4, CD8, or TCR.
  • the bispecific antibody recognizes a T cell antigen and is referred to as a Bispecific T Cell Engager (BiTE).
  • the first and second scFv bind an antigen on a target cell and an antigen on a T cell.
  • the T cell antigen can include the CLEAR, CD3, CD4, CD8, or TCR.
  • the bispecific antibody recognizes a T cell antigen, such as CD3, CD4, CD8, or TCR, and is referred to as a Bispecific T Cell Engager (BiTE).
  • the bispecific antibody comprises bispecificity for an antigen on the target cell and the CLEAR on the T cell.
  • the present invention is not limited by the use of any particular bispecific antibody. Rather, any bispecific antibody or BiTE can be used.
  • the bispecific antibody or BiTE molecule may also be expressed as a membrane protein with specificity for at least one target cell associated antigen. Examples of target cell associated antigens are described elsewhere herein, all of which may be targeted by the bispecific antibody of the present invention. Techniques for making human and humanized antibodies are also described elsewhere herein.
  • the bispecific antibody or BiTE molecule comprises a bispecific antigen binding domain.
  • the bispecific antigen binding domain includes a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof.
  • the invention includes a population of modified T cells comprising a nucleic acid, such as RNA, encoding a bispecific antibody comprising bispecificity for an antigen on a target cell and an antigen on the T cell.
  • the population of T cells is expanded prior to introduction of the nucleic acid.
  • the invention includes a population of modified T cells comprising an electroporated mRNA encoding a bispecific antibody comprising bispecificity for an antigen on a target cell and an antigen on an activating T cell.
  • the population of T cells was expanded prior to the BiTE electroporation.
  • the invention includes a modified T cell comprising an electroporated mRNA encoding a bispecific T-cell engager (BiTE) molecule.
  • the BiTE molecule comprises bispecificity for an antigen on a target cell and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and TCR.
  • the invention includes a population of modified T cells comprising a nucleic acid, such as RNA, encoding a bispecific antibody comprising bispecificity for an antigen on a target cell and an antigen on the T cell.
  • the population of T cells can be expanded prior to introduction of the nucleic acid.
  • the invention includes a modified T cell comprising an electroporated RNA encoding a bispecific antibody.
  • the bispecific antibody comprises bispecificity for an antigen on a target cell and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and TCR.
  • This embodiment also includes the T cell being expanded prior to electroporation with the bispecific antibody mRNA.
  • the invention includes a modified T cell comprising a nucleic acid, such as RNA, encoding a bispecific antibody.
  • the bispecific antibody comprises bispecificity for an antigen on a target cell and an antigen on the T cell, such a the CLEAR.
  • This embodiment also includes expanding the T cell prior to electroporation with the bispecific antibody RNA.
  • the invention includes electroporating the expanded T cells with mRNA encoding a bispecific antibody, such as a BiTE molecule.
  • the invention includes introducing the expanded T cells with a nucleic acid encoding a bispecific antibody, such as a BiTE molecule.
  • theT cells are capable of expressing the bispecific antibody.
  • Techniques for engineering and expressing bispecific antibodies include, but are not limited to, recombinant co- expression of two immunoglobulin heavy chain- light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983), WO 93/08829, and Traunecker et al, EMBO J.
  • Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., U.S. Pat.
  • Bispecific antibodies can be constructed by linking two different antibodies, or portions thereof.
  • a bispecific antibody can comprise Fab, F(ab') 2 , Fab', scFv, and sdAb from two different antibodies.
  • the bispecific antibody and/or BiTE molecule comprises a bispecific antigen binding domain that comprises a first and a second single chain variable fragment (scFv) molecules.
  • the bispecific antigen binding domain can comprise bispecificity for an antigen on a target cell and an antigen on the T cell, such as the first scFv molecule is specific for at least one antigen on a target cell and the second scFv molecule is specific for at least antigen on the T cell.
  • the bispecific antigen binding domain can comprise bispecificity for an antigen on a target cell and an antigen on an activating T cell, such as the first scFv molecule is specific for at least one antigen on a target cell and the second scFv molecule is specific for at least one antigen on an activating T cell.
  • the bispecific antibody is expressed as a membrane protein.
  • the bispecific antibody comprises specificity to a target cell antigen.
  • the target cell antigen may include the same target cell antigen that the T cell receptor binds or may include a different target cell antigen.
  • the target cell antigen may include any type of ligand that defines the target cell.
  • the target cell antigen may be chosen to recognize a ligand that acts as a cell marker on target cells associated with a particular disease state.
  • cell markers that may act as ligands for the antigen moiety domain in a BiTE molecule, including those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
  • the target cell antigen includes any tumor associated antigen (TAA) and viral antigen, or any fragment thereof.
  • TAA tumor associated antigen
  • the bispecific antibody and/or BiTE molecule comprises an antibody, such as a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof, that specifically binds to the target cell antigen.
  • the activating T cell antigen may include tumor antigens, viral antigens, and fragments thereof.
  • the target cell antigen may include tumor antigens, viral antigens, and fragments thereof.
  • the bispecific antibody and/or BiTE molecule comprises specificity to at least one antigen on an activating T cell.
  • the activating T cell antigen includes antigens found on the surface of a T cell that can activate another cell.
  • the activating T cell antigen may include a co-stimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient response of lymphocytes to an antigen.
  • the activating T cell antigen is CD3, CD4, CD8, T cell receptor (TCR), or any fragment thereof.
  • the bispecific antibody and/or BiTE molecule comprises an antibody, such as a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof, that specifically binds to the activating T cell antigen.
  • the activating T cell antigen may include anti-CD3, anti-CD4, anti-CD8, anti-TCR, and fragments thereof.
  • the bispecific antibody and/or BiTE molecule comprises specificity to at least one antigen on the T cell.
  • the T cell antigen includes antigens found on the surface of the T cell, such as the CLEAR.
  • the T cell antigen may include a co-stimulatory signal or domain.
  • a costimulatory signal or domain is from a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient response of lymphocytes to an antigen.
  • the bispecific antibody comprises bispecificity for an antigen on the target cell and the CLEAR on the T cell.
  • the T cell antigen is CD3, CD4, CD8, T cell receptor (TCR), or any fragment thereof.
  • the bispecific antibody and/or BiTE molecule comprises an antibody, such as a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof, that specifically binds to the T cell antigen.
  • the activating T cell antigen may include anti-CD3, anti-CD4, anti-CD8, anti-TCR, and fragments thereof.
  • the present invention includes a m odified T cell with an affinity molecule chimeric receptor.
  • the invention includes a method for generating a modified T cell comprising introducing a nucleic acid encoding an affinity molecule chimeric receptor comprising a small molecule extracellular domain with affinity for an antigen on a target cell into a population of T cells, wherein the T cells are capable of expressing the affinity molecule chimeric receptor.
  • the affinity molecule chimeric receptor is generally composed of a small molecule extracellular domain for antigen recognition, such as an extracellular domain with affinity for an antigen on a target cell.
  • the small molecule extracellular domain is derived from an antibody mimetic.
  • the small molecule extracellular domain of the bispecific affinity molecule generally is a peptide having about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids.
  • the molar mass of the small molecule extracellular domain may be less than single-domain antibodies, such as less than about 10 kD.
  • the affinity molecule chimeric receptor comprises a small molecule extracellular domain that is less than about 10 kD.
  • the molar mass of the small molecule extracellular domain may be less than about 12 kD, 11 kD, 10 kD, 9 kD, 8 kD, 7 kD, 6 kD, 5 kD, or any molar mass therebetween or less.
  • the small molecule extracellular domain may also comprise a helical structure that lacks disulfide bridges. Some small molecule extracellular domains comprise at least one alpha-helix, two alpha-helices, three alpha-helices or more. The small molecule extracellular domain may also be chemically inert and capable of withstanding high temperatures, such as about 85°C or higher.
  • the affinity molecule chimeric receptor further comprises an intracellular signaling domain, such as a CD3 signaling domain; a transmembrane domain, such as a CD8 transmembrane domain; and a co-stimulatory domain, such as a 4- IBB co-stimulatory domain.
  • an intracellular signaling domain such as a CD3 signaling domain
  • a transmembrane domain such as a CD8 transmembrane domain
  • a co-stimulatory domain such as a 4- IBB co-stimulatory domain.
  • the affinity molecule chimeric receptor may also be based on a T cell receptor (TCR).
  • TCR T cell receptor
  • the affinity molecule chimeric receptor comprises a small molecule extracellular domain with affinity for an antigen on a target cell, a TCR variable domain, and a TCR constant domain.
  • the TCR variable domain may be derived from an alpha or beta chain or a chimeric of both chains.
  • the TCR constant domain may be derived from an alpha or beta chain or a chimeric of both chains.
  • Each of the constant and variable domains may include an intra-chain disulfide bond.
  • TCR comprises at least one disulfide bond.
  • the variable domains include the highly polymorphic loops analogous to the complementarity determining regions (CDRs) of antibodies. The diversity of TCR sequences is generated via somatic rearrangement of linked variable (V), diversity (D), joining (J), and constant genes.
  • the invention includes a population of modified T cells comprising a nucleic acid encoding an affinity molecule chimeric receptor comprising a small molecule extracellular domain with affinity for an antigen on a target cell, wherein the population of T cells express the affinity molecule chimeric receptor.
  • the invention includes a modified T cell comprising a nucleic acid encoding an affinity molecule chimeric receptor comprising a small molecule extracellular domain with affinity for an antigen on a target cell, wherein the T cell expresses the affinity molecule chimeric receptor.
  • the small molecule extracellular domain comprises specificity to a target cell antigen.
  • the target cell antigen may include any type of protein associated with a target cell.
  • the target cell antigen may be chosen to recognize a particular disease state of the target cell.
  • cell surface markers that may act to bind the small molecule extracellular domain to an antigen, such as antigens associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
  • the target cell antigen includes any tumor associated antigen
  • TAA bacterial antigen
  • parasitic antigen parasitic antigen
  • viral antigen or any fragment thereof.
  • the target cell antigen may include any protein that may be processed and presented by major histocompability complexes.
  • the target antigen may be associated with a particular disease state.
  • cell markers that may act as targets of the TCR include those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
  • the target antigen includes any of tumor associated antigens (TAA) and viral antigens, or any fragment thereof
  • the present invention also includes a bispecific affinity molecule.
  • a bispecific affinity molecule comprises two different binding specificities and thus is capable of binding two targets, molecules, or antigens.
  • the invention includes a modified cell comprising a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell.
  • At least one affinity domain comprises a small molecule antigen binding domain and the cell expresses the bispecific affinity molecule.
  • the activating T cell and the target cell bind with the bispecific affinity molecule.
  • Either affinity domain of the bispecific affinity molecule may comprise a small molecule antigen binding domain, such that the small molecule antigen binding domain may have affinity for the target cell antigen or the activating T cell antigen.
  • the affinity domain capable of binding the target cell antigen is selected from the group consisting of the small molecule antigen binding domain, and an antigen binding domain of an antibody.
  • the affinity domain capable of binding the activating T cell antigen is selected from the group consisting of the small molecule antigen binding domain, and an antigen binding domain of an antibody.
  • the bispecific affinity molecule comprises a small molecule antigen binding domain with affinity for the target cell antigen and a small molecule antigen binding domain with affinity for the activating T cell antigen. In one embodiment, the bispecific affinity molecule comprises a small molecule antigen binding domain with affinity for the target cell antigen and an antigen binding domain of an antibody with affinity for the activating T cell antigen. In another embodiment, the bispecific affinity molecule comprises an antigen binding domain of an antibody with affinity for the target cell antigen and a small molecule antigen binding domain with affinity for the activating T cell antigen.
  • the small molecule antigen binding domain of the bispecific affinity molecule comprises an antibody mimetic or a fragment thereof.
  • the small molecule antigen binding domain of the bispecific affinity molecule generally is a peptide having about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids.
  • the molar mass of the small molecule may be less than single-domain antibodies, such as less than about 10 kD.
  • the bispecific affinity molecule comprises a small molecule antigen binding domain that is less than about 10 kD.
  • the small molecule When the affinity domain is a small molecule antigen binding domain, the small molecule may have a molar mass that is less than about 12 kD, 11 kD, 10 kD, 9 kD, 8 kD, 7 kD, 6 kD, 5 kD, or any molar mass therebetween or less.
  • the molar mass of the small molecule antigen binding domain with affinity for the target cell antigen may be more or less than the molar mass of the small molecule antigen binding domain with affinity for the activating T cell antigen.
  • the small molecule antigen binding domain may also comprise a helical structure that lacks disulfide bridges.
  • Some small molecule antigen binding domains comprise at least one alpha-helix, two alpha-helices, three alpha-helices or more.
  • the small molecule antigen binding domain may also be chemically inert and capable of withstanding high temperatures, such as about 85°C or higher.
  • the nucleic acid encoding the bispecific affinity molecule may further comprises a linker or spacer between the affinity domains.
  • linker or "spacer” generally mean any oligo- or polypeptide that functions to link one affinity domain to another, either the small molecule antigen binding domain to another small molecule antigen binding domain or the small molecule antigen binding domain to the antibody antigen binding domain.
  • a spacer or linker may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
  • the present invention is not limited by the use of only particular affinity domains. Rather, any affinity domains can be used.
  • the bispecific affinity molecule may also be expressed as a membrane protein with specificity for at least one target cell antigen. Examples of target cell antigens are described elsewhere herein, all of which may be targeted by the bispecific affinity molecule of the present invention.
  • the bispecific affinity molecule comprises an antigen binding domain of an antibody.
  • Techniques for making human and humanized antibodies or fragments thereof are also described elsewhere herein.
  • the antibody antigen binding domain includes a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof.
  • the invention includes a population of modified cells comprising a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell, wherein at least one affinity domain comprises a small molecule antigen binding domain and the population of cells express the bispecific affinity molecule.
  • the population of modified cells comprises lymphocytes, such as T cells, B cells, or natural killer cells; antigen presenting cells, or non-lymphocytes.
  • the population of cells comprises T cells, B cells, natural killer cells, or antigen presenting cells.
  • the invention includes a modified cell comprising a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell, wherein at least one affinity domain comprises a small molecule antigen binding domain and the cell expresses the bispecific affinity molecule.
  • the modified cell may be selected from a lymphocyte, such as a T cell, B cell, or natural killer cell; an antigen presenting cell; or a non- lymphocyte.
  • the cell is a T cell, B cell, a natural killer cell, or an antigen presenting cell.
  • the invention includes a method of generating a modified cell comprising introducing a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell into a population of cells.
  • at least one affinity domain comprises a small molecule antigen binding domain and the cell expresses the bispecific affinity molecule.
  • the population of cells comprises a T cell, B cell, a natural killer cell, or an antigen presenting cell.
  • Techniques for engineering and expressing bispecific affinity molecules include, but are not limited to, engineering of AffibodyTM molecules (see Lofblom et.
  • Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., U.S. Pat. No. 4,676,980, and Brennan et al, Science 229:81 (1985)); using leucine zippers to produce bispecific antibodies (see, e.g., Kostelny et al, J. Immunol.
  • Bispecific antibodies can be constructed by linking two different antibodies, or portions thereof.
  • one of the affinity domains of the bispecific affinity molecule can comprise a Fab, a F(ab') 2 , a Fab', a scFv, or a sdAb from an antibody.
  • the bispecific affinity molecule comprises an affinity domain capable of binding the target cell antigen.
  • the target cell antigen may include any type of ligand or antigen that defines the target cell.
  • the target cell antigen may be chosen to recognize a ligand that acts as a cell marker on the target cell and is associated with a particular disease state.
  • target cell antigens including those associated with viral, bacterial and parasitic infections, diseased state, autoimmune disease and cancer cells.
  • the target cell antigen includes any tumor associated antigen (TAA), bacterial antigen, parasitic antigen, viral antigen, and any fragment thereof.
  • TAA tumor associated antigen
  • the antigen binding domain of an antibody may comprise an antibody, such as a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof, that specifically binds to the target cell antigen.
  • the bispecific affinity molecule comprises an affinity domain capable of binding an activating T cell antigen.
  • the activating T cell antigen includes antigens found on the surface of a T cell that can activate another cell.
  • the activating T cell antigen may include a co-stimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient response of lymphocytes to an antigen.
  • Examples of such molecules include CD27, CD28, 4- IBB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like.
  • Other costimulatory elements are also within the scope of the invention.
  • the activating T cell antigen is CD3, CD4, CD8, T cell receptor (TCR), or any fragment thereof.
  • the bispecific antibody and/or BiTE molecule comprises an antibody, such as a synthetic antibody, human antibody, a humanized antibody, single chain variable fragment, single domain antibody, an antigen binding fragment thereof, and any combination thereof, that specifically binds to the activating T cell antigen.
  • the activating T cell antigen may include anti-CD3, anti-CD4, anti-CD8, anti-TCR, and fragments thereof.
  • the present invention includes a T cell with a chimeric ligand engineered activation receptor.
  • the invention includes a method for generating a modified T cell comprising expanding a population of T cells, and introducing a nucleic acid encoding a chimeric ligand engineered activation receptor (CLEAR).
  • the T cells are capable of expressing the CLEAR.
  • the CLEAR is generally composed of an extracellular domain for ligand recognition and an intracellular domain for activation signal transduction.
  • the CLEAR comprises an intracellular activation domain and an
  • the extracellular domain can be engineered for recognition by an antibody, receptor, ligand, or other binding molecule.
  • the extracellular domain specifically binds to either a tumor antigen or molecule not normally expressed by a healthy cell or tissue.
  • tumor antigens or abnormal molecules include, but are not limited to, viral, bacterial and parasitic antigens, tumor associated antigens (TAA), or any fragment thereof.
  • TAA tumor associated antigens
  • the extracellular domain is selected from an antigen binding domain of an antibody, a ligand binding domain of a receptor, an antigen, or a ligand.
  • the extracellular domain is selected from CD27, CD28, CD70, CD80, PD1, or PD-L1.
  • the extracellular domain is capable of binding to a tumor antigen.
  • the intracellular domain can be engineered to provide an activation signal within the T cell.
  • intracellular domains include, but are not limited to, the intracellular domain from CD3, CD3zeta with or without co-stimulatory signal, CD28, CD4, CD8, 4-1BB, TCR alpha and/or beta chain, or a fragment of any of the intracellular domains thereof.
  • the intracellular activation domain comprises an intracellular activation domain of CD3 zeta.
  • the activation signal provided within the T cell may be a positive signal that induces growth, cytokine production, lytic activity, and other activities of the T cell.
  • the activation signal provided within the T cell may be a negative signal that shuts down activity within the T cell, such as inhibits growth, induces senescence and/or anergy, inhibits cytokine production, and other activities of the T cell.
  • the CLEAR comprises a co-stimulatory domain.
  • Co- stimulatory domains from molecules include, but are not limited to, CD27, CD28, 4-1BB (CD 137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, and the like.
  • LFA-1 lymphocyte function-associated antigen- 1
  • Other costimulatory elements are also within the scope of the invention Co-Stimulatory Molecule
  • the modified T cell of the invention further includes a nucleic acid encoding a co -stimulatory molecule, such that the modified T cell expresses the co- stimulatory molecule.
  • the nucleic acid may be introduced into the T cell by transducing the T cell, transfecting the T cell, or electroporating the T cell.
  • the co-stimulatory molecule is selected from CD3, CD27, CD28, CD83, CD86, CD127, 4- IBB, 4-1BBL, PD1 and PD1L.
  • the co-stimulatory molecule is CD3, and CD3 comprises at least two different CD3 chains, such as CD3 zeta and CD3 epsilon chains.
  • RNA encoding the co-stimulatory molecule such as CD3, is electroporated into the T cell or cell.
  • the nucleic acid encoding the costimulatory molecule such as CD3 RNA
  • another nucleic acid such as the nucleic acid or RNA encoding the affinity molecule chimeric receptor.
  • the TCR is modified to include a co-stimulatory domain selected from at least one domain from CD3, CD27, CD28, CD83, CD86, CD127, 4-lBB,
  • Methods of introducing nucleic acids into a cell include physical, biological and chemical methods.
  • Physical methods for introducing a polynucleotide, such as RNA, into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like.
  • RNA can be introduced into target cells using commercially available methods which include electroporation (Amaxa).
  • RNA can also be introduced into cells using cationic liposome mediated transfection using lipofection, using polymer encapsulation, using peptide mediated transfection, or using biolistic particle delivery systems such as "gene guns” (see, for example, Nishikawa, et al. Hum Gene Ther., 12(8): 861-70 (2001).
  • Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
  • Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
  • Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
  • Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
  • Lipids suitable for use can be obtained from commercial sources.
  • DMPC dimyristyl phosphatidylcholine
  • DCP dicetyl phosphate
  • Choi cholesterol
  • DMPG phosphatidylglycerol
  • Avanti Polar Lipids, Inc. (Birmingham, AL).
  • Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution.
  • compositions that have different structures in solution than the normal vesicular structure are also encompassed.
  • the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
  • lipofectamine-nucleic acid complexes are also contemplated.
  • Such assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; "biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
  • “molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR
  • biochemical assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
  • a nucleic acid encoding a T cell receptor (TCR) comprising affinity for an antigen on a target cell is introduced into the T cells.
  • the nucleic acid may be introduced by any means, such as transducing the expanded T cells, transfecting the expanded T cells, and electroporating the expanded T cells.
  • a nucleic acid nucleic acid encoding an affinity molecule chimeric receptor or a bispecific affinity molecule is introduced by a method selected from the group consisting of transducing the population of cells, transfecting the population of cells, and electroporating the population of cells.
  • a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell into a population of cells by a method selected from the group consisting of transducing the population of cells, transfecting the population of cells, and electroporating the population of cells.
  • a nucleic acid encoding a bispecific antibody such as a BiTE molecule, is introduced into the T cells.
  • the nucleic acid may be introduced by any means, such as transducing the expanded T cells, transfecting the expanded T cells, and electroporating the expanded T cells.
  • the nucleic acids introduced into the T cell are RNA.
  • the RNA is mRNA that comprises in vitro transcribed RNA or synthetic RNA.
  • the RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template.
  • DNA of interest from any source can be directly converted by PCR into a template for in vitro mRNA synthesis using appropriate primers and RNA polymerase.
  • the source of the DNA can be, for example, genomic DNA, plasmid DNA, phage DNA, cDNA, synthetic DNA sequence or any other appropriate source of DNA.
  • the desired template for in vitro transcription is a chimeric membrane protein.
  • the template encodes an antibody, a fragment of an antibody or a portion of an antibody.
  • the template comprises an extracellular domain comprising a single chain variable domain of an antibody, such as anti-CD3, and an intracellular domain of a co-stimulatory molecule.
  • the template for the RNA chimeric membrane protein encodes a chimeric membrane protein comprising an extracellular domain comprising an antigen binding domain derived from an antibody to a co-stimulatory molecule, and an intracellular domain derived from a portion of an intracellular domain of CD28 and 4-1BB.
  • PCR can be used to generate a template for in vitro transcription of mRNA which is then introduced into cells.
  • Methods for performing PCR are well known in the art.
  • Primers for use in PCR are designed to have regions that are substantially complementary to regions of the DNA to be used as a template for the PCR. "Substantially
  • nucleotide complementary refers to sequences of nucleotides where a majority or all of the bases in the primer sequence are complementary, or one or more bases are non- complementary, or mismatched. Substantially complementary sequences are able to anneal or hybridize with the intended DNA target under annealing conditions used for
  • the primers can be designed to be substantially complementary to any portion of the DNA template.
  • the primers can be designed to amplify the portion of a gene that is normally transcribed in cells (the open reading frame), including 5' and 3' UTRs.
  • the primers can also be designed to amplify a portion of a gene that encodes a particular domain of interest.
  • the primers are designed to amplify the coding region of a human cDNA, including all or portions of the 5' and 3' UTRs. Primers useful for PCR are generated by synthetic methods that are well known in the art.
  • Forward primers are primers that contain a region of nucleotides that are substantially complementary to nucleotides on the DNA template that are upstream of the DNA sequence that is to be amplified. "Upstream” is used herein to refer to a location 5, to the
  • reverse primers are primers that contain a region of nucleotides that are substantially complementary to a double-stranded DNA template that are downstream of the DNA sequence that is to be amplified.
  • Downstream is used herein to refer to a location 3' to the DNA sequence to be amplified relative to the coding strand.
  • the RNA preferably has 5' and 3' UTRs.
  • the 5' UTR is between zero and 3000 nucleotides in length.
  • the length of 5' and 3' UTR sequences to be added to the coding region can be altered by different methods, including, but not limited to, designing primers for PCR that anneal to different regions of the UTRs. Using this approach, one of ordinary skill in the art can modify the 5' and 3' UTR lengths required to achieve optimal translation efficiency following transfection of the transcribed RNA.
  • the 5' and 3' UTRs can be the naturally occurring, endogenous 5' and 3' UTRs for the gene of interest.
  • UTR sequences that are not endogenous to the gene of interest can be added by incorporating the UTR sequences into the forward and reverse primers or by any other modifications of the template.
  • the use of UTR sequences that are not endogenous to the gene of interest can be useful for modifying the stability and/or translation efficiency of the RNA.
  • AU-rich elements in 3' UTR sequences can decrease the stability of mRNA. Therefore, 3' UTRs can be selected or designed to increase the stability of the transcribed RNA based on properties of UTRs that are well known in the art.
  • the 5' UTR can contain the Kozak sequence of the endogenous gene.
  • a consensus Kozak sequence can be redesigned by adding the 5' UTR sequence.
  • Kozak sequences can increase the efficiency of translation of some RNA transcripts, but does not appear to be required for all RNAs to enable efficient translation. The requirement for Kozak sequences for many mRNAs is known in the art.
  • the 5' UTR can be derived from an RNA virus whose RNA genome is stable in cells.
  • various nucleotide analogues can be used in the 3 ' or 5' UTR to impede exonuclease degradation of the mRNA.
  • a promoter of transcription should be attached to the DNA template upstream of the sequence to be transcribed.
  • the RNA polymerase promoter becomes incorporated into the PCR product upstream of the open reading frame that is to be transcribed.
  • the promoter is a T7 polymerase promoter, as described elsewhere herein.
  • Other useful promoters include, but are not limited to, T3 and SP6 RNA polymerase promoters. Consensus nucleotide sequences for T7, T3 and SP6 promoters are known in the art.
  • the mRNA has both a cap on the 5' end and a 3' poly(A) tail which determine ribosome binding, initiation of translation and stability mRNA in the cell.
  • RNA polymerase produces a long concatameric product which is not suitable for expression in eukaryotic cells.
  • the transcription of plasmid DNA linearized at the end of the 3' UTR results in normal sized mR A which is not effective in eukaryotic transfection even if it is polyadenylated after transcription.
  • phage T7 RNA polymerase can extend the 3' end of the transcript beyond the last base of the template (Schenborn and Mierendorf, Nuc Acids Res., 13:6223-36 (1985); Nacheva and Berzal-Herranz, Eur. J. Biochem., 270: 1485-65
  • the polyA/T segment of the transcriptional DNA template can be produced during PCR by using a reverse primer containing a polyT tail, such as 100T tail (size can be 50-5000 T), or after PCR by any other method, including, but not limited to, DNA ligation or in vitro recombination.
  • Poly(A) tails also provide stability to RNAs and reduce their degradation. Generally, the length of a poly(A) tail positively correlates with the stability of the transcribed RNA. In one embodiment, the poly(A) tail is between 100 and 5000 adenosines.
  • Poly(A) tails of RNAs can be further extended following in vitro transcription with the use of a poly(A) polymerase, such as E. coli polyA polymerase (E-PAP).
  • E-PAP E. coli polyA polymerase
  • increasing the length of a poly(A) tail from 100 nucleotides to between 300 and 400 nucleotides results in about a two-fold increase in the translation efficiency of the RNA.
  • the attachment of different chemical groups to the 3' end can increase mRNA stability. Such attachment can contain modified/artificial nucleotides, aptamers and other compounds.
  • ATP analogs can be incorporated into the poly(A) tail using poly(A) polymerase. ATP analogs can further increase the stability of the RNA.
  • RNAs produced by the methods disclosed herein include a 5' cap.
  • the 5' cap is provided using techniques known in the art and described herein (Cougot, et al, Trends in
  • RNAs produced by the methods disclosed herein can also contain an internal ribosome entry site (IRES) sequence.
  • IRES sequence may be any viral, chromosomal or artificially designed sequence which initiates cap-independent ribosome binding to mRNA and facilitates the initiation of translation. Any solutes suitable for cell electroporation, which can contain factors facilitating cellular permeability and viability such as sugars, peptides, lipids, proteins, antioxidants, and surfactants can be included.
  • the disclosed methods can be applied to the modulation of T cell activity in basic research and therapy, in the fields of cancer, stem cells, acute and chronic infections, and autoimmune diseases, including the assessment of the ability of the genetically modified T cell to kill a target cancer cell.
  • the methods also provide the ability to control the level of expression over a wide range by changing, for example, the promoter or the amount of input RNA, making it possible to individually regulate the expression level.
  • the PCR-based technique of mRNA production greatly facilitates the design of the chimeric receptor mRNAs with different structures and combination of their domains. For example, varying of different intracellular effector/costimulator domains on multiple chimeric receptors in the same cell allows determination of the structure of the receptor
  • RNA transfection is essentially transient and a vector-free.
  • a RNA transgene can be delivered to a lymphocyte and expressed therein following a brief in vitro cell activation, as a minimal expressing cassette without the need for any additional viral sequences. Under these conditions, integration of the transgene into the host cell genome is unlikely.
  • Cloning of cells is not necessary because of the efficiency of transfection of the RNA and its ability to uniformly modify the entire lymphocyte population.
  • IVVT-RNA in vitro-transcribed RNA
  • IVT vectors are known in the literature which are utilized in a standardized manner as template for in vitro transcription and which have been genetically modified in such a way that stabilized RNA transcripts are produced.
  • protocols used in the art are based on a plasmid vector with the following structure: a 5' RNA polymerase promoter enabling RNA transcription, followed by a gene of interest which is flanked either 3' and/or 5' by untranslated regions (UTR), and a 3' polyadenyl cassette containing 50-70 A nucleotides.
  • UTR untranslated regions
  • the circular plasmid Prior to in vitro transcription, the circular plasmid is linearized downstream of the polyadenyl cassette by type II restriction enzymes (recognition sequence corresponds to cleavage site).
  • the polyadenyl cassette thus corresponds to the later poly(A) sequence in the transcript.
  • some nucleotides remain as part of the enzyme cleavage site after linearization and extend or mask the poly(A) sequence at the 3' end. It is not clear, whether this nonphysio logical overhang affects the amount of protein produced intracellularly from such a construct.
  • RNA has several advantages over more traditional plasmid or viral approaches. Gene expression from an RNA source does not require transcription and the protein product is produced rapidly after the transfection. Further, since the RNA has to only gain access to the cytoplasm, rather than the nucleus, and therefore typical transfection methods result in an extremely high rate of transfection. In addition, plasmid based approaches require that the promoter driving the expression of the gene of interest be active in the cells under study.
  • the RNA construct is delivered into the cells by electroporation. See, e.g., the formulations and methodology of electroporation of nucleic acid constructs into mammalian cells as taught in US 2004/0014645, US 2005/0052630A1, US
  • electroporation may also be used for transfection of cells in vitro as described e.g. in US20070128708A1. Electroporation may also be utilized to deliver nucleic acids into cells in vitro. Accordingly,
  • electroporation-mediated administration into cells of nucleic acids including expression constructs utilizing any of the many available devices and electroporation systems known to those of skill in the art presents an exciting new means for delivering an RNA of interest to a target cell.
  • the RNA encoding a TCR is electroporated into the cells. In one embodiment, the RNA encoding the TCR is in vitro transcribed RNA. In some embodiments, the mRNA encoding bispecific antibodies are electroporated into the cells.
  • the mRNA encoding bispecific antibodies is in vitro transcribed mRNA.
  • the RNA encoding bispecific antibodies is electroporated into the cells. In one embodiment, the RNA encoding bispecific antibodies is in vitro transcribed RNA.
  • the RNA encoding the affinity molecule chimeric receptor or bispecific affinity molecule is electroporated into the cells. In one embodiment, the RNA encoding the affinity molecule chimeric receptor or bispecific affinity molecule is in vitro transcribed RNA.
  • the method includes electroporating a RNA encoding a TCR alpha and beta chain.
  • the TCR alpha and beta chain can be encoded on the same or separate RNAs, such as co-electroporating a RNA encoding the TCR alpha chain and a separate RNA encoding the TCR beta chain.
  • the alpha and beta are encoded by separate RNAs, the RNA may be co-electroporated.
  • the method further includes electroporating a nucleic acid encoding a bispecific antibody or BiTE molecule.
  • the bispecific antibody nucleic acid may be co-electroporated with the TCR RNA.
  • the method may further include electroporating a nucleic acid encoding a costimulatory molecule.
  • the costimulatory molecule nucleic acid may be co-electroporated with the TCR RNA.
  • the method includes electroporating a RNA encoding the affinity molecule chimeric receptor. In another embodiment, the method further includes electroporating a RNA encoding a co-stimulatory molecule, such as CD3.
  • the affinity molecule chimeric receptor and co-stimulatory molecule can be encoded on the same or separate RNAs. When the affinity molecule chimeric receptor and co-stimulatory molecule are encoded by separate RNAs, the RNA may be co-electroporated.
  • the method includes electroporating a nucleic acid encoding a bispecific affinity molecule.
  • the costimulatory molecule nucleic acid may also be co-electroporated with the bispecific affinity molecule nucleic acid.
  • the modified T cells are expanded prior to introduction of the nucleic acid. In another embodiment, the modified T cells are expanded prior to electroporation with R A encoding the TCR or the bispecific antibody or BiTE molecule.
  • the expansion of the T cells may include electroporating the T cells with RNA encoding a chimeric membrane protein, and culturing the electroporated T cells.
  • the chimeric membrane protein of the invention comprises an extracellular and intracellular domain.
  • the extracellular domain comprises a target-specific binding element, such as an antibody.
  • the extracellular domain of the chimeric membrane protein targets a molecule on a T cell that includes but is not limited to TCR, CD3, CD28, and the like.
  • the present invention includes an extracellular domain comprising an antigen binding domain comprising an antibody or fragment thereof directed against a molecule on T cells.
  • the molecule can include any molecule that co-stimulates T cells, such as, but not limited to, TCR, CD3, CD28, or a combination thereof.
  • the extracellular domain can include an antigen binding domain comprising the CD3 binding domain of an anti-CD3 antibody, an anti-TCR antibody, anti-CD28 antibody, or a combination thereof.
  • the extracellular domain can include any fragment of an antibody that binds to antigen including, but not limited to, the antigen binding domain of a synthetic antibody, human antibody, humanized antibody, single domain antibody, single chain variable fragments, and fragments thereof.
  • the extracellular domain of the chimeric membrane protein may comprise a human antibody or fragment thereof.
  • the extracellular domain comprises a human antibody or a fragment thereof.
  • the antibody is a synthetic antibody, human antibody, humanized antibody, single domain antibody, single chain variable fragment, and antigen-binding fragments thereof.
  • Intracellular Domain a synthetic antibody, human antibody, humanized antibody, single domain antibody, single chain variable fragment, and antigen-binding fragments thereof.
  • the intracellular domain or cytoplasmic domain comprises a costimulatory signaling region.
  • the costimulatory signaling region refers to an intracellular domain of a costimulatory molecule.
  • Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient response of
  • lymphocytes to antigen.
  • the cytoplasmic domain or the intracellular signaling domain of the chimeric membrane protein is responsible for activation of at least one of effector functions of the T cell.
  • effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
  • intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
  • intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • Nonlimiting examples of intracellular signaling domains for use in the chimeric membrane protein include any fragment of the intracellular domain of CD28, 4-1BB, T cell receptor (TCR), co-stimulatory molecules, any derivative or variant of these sequences, any synthetic sequence that has the same functional capability, and any combination thereof.
  • TCR T cell receptor
  • spacer domain generally means any oligo- or polypeptide that functions to link the transmembrane domain to, either the extracellular domain or, the cytoplasmic domain in the polypeptide chain.
  • a spacer domain may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
  • the chimeric membrane protein further comprises a transmembrane domain. In some embodiment, the chimeric membrane protein further comprises a hinge domain. In one embodiment, the mR A encoding the chimeric membrane protein further comprises a transmembrane and hinge domain, such as a CD28 transmembrane domain and a CD8-alpha hinge domain.
  • human antibodies For in vivo use of antibodies in humans, it may be preferable to use human antibodies. Completely human antibodies are particularly desirable for therapeutic treatment of human subjects. Human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences, including improvements to these techniques. See, also, U.S. Pat. Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645, WO 98/50433, WO 98/24893, W098/16654, WO 96/34096, WO 96/33735, and WO
  • a human antibody can also be an antibody wherein the heavy and light chains are encoded by a nucleotide sequence derived from one or more sources of human DNA.
  • Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
  • transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
  • human heavy and light chain For example, the human heavy and light chain
  • immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells.
  • the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes.
  • the mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. For example, it has been described that the homozygous deletion of the antibody heavy chain joining region (JH) gene in chimeric and germ- line mutant mice results in complete inhibition of endogenous antibody production.
  • JH antibody heavy chain joining region
  • the chimeric mice are then bred to produce homozygous offspring which express human antibodies.
  • the transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of a polypeptide of the invention.
  • Antibodies directed against the target of choice can be obtained from the immunized, transgenic mice using conventional hybridoma technology.
  • the human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation.
  • IgG, IgA, IgM and IgE antibodies including, but not limited to, IgGl (gamma 1) and IgG3.
  • Human antibodies can also be derived from phage-display libraries (Hoogenboom et al, J. Mol. Biol, 227:381 (1991); Marks et al, J. Mol. Biol, 222:581-597 (1991); Vaughan et al, Nature Biotech., 14:309 (1996)).
  • Phage display technology McCafferty et al, Nature, 348:552-553 (1990)
  • V immunoglobulin variable
  • antibody V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as Ml 3 or fd, and displayed as functional antibody fragments on the surface of the phage particle.
  • a filamentous bacteriophage such as Ml 3 or fd
  • the filamentous particle contains a single-stranded DNA copy of the phage genome
  • selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties.
  • the phage mimics some of the properties of the B cell.
  • Phage display can be performed in a variety of formats; for their review see, e.g., Johnson, Kevin S, and
  • V-gene segments can be used for phage display.
  • Clackson et al Nature, 352:624-628 (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of unimmunized mice.
  • a repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Marks et al, J. Mol. Biol, 222:581-597 (1991), or Griffith et al, EMBO J., 12:725-734 (1993). See, also, U.S. Pat. Nos.
  • Human antibodies may also be generated by in vitro activated B cells (see, U.S. Pat. Nos. 5,567,610 and 5,229,275, each of which is incorporated herein by reference in its entirety). Human antibodies may also be generated in vitro using hybridoma techniques such as, but not limited to, that described by Roder et al. (Methods EnzymoL, 121 : 140-167 (1986)).
  • a non-human antibody is humanized, where specific sequences or regions of the antibody are modified to increase similarity to an antibody naturally produced in a human.
  • the antigen binding domain is humanized.
  • a “humanized” antibody retains a similar antigenic specificity as the original antibody.
  • affinity and/or specificity of binding of the antibody for human CD3 antigen may be increased using methods of "directed evolution,” as described by Wu et al, J. Mol. Biol, 294: 151 (1999), the contents of which are incorporated herein by reference herein in their entirety.
  • humanized antibody has one or more amino acid residues introduced into it from a source which is nonhuman. These nonhuman amino acid residues are often referred to as "import” residues, which are typically taken from an “import” variable domain.
  • humanized antibodies comprise one or more CDRs from nonhuman immunoglobulin molecules and framework regions from human.
  • humanized chimeric antibodies substantially less than an intact human variable domain has been substituted by the corresponding sequence from a nonhuman species.
  • humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies. Humanization of antibodies can also be achieved by veneering or resurfacing (EP 592,106; EP 519,596; Padlan, 1991, Molecular Immunology, 28(4/5):489-498;
  • variable domains both light and heavy
  • the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is to reduce antigenicity.
  • sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
  • the human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol., 151 :2296 (1993); Chothia et al., J. Mol. Biol., 196:901 (1987), the contents of which are incorporated herein by reference herein in their entirety).
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
  • the same framework may be used for several different humanized antibodies (Carter et al, Proc. Natl. Acad. Sci. USA, 89:4285 (1992); Presta et al, J. Immunol, 151 :2623 (1993), the contents of which are incorporated herein by reference herein in their entirety).
  • Antibodies can be humanized with retention of high affinity for the target antigen and other favorable biological properties.
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate
  • immunoglobulin sequence i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind the target antigen.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen, is achieved.
  • the CDR residues are directly and most substantially involved in influencing antigen binding.
  • a source of T cells is obtained from a subject.
  • subjects include humans, dogs, cats, mice, rats, and transgenic species thereof.
  • the subject is a human.
  • T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, spleen tissue, umbilical cord, and tumors. In certain embodiments, any number of T cell lines available in the art, may be used.
  • T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll separation.
  • cells from the circulating blood of an individual are obtained by apheresis or leukapheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media, such as phosphate buffered saline (PBS) or wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations, for subsequent processing steps.
  • PBS phosphate buffered saline
  • wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations, for subsequent processing steps.
  • the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • T cells are isolated from peripheral blood by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient.
  • T cells can be isolated from umbilical cord.
  • a specific subpopulation of T cells can be further isolated by positive or negative selection techniques.
  • the cord blood mononuclear cells so isolated can be depleted of cells expressing certain antigens, including, but not limited to, CD34, CD8, CD14, CD19 and CD56. Depletion of these cells can be accomplished using an isolated antibody, a biological sample comprising an antibody, such as ascites, an antibody bound to a physical support, and a cell bound antibody.
  • Enrichment of a T cell population by negative selection can be accomplished using a combination of antibodies directed to surface markers unique to the negatively selected cells.
  • a preferred method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
  • a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD1 lb, CD16, HLA-DR, and CD8.
  • the concentration of cells and surface can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion.
  • T cells can also be frozen after the washing step, which does not require the monocyte-removal step. While not wishing to be bound by theory, the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
  • the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, in a non-limiting example, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or other suitable cell freezing media. The cells are then frozen to -80°C at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20°C or in liquid nitrogen.
  • the population of T cells is comprised within cells such as peripheral blood mononuclear cells, cord blood cells, a purified population of T cells, and a T cell line.
  • peripheral blood mononuclear cells comprise the population of T cells.
  • purified T cells comprise the population of T cells.
  • the T cells are isolated from cells such as peripheral blood mononuclear cells, cord blood cells, a purified population of T cells, and a T cell line.
  • the method described herein further comprises isolating a population of T cells from peripheral blood mononuclear cells, cord blood cells, a purified population of T cells, or a T cell line.
  • expanding the T cells further includes culturing the electroporated T cells.
  • the source of the T cells to be
  • T cells are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells.
  • the present invention comprises a novel method of expanding a population of electroporated T cells comprising culturing the electroporated population, wherein the electroporated T cells within the population expand at least 10 fold. Expression of the chimeric membrane protein allows interaction with other cells in the population to stimulate and activate expansion of the electroporated T cells. In one embodiment, at least one cell in the population of cells expresses CD3.
  • the cells that express CD3 may come into contact and bind with the chimeric membrane protein that is expressed on the surface of the electroporated cells. At least one cell expressing the chimeric membrane protein may interact with another cell expressing CD3. This interaction may stimulate expansion of the electroporated T cells.
  • the cells can be ex vivo expanded using a method described in U.S. Pat. No. 5,199,942 (incorporated herein by reference). Expansion, such as described in U.S. Pat. No. 5,199,942 can be an alternative or in addition to other methods of expansion described herein.
  • ex vivo culture and expansion of T cells comprises the addition to the cellular growth factors, such as those described in U.S. Pat. No. 5,199,942, or other factors, such as flt3-L, IL-1, IL-2, IL-3 and c-kit ligand, for example as those described in Dudley et al., J.
  • expanding the T cells comprises culturing the T cells with a factor selected from the group consisting of flt3-L, IL-1, IL-2, IL-3 and c-kit ligand.
  • expanding the electroporated T cells by the methods disclosed herein can be multiplied by about 10 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, 100 fold, 200 fold, 300 fold, 400 fold, 500 fold, 600 fold, 700 fold, 800 fold, 900 fold, 1000 fold, 2000 fold, 3000 fold, 4000 fold, 5000 fold, 6000 fold, 7000 fold, 8000 fold, 9000 fold, 10,000 fold, 100,000 fold, 1,000,000 fold, 10,000,000 fold, or greater, and any and all whole or partial intergers therebetween.
  • the T cells expand in the range of about 20 fold to about 50 fold.
  • the T cells can be incubated in cell medium in a culture apparatus for a period of time or until the cells reach confluency or high cell density for optimal passage before passing the cells to another culture apparatus.
  • the culturing apparatus can be of any culture apparatus commonly used for culturing cells in vitro.
  • a period of time can be any time suitable for the culture of cells in vitro.
  • the T cell medium may be replaced during the culture of the T cells at any time. Preferably, the T cell medium is replaced about every 2 to 3 days.
  • the T cells are then harvested from the culture apparatus whereupon the T cells can be used immediately or cryopreserved to be stored for use at a later time.
  • the invention includes cryopreserving the expanded T cells.
  • the cryopreserved, expanded T cells are then thawed prior to electroporation with RNA.
  • the cryopreserved T cells are thawed prior to introducing the nucleic acid into the T cell.
  • the method of expanding the T cells can further comprise isolating the T cells and a subsequent electroporation followed by culturing.
  • the invention further comprises cryopreserving the expanded T cells.
  • the cryopreserved T cells are thawed for electroporation with the RNA encoding the bispecific antibody or BiTE molecule.
  • the cryopreserved T cells are thawed for introduction with the affinity molecule chimeric receptor or bispecific affinity molecule nucleic acid.
  • the cryopreserved T cells are thawed for electroporation with the RNA encoding the TCR.
  • the culturing step as described herein can be very short, for example less than 24 hours such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 hours.
  • the culturing step as described further herein can be longer, for example 1, 2, 3,
  • Cell culture refers generally to cells taken from a living organism and grown under controlled condition.
  • a primary cell culture is a culture of cells, tissues or organs taken directly from an organism and before the first subculture.
  • Cells are expanded in culture when they are placed in a growth medium under conditions that facilitate cell growth and/or division, resulting in a larger population of the cells.
  • the rate of cell proliferation is typically measured by the amount of time required for the cells to double in number, otherwise known as the doubling time.
  • Each round of subculturing is referred to as a passage.
  • a specific population of cells, or a cell line, is sometimes referred to or characterized by the number of times it has been passaged.
  • a cultured cell population that has been passaged ten times may be referred to as a P10 culture.
  • the primary culture i.e., the first culture following the isolation of cells from tissue, is designated P0.
  • the cells are described as a secondary culture (PI or passage 1).
  • PI secondary culture
  • P2 or passage 2 tertiary culture
  • the number of population doublings of a culture is greater than the passage number.
  • the expansion of cells (i.e., the number of population doublings) during the period between passaging depends on many factors, including but is not limited to the seeding density, substrate, medium, and time between passaging.
  • the cells may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between.
  • Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-gamma, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGF-beta, and TNF-a. or any other additives for the growth of cells known to the skilled artisan.
  • serum e.g., fetal bovine or human serum
  • IL-2 interleukin-2
  • insulin IFN-gamma
  • IL-4 interleukin-7
  • GM-CSF GM-CSF
  • IL-10 interleukin-12
  • IL-15 IL-15
  • additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol.
  • Media can include RPMI 1640, AIM-V, DMEM, MEM, a-MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum- free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin
  • the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% C0 2 ).
  • the medium used to culture the T cells may include an agent that can co-stimulate the T cells.
  • an agent that can stimulate CD3 is an antibody to CD3
  • an agent that can stimulate CD28 is an antibody to CD28.
  • a cell isolated by the methods disclosed herein can be expanded approximately 10 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, 100 fold, 200 fold, 300 fold, 400 fold, 500 fold, 600 fold, 700 fold, 800 fold, 900 fold, 1000 fold, 2000 fold, 3000 fold, 4000 fold, 5000 fold, 6000 fold, 7000 fold, 8000 fold, 9000 fold, 10,000 fold, 100,000 fold, 1 ,000,000 fold, 10,000,000 fold, or greater.
  • the T cells expand in the range of about 20 fold to about 50 fold, or more by culturing the electroporated population.
  • the method includes introducing a nucleic acid encoding a T cell receptor (TCR) comprising affinity for a surface antigen on a target cell into the expanded T cells, and electroporating a RNA encoding a co-stimulatory molecule into the TCR.
  • TCR T cell receptor
  • T cells wherein the electroporated T cells are capable of expressing the TCR and the co- stimulatory molecule.
  • the method further comprises stimulating the expanded T cells with at least one co-stimulatory molecule selected from the group consisting of CD3, CD27, CD28, CD83, CD86, CD127, 4-1BB, 4-1BBL, PD1 and PD1L.
  • the stimulation may include co-electroporation with RNA encoding the co-stimulatory molecule.
  • the expanded T cells are further electroporated or co-electroporated with a RNA encoding CD3.
  • the CD3 includes comprises at least two different CD3 chains, such as CD3 zeta and epsilon chains.
  • the method of expanding the T cells can further comprise isolating the expanded T cells for further applications.
  • the method of expanding can further comprise a subsequent electroporation of the expanded T cells followed by culturing.
  • the subsequent electroporation may include
  • the subsequent electroporation may include introducing a nucleic acid encoding an agent, such as a transducing the expanded T cells, transfecting the expanded T cells, or electroporating the expanded T cells with a nucleic acid encoding a TCR, into the expanded population of T cells, wherein the agent further stimulates the T cell.
  • the agent may stimulate the T cells, such as by stimulating further expansion, effector function, or another T cell function.
  • the agent nucleic acid is co-electroporated with the chimeric membrane protein RNA.
  • the agent nucleic acid such as a bispecific antibody or BiTE molecule RNA or TCR RNA, is electroporated after culturing the electroporated population.
  • the agent RNA such as a bispecific antibody or BiTE molecule RNA
  • the agent nucleic acid such as a TCR RNA
  • the agent nucleic acid is electroporated after culturing the electroporated population.
  • the agent nucleic acid is electroporated into expanded T cells that were cryopreserved.
  • the modified T cells are cryopreserved after electroporation with the RNA encoding the bispecific antibody or BiTE molecule.
  • the modified T cells are cryopreserved after introduction with the nucleic acid encoding the TCR.
  • the modified T cells are cryopreserved after introduction with the nucleic acid encoding a chimeric ligand engineered activation receptor (CLEAR).
  • CLEAR chimeric ligand engineered activation receptor
  • the modified T cells are cryopreserved after introduction with the nucleic acid encoding affinity molecule chimeric receptor.
  • the modified cells are cryopreserved after introduction with the nucleic acid encoding bispecific affinity molecule. Therapy
  • the modified T cells described herein may be included in a composition for therapy.
  • the composition may include a pharmaceutical composition and further include a pharmaceutically acceptable carrier.
  • a therapeutically effective amount of the pharmaceutical composition comprising the modified T cells may be administered.
  • the invention includes a method for stimulating a T cell-mediated immune response to a target cell or tissue in a subject comprising administering to a subject an effective amount of a modified T cell.
  • the invention includes a method for adoptive cell transfer therapy comprising administering a population of modified T cells to a subject in need thereof to prevent or treat an immune reaction that is adverse to the subject.
  • the invention includes a method of treating a disease or condition associated with enhanced immunity in a subject comprising administering a population of modified T cells to a subject in need thereof.
  • the modified T cells have been expanded and electroporated with RNA encoding a modified T cell receptor (TCR) comprising affinity for a surface antigen on a target cell.
  • TCR modified T cell receptor
  • the modified T cells have been expanded and electroporated with RNA encoding a modified T cell receptor (TCR) and RNA encoding a bispecific antibody, such as a bispecific T-cell engager (BiTE) molecule, comprising bispecificity for an antigen on a target cell and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and
  • the modified T cells comprise a nucleic acid encoding an affinity molecule chimeric receptor comprising a small molecule extracellular domain with affinity for an antigen on a target cell.
  • the modified cells comprise a nucleic acid encoding a bispecific affinity molecule comprising an affinity domain capable of binding an antigen on a target cell and an affinity domain capable of binding an antigen on an activating T cell, wherein at least one affinity domain comprises a small molecule antigen binding domain.
  • the modified T cells have been expanded and introduced with a nucleic acid encoding a chimeric ligand engineered activation receptor (CLEAR) and a nucleic acid encoding a bispecific antibody with bispecificity for an antigen on the target cell and the CLEAR on the T cell.
  • a nucleic acid encoding a chimeric ligand engineered activation receptor (CLEAR) and a nucleic acid encoding a bispecific antibody with bispecificity for an antigen on the target cell and the CLEAR on the T cell.
  • CLEAR chimeric ligand engineered activation receptor
  • the modified T cells have been expanded and electroporated with RNA encoding a bispecific T-cell engager (BiTE) molecule comprising bispecificity for an antigen on a target cell, and an antigen on an activating T cell selected from the group consisting of CD3, CD4, CD8, and TCR.
  • BiTE bispecific T-cell engager
  • the modified T cells may be administered to induce lysis of the target cell or tissue, such as where the induced lysis is antibody-dependent cell-mediated cytotoxicity (ADCC).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • the modified T cells generated as described herein possess T cell function.
  • the modified T cells can be administered to a mammal, preferably a human, to suppress an immune reaction, such as those common to autoimmune diseases such as diabetes, psoriasis, rheumatoid arthritis, multiple sclerosis, GVHD, enhancing allograft tolerance induction, transplant rejection, and the like.
  • the cells of the present invention can be used for the treatment of any condition in which a diminished or otherwise inhibited immune response, especially a cell-mediated immune response, is desirable to treat or alleviate the disease.
  • the invention includes treating a condition, such as an autoimmune disease, in a subject, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising a population of modified T cells.
  • autoimmune disease examples include but are not limited to, Acquired
  • Immunodeficiency Syndrome (AIDS, which is a viral disease with an autoimmune component), alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease,
  • AIDS which is a viral disease with an autoimmune component
  • alopecia areata ankylosing spondylitis
  • antiphospholipid syndrome autoimmune Addison's disease
  • autoimmune hemolytic anemia autoimmune hepatitis
  • AIED autoimmune inner ear disease
  • ALPS autoimmune lymphoproliferative syndrome
  • ATP autoimmune thrombocytopenic purpura
  • cardiomyopathy celiac sprue-dermatitis hepetiformis
  • CFDS chronic fatigue immune dysfunction syndrome
  • CIPD chronic inflammatory demyelinating polyneuropathy
  • cicatricial pemphigoid cold agglutinin disease
  • crest syndrome Crohn's disease
  • Degos' disease dermatomyositis-juvenile, discoid lupus, essential mixed
  • cryoglobulinemia fibromyalgia- fibromyositis, Graves' disease, Guillain-Barre syndrome,
  • Hashimoto's thyroiditis idiopathic pulmonary fibrosis, idiopathic thrombocytopenia purpura (ITP), IgA nephropathy, insulin-dependent diabetes mellitus, juvenile chronic arthritis (Still's disease), juvenile rheumatoid arthritis, Meniere's disease, mixed connective tissue disease, multiple sclerosis, myasthenia gravis, pernacious anemia, polyarteritis nodosa, polychondritis, polyglandular syndromes, polymyalgia rheumatica, polymyositis and dermatomyositis, primary agammaglobulinemia, primary biliary cirrhosis, psoriasis, psoriatic arthritis, Raynaud's phenomena, Reiter's syndrome, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma (progressive systemic sclerosis (PS
  • the modified T cells generated as described herein can also be expanded and used to treat inflammatory disorders.
  • inflammatory disorders include but are not limited to, chronic and acute inflammatory disorders.
  • inflammatory disorders include Alzheimer's disease, asthma, atopic allergy, allergy, atherosclerosis, bronchial asthma, eczema, glomerulonephritis, graft vs. host disease, hemolytic anemias, osteoarthritis, sepsis, stroke, transplantation of tissue and organs, vasculitis, diabetic retinopathy and ventilator induced lung injury.
  • the T cells described herein may be used for the manufacture of a medicament for the treatment of an immune response in a subject in need thereof.
  • the invention includes the modified cell described herein for use in a method of treating an immune response in a subject in need thereof.
  • the cells of the present invention can be administered to an animal, preferably a mammal, even more preferably a human, to treat a cancer.
  • the cells of the present invention can be used for the treatment of any condition related to a cancer, especially a cell-mediated immune response against a tumor cell(s), where it is desirable to treat or alleviate the disease.
  • cancers include but are not limited breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer, thyroid cancer, and the like.
  • Cells of the invention can be administered in dosages and routes and at times to be determined in appropriate pre-clinical and clinical experimentation and trials. Cell compositions may be administered multiple times at dosages within these ranges.
  • Administration of the cells of the invention may be combined with other methods useful to treat the desired disease or condition as determined by those of skill in the art.
  • the cells of the invention to be administered may be autologous, allogeniec or xenogenic with respect to the subject undergoing therapy.
  • the administration of the cells of the invention may be carried out in any convenient manner known to those of skill in the art.
  • the cells of the present invention may be administered to a subject by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation.
  • the compositions described herein may be administered to a patient transarterially, subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (z ' .v.) injection, or intraperitoneally.
  • the cells of the invention are injected directly into a site of inflammation in the subject, a local disease site in the subject, alymph node, an organ, a tumor, and the like.
  • the cells described herein can also be administered using any number of matrices.
  • the present invention utilizes such matrices within the novel context of acting as an artificial lymphoid organ to support, maintain, or modulate the immune system, typically through modulation of T cells. Accordingly, the present invention can utilize those matrix compositions and formulations which have demonstrated utility in tissue engineering. Accordingly, the type of matrix that may be used in the compositions, devices and methods of the invention is virtually limitless and may include both biological and synthetic matrices.
  • Matrices comprise features commonly associated with being biocompatible when administered to a mammalian host. Matrices may be formed from natural and/or synthetic materials. The matrices may be non-biodegradable in instances where it is desirable to leave permanent structures or removable structures in the body of an animal, such as an implant; or biodegradable. The matrices may take the form of sponges, implants, tubes, telfa pads, fibers, hollow fibers, lyophilized components, gels, powders, porous compositions, or nanoparticles.
  • matrices can be designed to allow for sustained release of seeded cells or produced cytokine or other active agent.
  • the matrix of the present invention is flexible and elastic, and may be described as a semisolid scaffold that is permeable to substances such as inorganic salts, aqueous fluids and dissolved gaseous agents including oxygen.
  • a matrix is used herein as an example of a biocompatible substance.
  • the current invention is not limited to matrices and thus, wherever the term matrix or matrices appears these terms should be read to include devices and other substances which allow for cellular retention or cellular traversal, are biocompatible, and are capable of allowing traversal of macromolecules either directly through the substance such that the substance itself is a semi-permeable membrane or used in conjunction with a particular semi-permeable substance.
  • compositions of the present invention may comprise a modified T cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins;
  • compositions of the present invention are preferably formulated for intravenous administration.
  • compositions of the present invention may be administered in a manner appropriate to the disease to be treated (or prevented).
  • the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • a pharmaceutical composition comprising the modified T cells described herein may be administered at a dosage of 10 4 to 10 9 cells/kg body weight, preferably 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages.
  • the cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988).
  • the optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
  • T cells can be activated from blood draws of from 10 ml to 400 ml.
  • T cells are activated from blood draws of 20 ml, 30 ml, 40 ml, 50 ml, 60 ml, 70 ml, 80 ml, 90 ml, or 100 ml.
  • using this multiple blood draw/multiple reinfusion protocol may select out certain populations of T cells.
  • cells expanded and modified using the methods described herein, or other methods known in the art where T cells are expanded to therapeutic levels are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as ARA-C) or natalizumab treatment for MS patients or efalizumab treatment for psoriasis patients or other treatments for PML patients.
  • the T cells of the invention may be used in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other
  • immunoablative agents such as CAM PATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludaribine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, and irradiation.
  • These drugs inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p70S6 kinase that is important for growth factor induced signaling (rapamycin).
  • rapamycin growth factor induced signaling
  • the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either
  • the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
  • B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
  • subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation.
  • subjects receive an infusion of the expanded immune cells of the present invention.
  • expanded cells are administered before or following surgery.
  • the dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment.
  • the scaling of dosages for human administration can be performed according to art-accepted practices.
  • the dose for CAMPATH for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between 1 and
  • the preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Patent No. 6,120,766).
  • T cells Primary human lymphocytes. Primary lymphocytes were stimulated with microbeads coated with CD3 and CD28 stimulatory antibodies (Life Technologies, Grand Island, NY, Catalog) as described ⁇ Human gene therapy 2011, 22(12): 1575-1586). T cells were cryopreserved at day 10 in a solution of 90% fetal calf serum and 10% dimethylsulfoxide (DMSO) at 1 x 10 8 cells/vial.
  • DMSO dimethylsulfoxide
  • TCR constructs for mRNA electroporation and lentiviral transduction 1G4 NY-ESO-1 TCR with different mutations were synthesized and/or amplified by PCR, based on sequencing information provided by the relevant publications (The Journal of experimental medicine 2005, 201(8): 1243-1255; J Immunol 2008, 180(9):6116-6131), and subcloned into pGEM.64A R A based vector or pTRPE lenti viral vectors.
  • T7 mscript systems kit CellScript
  • IVTT in vitro transcribed RNA
  • CD3/CD28 bead stimulated T cells were electroporated with IVT RNA using BTX EM830 (Harvard
  • Apparatus BTX as previously described (Cancer research 2010, 70(22):9053-9061). Briefly, T cells were washed three times and resuspended in OPTI-MEM (Invitrogen) at a final concentration of 1-3 x 10 8 cells/ml. Subsequently, 0.1 ml of cells were mixed with 10 ug IVT RNA (or as indicated) and electroporated in a 2 mm cuvette.
  • Target cells different tumor cell lines expressing CD 19, were washed and suspended at lxl 0 6 cells/ml in R10 medium (RPMI 1640 supplemented with 10% fetal calf serum; Invitrogen). 100 ul of each target cell type was added in duplicate to a 96 well round bottom plate (Corning). Effector T cells were washed, and re- suspended at lxl 0 6 cells/ml in R10 medium and then 100 ul of T cells were combined with the target cells in the indicated wells. In addition, wells containing T cells alone were prepared as a control. The plates were incubated at 37° C for 18 to 20 hours. After the incubation, supernatant was harvested and subjected to an ELISA assay (eBioscience, 88-7316-77; 88-7025-77).
  • CD107a staining Cells were plated at an Effector cell:T cell ratio of 1 : 1 (lxlO 5 effectors to lxl 0 5 targets) in 160 ⁇ of complete RPMI medium in a 96 well plate.
  • 20 ⁇ of phycoerythrin-labeled anti-CD107a antibody (BD Biosciences, 555801) was added and the plate was incubated at 37° C for 1 hour before adding Golgi Stop (2 ul Golgi Stop in 3 ml RPMI medium, 20 ul/well; BD Biosciences, 51-2092KZ ) and incubating the plate for another 2.5 hours.
  • 5 ⁇ FITC-anti-CD8 and 5 ul APC-anti-CD3 were added and incubated at 37° C for 30 min. After incubation, the samples were washed with FACS buffer and analyzed by flow cytometry.
  • Luciferase based CTL assay Naml6-CBG tumor cells were generated and employed in a modified version of a luciferase based cytotoxic T lymphocyte assay. Briefly, click beetle green luciferase (CBG) was cloned into the pELNS vector, packaged into lentivirus, transduced into Naml6 tumor cells and sorted for CBG expression. The resulting Naml6-CBG cells were washed and resuspended at lxl 0 5 cells/ml in R10 medium, and 100 ul of CBG-labeled cells were incubated with different ratios of T cells (e.g. 30: 1, 15: 1, etc) overnight at 37° C. 100 ul of the mixture was transferred to a 96 well white luminometerplate. 100 ul of substrate was added to the cells and luminescence was immediately determined.
  • CBG click beetle green luciferase
  • mice 6-10 week old NOD/SCID gamma (NSG) mice were injected subcutaneously with lxlO 6 PC3-CBG tumors cells on the right flank at day 0 and the same mice were given SK-OV3-CBG tumor cells (5xl0 6 cells/mouse, subcutaneously.) on the left flank at day 5.
  • the mice were treated with T cells via the tail vein at day 23 post PC3-CBG tumor inoculation, such that both tumors were approximately 200 mm 3 in volume.
  • Lentivirally transduced T cells were given at lxlO 7 cells/mouse (10M), or 3xl0 6 cells/mouse (3M).
  • IVT in vitro transcription
  • RNA in vitro transcription IVTT
  • IVT RNA in vitro transcription
  • kit such as mMESSAGE mMACHINE® T7 Ultra (Ambion, Inc)
  • ARC A Anti-Reverse Cap Analog
  • the IVT RNA products were purified using an RNeasy Mini Kit (Qiagen, Inc., Valencia, CA) and purified RNA was eluted in RNase-free water at 1-2 mg/ml.
  • RNA electroporation of T cells Purified resting T cells or CD3/CD28 bead- stimulated T cells were electroporated using BTX EM830 (Harvard Apparatus BTX, Holliston, MA, USA). The T cells subjected to electroporation were washed three times with OPTI-MEM (Invitrogen) and were re-suspended in OPTI-MEM at the final concentration of l-3xl0 8 /ml. Subsequently, 0.1 ml of the cells was mixed with 10 ug IVT RNA (or as indicated) and electroporated in a 2-mm cuvette as described (Zhao et al.,
  • Target cells were washed and suspended at 10 6 cells/mL in RIO.
  • One hundred thousand cells of each target cell type were added to each of 2 wells of a 96 well round bottom plate (Corning).
  • Effector T cell cultures were washed and suspended at 10 6 cells/mL in RIO.
  • One hundred thousand effector T cells were combined with target cells in the indicated wells of the 96 well plate.
  • wells containing T cells alone were prepared. The plates were incubated at 37°C for 18 to 20 hours. After the incubation, supernatant was harvested and subjected to an ELISA assay using standard methods (Pierce, Rockford, IL).
  • CD107a staining Cells were plated at an E:T of 1 : 1 (10 5 effectors: 10 5 targets) in 160 ⁇ of complete RPMI medium in a 96 well plate. 20 ⁇ of phycoerythrin-labeled anti-
  • CD 107a antibody (BD Pharmingen, San Diego, CA) was added and the plate was incubated at 37°C for 1 hour before adding Golgi Stop and incubating for another 2.5 hours. After 2.5 hours 10 ⁇ FITC-anti-CD8 and APC-anti-CD3 was added and incubated at 37°C for 30 min. After incubation, the samples were washed once with FACS buffer. Flow cytometry acquisition was performed with a BD FacsCalibur (BD Biosciences), and analysis was performed with Flow Jo (Treestar Inc, Ashland, OR).
  • Primary human lymphocytes Primary lymphocytes. Primary lymphocytes were stimulated with microbeads coated with CD3 and CD28 stimulatory antibodies (Life Technologies, Grand).
  • T cells were cryopreserved at day 10 in a solution of 90% fetal calf serum and 10% dimethylsulfoxide (DMSO) at 1 x 10 8 cells /vial.
  • DMSO dimethylsulfoxide
  • ART constructs for mRNA electroporation.
  • VDNKFNKEM WAA WEEIRNLPNLNG WQMT AFI ASL VDDP S Q S ANLL AE AKKLND AQAPK
  • VDNKFEKEMR AYWEIALLPNLTNQQKRAFIRSLYDDPSQSANLLAEAKKLNDA QAPK Table 1 Affinity of the Affinity Antibody Mimetics.
  • the first is CAR based ART ( Figure 28, upper panel): that is composed of a signal peptide (SP) from human CD8 alpha, affinity antibody mimetic, 6X His tag (His- Tag), human CD8 alpha hinge and transmembrane (CD8 Hinge&TM), 4- IBB
  • TCR based ART (Fig. 28 lower panel): that potentially could target multiple tumor antigens simultaneously, which is composed of a signal peptide (SP) from human CD8 alpha, ErbB2 affinity antibody mimetic (ZHER2.342, ZHER2.342-15, ZHER2.342- 14 or ZHER2.342-4) and full length 1G4 NY-ESO-1 TCR alpha or beta chain.
  • SP signal peptide
  • BiTEs Bi-specific T-cell engager
  • ZHER2.342-15, ZHER2.342-14 or ZHER2.342-4 GS lmker(or EGFR affinity antibody mimetic and GS linker) and CD3 affinity antibody mimetic (or scFv).
  • RNA RNA.
  • CD3/CD28 bead stimulated T cells were electroporated with IVT RNA using BTX EM830 (Harvard Apparatus BTX) as previously described (Zhao, et al, Cancer research 2010, 70(22):9053-9061). Briefly, T cells were washed three times and resuspended in OPTI-MEM (Invitrogen) at a final concentration of 1-3 x 10 8 cells /ml. Subsequently, 0.1 ml of cells were mixed with lOug IVT RNA (or as indicated) and electroporated in a 2mm cuvette.
  • OPTI-MEM Invitrogen
  • Target cells were washed and suspended at lx 10 6 cells/ml in R10 medium (RPMI 1640 supplemented with 10% fetal calf serum; Invitrogen). lOOul each target cell type were added in duplicate to a 96 well round bottom plate (Corning).
  • Effector T cells were washed, and re-suspended at lx 10 6 cells/ml in R10 medium and then lOOul of T cells were combined with target cells in the indicated wells. In addition, wells containing T cells alone were prepared. The plates were incubated at 37°C for 18 to 20 hours. After the incubation, supernatant was harvested and subjected to an ELISA assay (eBioscience, 88-7316-77; 88-7025-77).
  • CD107a staining Cells were plated at an E:T of 1 : 1 (1 x 10 5 effectors: 1 x 10 5 targets) in 160 ⁇ of complete RPMI medium in a 96 well plate. 20 ⁇ 1 of phycoerythrin- labeled anti-CD107a Ab (BD Biosciences, 555801) was added and the plate was incubated at 37°C for 1 hour before adding Golgi Stop (2ul Golgi Stop in 3ml RPMI medium, 20ul/well; BD Biosciences, 51-2092KZ ) and incubating for another 2.5 hours. Then 5 ⁇ FITC-anti-CD8 and 5ul APC-anti-CD3 were added and incubated at 37°C for 30 min. After incubation, the samples were washed with FACS buffer and analyzed by flow cytometry.
  • SK-OV3-CBG tumor cells were generated and employed in a modified version of a luciferase based CTL assay as follows: Click beetle green luciferase (CBG) was cloned into the pELNS vector, packaged into lentivirus, transduced into SK-OV3 tumor cells and sorted for CBG expression. Resulting SK-OV3-
  • CBG cells were washed and resuspended at 1 x 10 5 cells /ml in R10 medium, and 100 ul of CBG-labeled cells were incubated with different ratios of T cells (e.g. 30: 1, 15: 1, etc) 8h at 37°C. lOOul of the mixture was transferred to a 96 well white luminometerplate, lOOul of substrate was added and the luminescence was immediately determined.
  • T cells e.g. 30: 1, 15: 1, etc
  • IVT in vitro transcription
  • All CARs CD 19, mesothelin, cMet, GD2, PSCA, EGFRviii and ErBB2
  • the RNA encoding bispecific antibodies Bis-RNAs
  • the PCR products were subcloned into pGEM.64A based vector by replacing GFP of pGEM-GFP.64A (Zhao et al, 2003, Blood 102:4137-4142) to produce pGEM.64A based CAR or Bis-RNA vectors.
  • DNA encoding Blinatumomab and the fully human CD 19 CAR (21D4-BBZ) and Bis-RNA (21D4-F11) were synthesised and assembled by PCR based on sequencing information provided from the published patent No.: US2013/050275.
  • RNA in vitro transcription IVT.
  • IVTT RNA in vitro transcription
  • kit such as mMESSAGE mMACHINE® T7 Ultra (Ambion, Inc)
  • ARC A Anti-Reverse Cap Analog
  • the IVT RNA products were purified using an RNeasy Mini
  • RNA was eluted in RNase-free water at 1-2 mg/ml.
  • RNA electroporation of T cells Purified resting T cells or CD3/CD28 bead- stimulated T cells were electroporated using BTX EM830 (Harvard Apparatus BTX, Holliston, MA, USA). The T cells subjected to electroporation were washed three times with OPTI-MEM (Invitrogen) and were re-suspended in OPTI-MEM at the final concentration of l-3xl0 8 /ml. Subsequently, 0.1 ml of the cells was mixed with 10 ug IVT RNA (or as indicated) and electroporated in a 2-mm cuvette as described (Zhao et al., 2010, Cancer Res 70:9053-9061).
  • Target cells were washed and suspended at 10 6 cells/mL in R10.
  • One hundred thousand cells of each target cell type were added to each of 2 wells of a 96 well round bottom plate (Corning).
  • Effector T cell cultures were washed and suspended at 10 6 cells/mL in R10.
  • One hundred thousand effector T cells were combined with target cells in the indicated wells of the 96 well plate.
  • wells containing T cells alone were prepared. The plates were incubated at 37°C for 18 to 20 hours. After the incubation, supernatant was harvested and subjected to an ELISA assay using standard methods (Pierce, Rockford, IL). CD107a staining.
  • Cells were plated at an E:T of 1 : 1 (10 5 effectors: 10 5 targets) in 160 ⁇ of complete RPMI medium in a 96 well plate.
  • 20 ⁇ of phycoerythrin-labeled anti- CD 107a antibody (BD Pharmingen, San Diego, CA) was added and the plate was incubated at 37°C for 1 hour before adding Golgi Stop and incubating for another 2.5 hours.
  • 10 ⁇ FITC-anti-CD8 and APC-anti-CD3 was added and incubated at 37°C for 30 min. After incubation, the samples were washed once with FACS buffer.
  • Flow cytometry acquisition was performed with a BD FacsCalibur (BD Biosciences), and analysis was performed with Flow Jo (Treestar Inc, Ashland, OR).
  • T cells at a concentration of lOxlO 6 / mL in PBS were labeled with CFSE at 3 ⁇ for 3 min and 30 sec at room temperature. The labeling was stopped 5% FBS (in PBS) and washed twice with R10 and cultured in R10 with 10 IU/ml IL-2. After overnight culture, the CFSE labeled T cells were
  • T cells were stimulated with irradiated tumor or K562 cell lines at T:stimulator at 1 : 1.
  • CFSE dilution was examined by flow cytometry and cell number was counted at the time as indicated.
  • CBG Click beetle green luciferase
  • CBG tumor cells were sorted for CBG expression.
  • the resulting CBG tumor cells were washed and resuspended at lxl 0 5 cells/ml in R10 medium, and 100 ul of CBG-labeled cells were incubated with different ratios of T cells (e.g. 30: 1, 15: 1, etc) overnight at 37°C.
  • 100 ul of the mixture was transferred to a 96 well white luminometer plate. 100 ul of substrate was added to each well and luminescence was immediately determined.
  • CD 19+ human ALL line was transduced with CBG (Nalm6-CBG) and injected via the tail vein in 0.2 ml of sterile PBS in the dosage of one million cells. T cells were injected via the tail vein 7 days after injection of Nalm-6-CBG. Bioluminescence imaging (BLI). Tumor growth was monitored by BLI.
  • CBG Neuronalm6-CBG
  • BLI Bioluminescence imaging
  • mice were imaged using a Xenogen Spectrum system and Living Image v3.2 software.
  • D-luciferin Caliper Life Sciences, Hopkinton, MA
  • IP intraperitoneal
  • mice were imaged alone (for photon quantitation) or in groups of up to 5 mice (for display purposes) in the anterior-posterior prone position at the same relative time point after luciferin injection (6 minutes). Data were collected until the midrange of the linear scale was reached (600 to 60000 counts) or maximal exposure settings reached (f/stop 1, large binning and 1-2 seconds), and then converted to photons/second/cm2/steradian to normalize each image for exposure time, f/stop, binning and animal size. For anatomic localization, a pseudocolor map representing light intensity was superimposed over the grayscale body-surface reference image. For data display purposes, mice without luciferase containing cells were imaged at maximal settings and a mean value of 3.6 xlO 5 p/s/cm2/sr was obtained.
  • T cells Primary human lymphocytes. Primary lymphocytes were stimulated with microbeads coated with CD3 and CD28 stimulatory antibodies (Life Technologies, Grand Island, NY, Catalog) as described ⁇ Human gene therapy 2011, 22(12): 1575-1586). T cells were cryopreserved at day 10 in a solution of 90% fetal calf serum and 10% dimethylsulfoxide (DMSO) at 1 x 10 8 cells/vial.
  • DMSO dimethylsulfoxide
  • T7 mscript systems kit CellScript
  • IVTT in vitro transcribed RNA
  • CD3/CD28 bead stimulated T cells were electroporated with IVT RNA using BTX EM830 (Harvard
  • Apparatus BTX as previously described (Cancer research 2010, 70(22):9053-9061). Briefly, T cells were washed three times and resuspended in OPTI-MEM (Invitrogen) at a final concentration of 1-3 x 10 8 cells/ml. Subsequently, 0.1 ml of cells were mixed with 10 ug IVT RNA (or as indicated) and electroporated in a 2 mm cuvette.
  • Target cells different tumor cell lines expressing CD 19, were washed and suspended at lxl 0 6 cells/ml in R10 medium (RPMI 1640 supplemented with 10% fetal calf serum; Invitrogen). 100 ul of each target cell type was added in duplicate to a 96 well round bottom plate (Corning). Effector T cells were washed, and re- suspended at lxl 0 6 cells/ml in R10 medium and then 100 ul of T cells were combined with the target cells in the indicated wells. In addition, wells containing T cells alone were prepared as a control. The plates were incubated at 37° C for 18 to 20 hours. After the incubation, supernatant was harvested and subjected to an ELISA assay (eBioscience, 88-7316-77; 88-7025-77).
  • CD107a staining Cells were plated at an Effector cell:T cell ratio of 1 : 1 (lxlO 5 effectors to lxlO 5 targets) in 160 ⁇ of complete RPMI medium in a 96 well plate.
  • 20 ⁇ of phycoerythrin-labeled anti-CD107a antibody (BD Biosciences, 555801) was added and the plate was incubated at 37° C for 1 hour before adding Golgi Stop (2 ul Golgi Stop in 3 ml RPMI medium, 20 ul/well; BD Biosciences, 51-2092KZ ) and incubating the plate for another 2.5 hours.
  • 5 ⁇ FITC-anti-CD8 and 5 ul APC-anti-CD3 were added and incubated at 37° C for 30 min. After incubation, the samples were washed with FACS buffer and analyzed by flow cytometry.
  • Luciferase based CTL assay Naml6-CBG tumor cells were generated and employed in a modified version of a luciferase based cytotoxic T lymphocyte assay. Briefly, click beetle green luciferase (CBG) was cloned into the pELNS vector, packaged into lentivirus, transduced into Naml6 tumor cells and sorted for CBG expression. The resulting Naml6-CBG cells were washed and resuspended at lxl 0 5 cells/ml in R10 medium, and 100 ul of CBG-labeled cells were incubated with different ratios of T cells (e.g. 30: 1, 15: 1, etc) overnight at 37° C. 100 ul of the mixture was transferred to a 96 well white luminometerplate. 100 ul of substrate was added to the cells and luminescence was immediately determined.
  • CBG click beetle green luciferase
  • mice 6-10 week old NOD/SCID gamma (NSG) mice were injected subcutaneously with lxlO 6 PC3-CBG tumors cells on the right flank at day 0 and the same mice were given SK-OV3-CBG tumor cells (5xl0 6 cells/mouse, subcutaneously.) on the left flank at day 5.
  • the mice were treated with T cells via the tail vein at day 23 post PC3-CBG tumor inoculation, such that both tumors were approximately 200 mm 3 in volume.
  • Lentivirally transduced T cells were given at lxlO 7 cells/mouse (10M), or 3xl0 6 cells/mouse (3M).
  • Example 1 T cells expressing TCRs and bispecific antibodies.
  • the T cells were compared to assess the in vivo potency of T lymphocytes that expressed exogenous TCR and bispecific antibodies in Naml6 leukemia and A549 lung cancer mouse models.
  • T cells were electroporated with TCR RNA and bispecific T cell engagers (BiTEs).
  • Figure 1 shows transgene expression in the T cells co-electroporated with TCR and BiTEs.
  • T cells were co-electroporated with CD19.CD3 (upper panel) or 4D5.CD3 (ErbB2) (middle panel) BiTEs with or without CD3zeta and epsilon.
  • T cells were stained for TCR vbl3.1 and mlgG Fab (or Her2-Fc).
  • Lower panel shows TCR (vbl3.1) expression 3 days after electroporation
  • FIGS 2 and 3 illustrate CD 107a was up-regulated in T cells after stimulation with tumor cells.
  • the T cells were co-electroporated with TCR RNA and BiTEs RNA, then stimulated with tumor cell lines having single or double positivity for CD 19 and NY-ESO-1 (ESO). Both IFN- gamma and IL-2 production was increased in co-electroporated T cells ( Figures 4 and 5).
  • CD 107a was up-regulated in tumor stimulated T cells expressing NY-ESO-1 TCR (1G4) and mesothelin BiTEs (ssl .CD3) ( Figure 6).
  • the cells co-expressing the TCR and BiTEs were injected into a leukemia mouse model.
  • NOD/SCID (NSG) mouse models RNA electroporated T cells expressing NY- EOS- 1 wildtype TCR and CD19.CD3 BiTEs were injected five days after tumor cell injection (Figure 7). It was found that T cells electroporated with NY-ESO-1 wildtype TCR RNA and CD19.CD3 BiTEs showed potent anti -tumor activity, while T cells with NY-ESO-1 TCR were much less potent (Figure 8).
  • T cells expressing modified TCRs also recognized both cognate and MHC/peptide and surface tumor antigens without HLA restriction when combined with bi-specific antibodies in the T cells (Figure 9).
  • a list of the constructs of bi-specific antibody RNAs and TCR RNAs electroporated into T cells is shown in Figures 10A and 10B.
  • T cells expressing the modified NY-ESO-1 TCR and bi-specific antibodies recognized both cognate antigen (HLA-A2/NY-ESO-1) and CD19 or Her2 (Figure 11).
  • Example 2 T cells modified with bispecific antibodies and CLEARs.
  • the novel molecule was named "chimeric ligand engineered activation receptors (CLEARs)" (target- 1) and was composed of an intracellular T cell activation signaling domain, such as CD3 zeta with or without co-stimulatory signal, and an extracellular domain.
  • the extracellular domain was chosen to: 1) recognize an antibody or a specific receptor/ligand and, 2) specifically bind to either a tumor antigen or other molecule that is not expressed on healthy tissues.
  • the cells were also engineered to express bi-specific antibodies or fusion proteins bind tumor antigen (target 2) on one side and the extracellular domain of the CLEARs on the other side. This was to enable T cell recognition of a second tumor expression target (Figure 12).
  • the CLEAR targeted target- 1 and at the same time bound to the secreted bi-specific antibody (or fusion protein).
  • the T cells were triggered by either direct recognition of target- 1 and/or by simultaneous engagement with CLEARs at target-2 on the tumor cell and secreted bi- specific antibody (or fusion protein).
  • two receptor/ligand targets PD1/PD-L1 and CD27/CD70 important targets in immunotherapy of cancers, were chosen to generate PD1 or CD27 CLEARs.
  • Mesothelin, ErbB2 and CD 19 were used as target 2 antigens.
  • Three scFv with different affinities against PD1 (2D3, 4A11 and 4H1)(5) or CD27 (C2177, M709 and M708)(6) were chosen and bi-specific constructs were made with scFv against all the target-2 ligands mentioned above.
  • CD27 CLEARs with different co-stimulatory or co-receptor signaling domains were also constructed.
  • CD27 CLEARs were constructed using either CD27 (CD27-Z) (7) or CD27-4-1BB (CD27-BBZ) signaling domains ( Figures 13A and 13B). All the constructs were made into RNA via in vitro transcription (IVT) vectors and IVT RNA made and used to electroporate CD3/CD28 bead stimulated T cells.
  • PD1 or CD27 CLEARs redirected T cells targeting PDL1 or CD70 positive tumors.
  • T cells expressing either CD27 or PD1 CLEARs alone were tested. It was found that CD27 CLEARs could be expressed on the cell surface ( Figure 14). When the T cells were stimulated with tumor lines that express CD70, the T cells were specifically activated, which was evidenced by significant up-regulation of CD 107a expression ( Figure 15).
  • T cell function by using different co-stimulatory (CD28 or 4- IBB) or co- receptor (CD4 or CD8) molecules, five PD1 CLEARs were tested by their expression on T cells (Figure 16) and their reactivities against PDL1 positive cell line Nalm6-PD-Ll was determined.
  • T cells with all PD1 CLEARs responded to PD-L1 positive tumor strongly as evidenced by about 50% to about 70% CD 107a up-regulation and cytokine production.
  • T cells PDl CLEARs with CD4 or CD8 co-receptor signaling showed comparable CD107a expression with other PDl CLEARs: CD28, or 4-1BB or without any co-signaling (zeta alone, PD1-Z).
  • T cells with PDl eCLEARs were tested by co-electroporating RNAs for both PDl CLEAR (PD1-Z) and RNAs for bi-specific antibody against PDl and mesothelin (2D3- ssl, 4A11-ssl and 4Hl-ssl) into T cells.
  • Flow cytometry staining showed that both CLEARs and the bi-specific antibodies could be detected (Figure 18). More importantly, when these T cells were stimulated with different cell lines that expressed either single or double target antigens, they recognized, in an antigen specific manner, either single antigen positive tumor lines, or double positive tumor lines.
  • T cells with CLEARs (PD1Z&4A1 l .ssl) showed comparable lytic ability against mesothelin single positive cell line, K562-meso, in a CD107a up-regulation assay.
  • PC3-PDL1 that was lenti-virally transduced with PD-L1 and weakly positive for medothelin
  • T cells with eCLEARs had much higher CD 107a up-regulation than T cells with ssl .bbz CAR
  • Cytokine production (IFN-gamma and IL-2) of the stimulated T cells was tested by ELISA.
  • T cells transferred with CLEARs RNA showed as high as , or even higher than ssl .BBZ CAR transferred T cells cytokine production, there was nearly no detectable cytokines for both IL-2 and IFN-gamma for CLEARs transferred T cells stimulated with either single positive or double positive target cell lines.
  • T cells transferred with ssl .bbz CAR secreted high levels of both IL-2 and IFN-gamma ( Figure 20).
  • the property of high lytic ability with low cytokine production may have benefit in treating cancer patients, since the chance of developing an adverse cytokine storm could be reduced.
  • RNA for those new bi-specifc antibodies were co-electroporated into T cells and compared with their relevant CARs (4D5.BBZ, 19.BBZ or 2B3.BBZ).
  • CD 107a expression was examined after these T cells were stimulated with tumor lines and the results showed that PD1/CD19 CLEARs (PD1-Z/2D3-CD19, PD1-Z/4A11- CD 19) could recognize CD 19 single positive tumor cells, Nalm6, as efficiently as CD 19
  • CD 19 CAR T cells decreased their reactively against CD19/PDL1 double positive Nalm6-PDL1 cells (52.2% for CD107a+/CD8+ versus 56.6%). CD107a was also slightly increased for PD1/CD19 CLEARs T cells. The results also showed that, for both PD1/4D5 and PD1/2B3 CLEARs, CD 107a expressed higher in T cells with CLEARs than with the relevant CARs when the T cells were stimulated with double positive tumors (Figure 21).
  • CD27 CLEARs against two tumor antigens, ErbB2 and CD 19 were also tested.
  • surface staining of both CD27 and mlgG Fab upper panel for CD27-Z with ErbB2 target and lower panel for CD27-Z with CD 19 target
  • CD27-Z/M708-4D5 showed significantly increased CD 107a expression, at about 33.2%, over the about 3% background levels ( Figure 23).
  • PDl/Mesothelin eCLEARs the data shown herein indicates that tumor antigens could be targeted indirectly using CLEARs and bi-specific antibodies. Thus, two tumor antigens could be targeted simultaneously without interfering each other.
  • Anti-ErbB2 4D5 is a high affinity scFv that is not for use in T cell based cancer treatments.
  • T cells with PD1 eCLEARs were tested by co-electroporating RNAs for both PD1 CLEAR (PD1-Z) and bispecific antibodies against PD1 (2D3, 4A11 or 4H1) and ErbB2 (4D5, 4D5-2, 4D5-3, 4D5-4 or 4D5-5).
  • Flow cytometry staining showed that both PD1 CLEAR and the bi-specific antibody was detectable in most of the co-electroporated T cells (Figure 24).
  • T cells were then stimulated with different tumor cell lines that expressed either single or double target antigens or K562 cells electroporated with ErbB2 and/or PD-L1 RNA (Figure 25). As showed in Figures 26 and 27, it was found that T cells co- electroporated with both PD1 CLEAR and anti-PDl/anti-ErbB2 bispecific antibody showed affinity associated T cell activity against ErbB2 high expressing cell lines, SK- OV3 and ErbB2 RNA electroporated K562. 4H1-4D5, 4H1-4D5-4 and 4D5-2 were found to have insufficient affinity to be conclusive.
  • T cells co-electroporated with PD1 CLEAR and bispecific antibody with high affinity against ErbB2 scFv (4D5), 2D3-4D5 and 4A11-4D5 showed reactivity against PD1 negative and low level ErbB2 expressing tumor cells, MCF7.
  • T cells co- electroporated with PD1 CLEAR and bispecific antibody with lower affinity against ErbB2 scFv (4D5), 4D5-5, 4D5-4 and 4D5-3 showed completely no reactivity against PD1 negative and low level ErbB2 expressing tumor cells, MCF7. This suggested that the CLEARs and bi-specific antibodies could be safely used for treating cancer patient with ErbB2 overexpressing tumors.
  • Example 3 T cells expressing affinity molecule chimeric receptors or bispecific antibodies.
  • Figure 29 is a panel of graphs showing expression of Affinity antibody mimetic redirected T cells (ARTs) by staining with anti-His antibody.
  • ARTs Affinity antibody mimetic redirected T cells
  • T cells were stained by an anti-His tag antibody for flow cytometry detection of ART expression (lower panel) and showed that T cells electroporated with all the ART RNA were stained positive, comparing with the T cells that were no electroporated (No EP).
  • Figure 30 is a panel of graphs showing specific CD 107a up-regulation of EGFR and ErbB2 ARTs. Electroporated T cells as shown in Figure 29 were stimulated with 4 different tumor cell lines that express EGFR and/or ErbB2 as indicated below the name of each tumor. After 4h incubation, CD 107a upregulation was measured by staining the cell with CD107a-PE, CD3-APC and CD8-FITC. As shown in the Figure 29, all the EGFR ARTs only strongly reactive to the tumor lines that are EGFR positive (SK-OV3, MDA231 and MDA468), but not EGFR negative tumor MCF7. While all the ErbB2
  • FIG. 31 is a graph showing specific IFN-gamma production of EGFR and ErbB2 ARTs. Electroporated T cells as shown in Figure 29 were stimulated with 4 different tumor cell lines that express EGFR and/or ErbB2 as indicated below the name of each tumor. After overnight incubation, supernatant was used to measure INF-gamma production by ELISA. IFN-gamma could be detected at different levels for all the EGFR
  • Figure 32 is a graph showing specific IL-2 production of EGFR and ErbB2 ARTs. Electroporated T cells as shown in Figure 29 were stimulated with four different tumor cell lines that express EGFR and/or ErbB2 as indicated below the name of each tumor. After overnight incubation, supernatant was used to measure IL-2 production by ELISA. IL-2 could be detected at different levels for all the EGFR ARTs stimulated by the tumor lines that are EGFR positive (SK-OV3, MDA231 and MDA468), but not EGFR negative tumor MCF7.
  • Figure 33 is a graph showing specific lytic activities of EGFR and ErbB2 ARTs.
  • ART T cells killed the tumor cells as efficiently as relevant CAR T cells.
  • Figure 34A is a diagrammatic sketch of Affinity antibody mimetic modified TCR (Affi-TCR) by adding affinity antibody mimetic and His -tag sequence to the N' of either alpha or beta chain of a TCR..
  • Figure 34B is a panel of graphs showing VM3.1 TCR and His-tag detection of affinity antibody mimetic redirected TCR ( Affi-TCR) RNA electroporated T cells.
  • T cells were co-electroporated with NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or their ErbB2 affinity antibody mimetic (342, 342.15, 342 or 342.4) modification . After overnight, vbl3.1 and His-Tag were detected by flow cytometry.
  • Figure 34C shows the ErbB2 affinity antibody mimetic sequences.
  • Figure 35 is a panel of graphs showing CD 107a up-regulation of Affi-TCR RNA electroporated T cells.
  • T cells were co-electroporated with TCR alpha (a) and beta (b), or their ErbB2 affinity antibody mimetic (342, 342.15, 342 or 342.4) modification as indicated in Figure 34B and stimulated with tumor line Nalm-6-ESO (NY-eso-l+, ErbB2-), A549-ESO (NY-eso-l+, ErbB2+), SK-OV3 (NY-eso-1-, ErbB2+), A549 (NY- eso-1-, ErbB2+), or Nalm6 (NY-eso-1-, ErbB2-), for CD 107a assay.
  • the results show that T cells with ErbB2 Affi-TCR could specifically recognize both Ny-ESO-1 and
  • Figure 36A is a diagrammatic sketch of affinity antibody mimetic modified CD3 epsilon by adding affinity antibody mimetic and G4S linker to the N' of either CD3 epsilon.
  • FIG 36B is a table showing electroporation of T cells.
  • T cells were co- electroporated with NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or together with ErbB2 affinity antibody mimetic (342, 342.15, 342 or 342.4) modified CD3 epsilon (e).
  • NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or together with ErbB2 affinity antibody mimetic (342, 342.15, 342 or 342.4) modified CD3 epsilon (e).
  • Figure 36C is a panel of graphs showing t maintainenance of TCR expression and dual tageting by co-delivering affinity antibody mimeti modified CD3 epsilon. After overnight of the T cells of Figure 36B, vbl3.1 expression was detected by flow cytometry.
  • FIG 37 is a panel of graphs showing CD 107a up-regulation of Affi-TCR RNA electroporated T cells.
  • T cells were co-electroporated with NY-ESO-1 (1G4) TCR alpha (a) and beta (b), or together with ErbB2 affinity antibody mimetic (342, 342.15, 342 or
  • modified CD3 epsilon (e) as indicated in Figure 36B and stimulated with tumor line Nalm-6-ESO (NY-eso-1 +, ErbB2-), Nalm6 (NY-eso-1-, ErbB2-), SK-OV3 (NY-eso- 1-, ErbB2+) or MDA231 (NY-eso-1-, ErbB2+), for CD 107a assay.
  • Nalm-6-ESO NY-eso-1 +, ErbB2-
  • Nalm6 NY-eso-1-, ErbB2-
  • SK-OV3 NY-eso- 1-, ErbB2+
  • MDA231 NY-eso-1-, ErbB2+
  • BiTEs could be secreted from Bis-RNA electroporated T cells and engage to T cells with specific tumor reactivity.
  • Bis-RNA T T cells transferred with Bis-RNA (Bis-RNA T) were tested for their ability to secrete functional bispecific T cell engagers (BiTEs), and the roles of the BiTEs engaged in both Bis-RNA electroporated and non-Bis-RNA electroporated T cells were identified.
  • BiTEs bispecific T cell engagers
  • T cell anti-tumor activity was assessed when co-introducing CAR RNA and Bis-RNA.
  • T cells surface staining of the T cells was conducted with an antibody that can detect murine origin Fab (mlgGFab). Positive staining was found for the T cells electroporated with either CAR (CAR RNA) or Bis-RNA ( Figure 38A, upper panel).
  • CAR RNA CAR RNA
  • Bis-RNA Figure 38A, upper panel
  • GFP RNA electroporated T cells GFP T cells were mixed with either Bis-RNA T or CAR-RNA T, either immediately after electroporation ( Figure 38A, middle panel) or before staining ( Figure 38A, lower panel).
  • GFP-RNA T cells could be stained positive for mlgGFab, as long as they were co-incubated with Bis-RNA T cells, but not with CAR19-RNA T, suggesting that Blinatumomab secreted from Bis-RNA T could not only be engaged to Bis-RNA T cells, but also to other T cells.
  • the function of the Bis-RNA T cells, or the GFP T cells co-incubated with Bis- RNA T cells were tested in a four hour CD 107a assay by stimulating the T cells with CD 19 positive tumor lines (Nalm6, K562-CD 19 and Raji).
  • CD 19 positive tumor lines Nalm6, K562-CD 19 and Raji.
  • antigen specific CD 107a up-regulation for the Bis-RNA T cells was as efficient as for CAR-RNA T cells.
  • significant antigen specific CD 107a up-regulation, at the similar levels of CAR-RNA T cells and Bis-RNA T cells was also evidenced for GFP- RNA T cells for cells co-incubated with Bis-RNA-T, but not with CAR-RNA T cells.
  • T cells with 1 ⁇ g fo Bis-RNA killed tumors at similar levels as T cells with 10 ⁇ g CD19BBZ CAR RNA at effector to target ratios from 1 : 1 to 30: 1 (Figure 46).
  • RNA was electroporated into the T cells, in comparison with CD 19 CAR RNA.
  • RNA dose was over 1 ⁇ g
  • Bis-RNA T cells could be activated as efficient as 5-10 ⁇ g CD19-CAR-T cells.
  • K562 cell line expressing CD 19 at different levels was used to stimulate T cells electroporated with either CAR RNA or Bis-RNA at 5 ⁇ g or 10 ⁇ g respectively.
  • T cells for both CAR RNA and Bis-RNA recognized CD 19 at the same level of 0.00 ⁇ g.
  • K562 cell line expressing ErbB2 at different levels was also used to stimulate T cells electroporated with either 4D5BBZ CAR RNA or 4D5-CD3 Bis- RNA.
  • the T cell division and proliferation were tested by stimulating the Blinatumomab Bis- RNA T cells, or CD 19 CAR-RNA T cells with K562 expressing CD 19 and K562 (K562-CD19/K562) or with K562-CD19 and K562 expressing CD86 (K562-CD19/K562- CD86).
  • K562-CD19/K562 K562-CD19/K562
  • CD86 K562-CD19/K562- CD86
  • T cell division of Bis-RNA T cells was correlated with cell proliferation and expansion, which relys on both T cell division and survival.
  • Figure 41B left panel, only Bis-RNA T cells showed T cell expansion, even at the 1 ⁇ g RNA dose.
  • CAR-RNA T cells showed no T cell expansion at all RNA doses.
  • CD28 co- stimulation greatly enhanced both division (for all RNA doses) and proliferation (only at RNA dose of 10 ⁇ g) of CAR-RNA T cells. While, CD28 co-stimulation slightly increased the Bis-RNA T cells division with enhanced cell proliferation at all the Bis- RNA doses ( Figures 41B, 48A, and 48B).
  • T cells electroporated with as low as 0.2 ⁇ g of RNA could be efficiently activated, as evidenced by CFSE dilution of T cells and cell expansion for CD45RO- naive cells or CD45RO+ memory cells co-stimulated with K562-CD86 (equivalent as T cells with 5 ⁇ g CD19BBZ RNA in most cases) ( Figures 41C, 41D, and 48C). This further confirms that T cells with Bis-RNA were more sensitive to T cell activation and less dependent on co-stimulation than T cells with CAR RNA.
  • CD 19- 28Z CAR RNA was added to assess the division and proliferation capacity of CAR RNA and Bis- RNA electroporated T cells. It was found that both CFSE dilution ( Figure 48F) and T cell expansion ( Figure 48G) for CD19-28Z CAR RNA T cells were slightly increased, compared to CD19BBZ CAR RNA T cells upon stimulation with a CD 19+ tumor line with or without additional CD28 co-stimulation.
  • Bis-RNA T cells may have enhanced functionality in vivo demonstrated by increased CD 107a up-regulation, cytokine production, tumor lytic ability, and cell dividing and proliferation capacity as compared to CAR RNA T cells. Seven days after NOD-SCID-?c-/- (NSG) mice received green luciferase-transduced
  • mice Nalm6 cells (Nalm6-CBG), the mice were treated with T cells that were electroporated with CD19BBZ RNA CAR (RNA CAR) and/or Blinatumomab Bis-RNA as indicated ( Figures 42 A and 42B).
  • RNA CAR RNA CAR
  • Blinatumomab Bis-RNA as indicated
  • CAR RNA T cells showed significant tumor burden reduction compared with mice treated with control CAR RNA T cells (sslBBZ).
  • mice treated by Bis-RNA T cells, or T cells co-electroporated with both CAR RNA and Bis-RNA demonstrated enhanced tumor regression, evidenced by approximately 1-2 log tumor density reduction.
  • the tumor burden for both groups of mice, treated with CAR RNA T cells and Bis-RNA T cells were reduced to background levels.
  • mice given a single injection of human T cells were euthanized and cells from the bone marrow and spleens were purified for functional analysis.
  • T cells were analyzed for CD 137 expression (Figure 42C), IFN-gamma production ( Figure 42D), and CD 107a ( Figure 42E) expression after stimulation with a CD19 positive cell line, K562-CD19.
  • CD19BBZ CAR T cells (CAR RNA T) and CD19 Bis-RNA T cells (Bis-RNA T) demonstrated high reactivity to specific antigen stimulation at day 1 post T cell injection in all three functional assays.
  • CAR RNA T cells While at day 3 post injection, CAR RNA T cells still demonstrated some anti-tumor activity, at day 7 post injection, nearly all anti-tumor activity was absent for both CAR RNA and Bis-RNA T cells. Generating Bis-RNA using different scFvs targeting different tumor antigens.
  • the immunogenicity of the CARs derived from mouse scFv is a potential limitation threatening CAR therapy.
  • an adverse immune response is provoked, often times the immune response is directed against the extracellular antigen recognition domain that is usually derived from mouse monoclonal antibodies (Lamer et al, Blood 117:72-82, 2011).
  • a human anti-CD19 scFv (21D4) and a human anti-CD3 scFv (28F11) were chosen to make a fully human CD19-CD3 Bis-RNA.
  • Initial attempts at making VH and VL chains of each single chain variable fragment (scFv) showed that the fully human CD19-CD3 Bis-RNA lacked any detectable function.
  • New constructs were made having different VL/VH sequences, D4-F11HLHL.
  • T cells expressing D4-F11 HLHLHL produced significant higher levels of IFN- gamma, compared with T cells expressing CD 19 CAR RNA or Blinatumomab Bis-RNA ( Figure 43B).
  • Cytokine production profiles showed that about 2-5 fold increased in cytokine production was observed from D4-F11 Bis-RNA T as compared to CD 19 CAR RNA T cells for TNF-alpha, IL-2, IL-10, IFN-gamma and GM-CSF (Figure 49B). These results indicated an overall enhancement of T cell function for T cells electroporated with CD19-CD3 Bis-RNA.
  • FMC63 anti-CD 19 scFv based CAR was used for most of the comparisons between CD 19 CAR RNA and Blinatumomab based Bis-RNA.
  • the CAR RNA from FMC63 scFv demonstrated more functionality than the Bis-RNA derived from Blinatumomab anti-CD 19 svFc (HD37).
  • lentiviral transduction with D4F11 produced T cells more anti-tumor activity than CD19BBZ lentiviral transduction.
  • GD2 CARs were used to generate Bis-RNAs.
  • Surface staining for scFv on T cells electroporated with these Bis-RNAs showed positive staining for mesothelin, cMet and PSCA, but not for GD2 ( Figure 43C).
  • antigen specific CD 107a up-regulation was observed in the T cells with relevant CAR RNAs, as well as T cells electroporated with mesothelin, cMet and PSCA Bis-RNAs, but not for GD2 Bis-RNA ( Figure 43D).
  • Bis-RNA T cells showed higher cytokine production, increased proliferation, increased lytic ability and less co-stimulation dependency, when compared to CAR-RNA T cells. Such properties indicate that the Bis-RNA T cells were fully functional and less prone to tumor associated suppressions, such as suppression by regulatory T cells and influences from programmed cell death 1 (PDl) receptor- ligand interaction.
  • PDl programmed cell death 1
  • T cells were co -electroporated with CD 19 Bis-RNA or CAR RNA and PDl RNA at different RNA doses and stimulated with CD 19 positive tumor cells.
  • the results showed that T cells co -electroporated with either 5ug or lOug PDl RNA significantly reduced CAR-RNA T cell response to specific antigen stimulation, reduced CD 107a expression ( Figure 44A) and cytokine production (IFN-gamma and IL-2) ( Figures 44B and 50).
  • T cell functions were minimally affected by PDl at 1 ug and 5 ug of Bis-RNA with 10 ug PDl RNA and no obvious negative influence on T cell function at 10 ug of Bis-RNA.
  • Treg regulatory T cell
  • CD 19 positive cell lines at different T effector :Treg ratios Suppression of proliferation was evidenced as a maintanence of CFSE labled cells, as compared to non-Treg suppressed cells that displayed a dilution in CFSE signal over time ( Figure 44D).
  • Blinatumomab Bis-RNA (4: 1 T effector:Treg ratio). No significant Treg suppression was observed above an 8: 1 T effector :Treg ratio for Bis-RNA T cells (Figure 44C).
  • the combining stimulation (anti-CD3 scFv expressed on the cell surface) and co- stimulation (CD28 and 4-lBB ⁇ ) in a single molecule provides essential components to support efficient T cell expansion and activation.
  • co-introducing co-stimulatory molecules novel T cell populations having a central memory phenotype with strong lytic capacity are two critical characteristics for T cell therapeutic efficacy, which is lacking in current T cell methodologies.
  • Bis-RNA Blinatumomab RNA
  • Bis-RNA T cells were activated as efficiently as T cells electroporated with 5-10 ⁇ g CD19-CAR RNA ( Figure 51 A).
  • ELISA showed that PD1-CD28 switch receptors, 10A5-1412 (aPDLl-aCD28 bi-RNA) and 13G4-1412 (aPDLl-aCD28 bi-RNA) significantly improved T cell function by increasing the secretion of both IL-2 and IFN-gamma.
  • the switch in function suggests a PD1 negative signal was switched to a CD28 positive signal.
  • T cells with Bis-RNA switch receptors, 10A5-1412 (aPDLl-aCD28 bi-RNA) and 13G4-1412 (aPDLl-aCD28 bi-RNA) showed increased cytokine production, suggesting that these engineered T cells delivered activation molecules that positively improved T cell function.
  • RNA in vitro transcription vectors to generate pGEM.aTGFbR-1-1412 and
  • Figure 56 A is a graph showing T cells electroporated with 4D5-CD3 Bis-RNA were reactive to ErbB2 over expressing tumor cells. T cells electroporated with ErbB2 CARs or Bis-RNA were stimulated with tumor lines expressing high levels of ErbB2,
  • a CD 107a assay showed that T cells expressing 4D5-6.CD3 were only reactive to ErbB2 over
  • Figure 56B is a panel of graphs showing results of a repeat of the experiment of Figure 56A.
  • Figure 57 is a panel of graphs showing lytic activity of T cells electroporated with 4D5-CD3 Bis-RNA to ErbB2 over expressing tumor cells.
  • T cells electroporated with ErbB2 CARs or Bis-RNA were tested for their lytic activity against ErbB2 over- expressing tumor cells, SK-OV3-CBG, or ErbB2 low expressing tumor cells, mel624 (624-CBG).
  • the luciferase based CTL assay showed that, like affinity tuned BebB2 CAR, 4D5-5.BBZ and 4D5-3.BBZ, T cells expressing 4D5-6.CD3 were only reactive to ErbB2 over expressing tumor cells, SK-OV3.
  • Figure 58 is a panel of graphs showing T cells lenti-virally transduced with 4D5-CD3 Bis-RNA were reactive to ErbB2 over expressing tumor cells.
  • T cells transduced with ErbB2 CARs or Bis-RNA were stimulated with tumor lines expressing high levels of ErbB2, SK-OV3 and N87, or low levels, MDA-231, PC3 and A549.
  • a CD 107a assay showed that T cells expressing 4D5-CD3 were only reactive to ErbB2 over expressing tumor cells.
  • Figure 59 is a panel of graphs showing T cells lenti-virally transduced with 4D5-CD3 Bis-R A were reactive to ErbB2 over expressing tumor cells.
  • T cells transduced with ErbB2 CARs or Bis-RNA as indicated were stimulated with tumor lines expressing high levels of ErbB2, SK-OV3 and N87, or low levels, MDA-231, PC3 and A549. Cytokine production as assayed by ELISA indicates T cells expressing T4D5-CD3 were only reactive to ErbB2 over expressing tumor cells.
  • Figure 60A is a panel of images showing affinity -tuned ErbB2 BiTE cells increase the therapeutic index and induce regression of advanced vascularized tumors in mice.
  • T cells modified with different affinity ErbB2 CARs or BiTEs by lentiviral transduction were tested in dual-tumor engrafted NSG mice.
  • the same mice were given SK-OV3-CBG tumor cells (5xl0 6 cells/mouse, s.c.) on the left flank.
  • the mice were treated with T cells (i.v.) at day 23 after PC3 tumor inoculation.
  • T cells were administered as a single injection of lxl0 7 /mouse. Mice treated with non-transduced T cells (No TD) served as controls. Animals were imaged at the indicated time post PC3 tumor inoculation.
  • Figure 60B is a graph showing SK-OV3 tumor size in dual-tumor grafted NSG mice model. Tumor sizes were measured, and the tumor volume was calculated and plotted.
  • Figure 60C is a graph showing PC3 tumor sizes in dual-tumor grafted NSG mice model. Tumor sizes were measured, and the tumor volume was calculated and plotted.
  • Figure 61 A is an illustration of constructs for co-expressing PD1-CD28 switch receptor and affinity tuned T4D5-6.CD3 BiTEs.
  • Figure 61B is a panel of graphs showing detection of PD1-CD28 switch receptor of T cells lentivirally transduced with PD1-CD28 and T4D5-CD3 co-expression vectors.
  • Figure 62A is a graph showing increased lytic activity of T cells co-expressing both PD1-CD28 switch receptor and T4D5-6.CD3 affinity tuned BiTEs.
  • FIGS 62B-62G are a panel of images showing Bis-RNA electroporated T cells generated by rapid expansion protocol (REP) of Dudley et al, J. Immunol, 26(4):332-342, 2003 modified for T cells directly isolated from normal donors. Bis- RNA electroporated T cells further improved in vivo anti-leukemia activity. Under REP conditions, the T cells are cultured with one or more factors, such as flt3-L, IL-1, IL-2, IL-3 and c-kit ligand. The phenotype of T cells expanded by REP or anti- CD3/anti-CD28 beads (Beads) was assessed ( Figure 62B).
  • REP rapid expansion protocol
  • Beads anti- CD3/anti-CD28 beads
  • REP T cells or anti- CD3/anti-CD28 bead T cells were electroporated with different amounts of CAR RNA or Bis-RNA and stimulated with different cell lines for 18 hr.
  • CD 137 up-regulation was analyzed by flow cytometry (gated on CD3+ T cells) ( Figure 62C). Lytic activity was measured in REP T cells ( Figure 62D, left panel) or anti-CD3/anti-CD28 beads T cells ( Figure 62D, right panel) electroporated with different amounts of CAR RNA or Blinatumomab Bis-RNA.
  • NSG mice were injected with lxlO 6 Nalm6-CBG
  • Figures 62H-62I are a panel of images showing the generation of K562 based artificial antigen presenting cells (aAPC) expressing membrane bound OKT3.
  • aAPC artificial antigen presenting cells
  • Lentiviral vectors expressing chimeric protein for membrane forms of OKT3 with either CD8 hinge and transmembrane (OKT3.8) or with CD8 hinge and CD28 transmembrane (OKT3.8.28) are illustrated in Figure 62H.
  • K562 based aAPC, K562- CD86-CD137L (KT) or K562-CD137L (2D11) cell lines were transduced with lentiviral OKT3.8 or OKT3.8.28 and the expression of the membrane bound OKT3 was detected using an antibody against murine IgG Fab ( Figure 621).
  • Figure 62 J is a panel of images showing characterization of membrane bound OKT3 transduced K562 aAPC clones. Selection of the clones by limiting dilution was based on expression of membrane band OKT3 from OKT3.8.28 transduced KT aAPC.
  • Figures 62K-62M are a panel of graphs showing REP with K562 based artificial aAPC.
  • Figure 62K is a graph showing OKT3 loaded K562-CD86-CD137L (KT) or K562-CD137L (2D11), or KT expressing membrane bound OKT3 (KT.OKT) were irradiated and cultured for one day (Dl) or two days (D2) before being used to stimulated T cells at T celkaAPC ratio of 1 :250.
  • Figure 62L is a panel of graphs showing the expanded T cells, independently expanded in the REP, stained for CD62L and CD28.
  • Figure 62M is a graph showing different B cell lines in a REP experiment, as compared with KT cells.
  • Example 5 T cells expressing modified TCRs.
  • the T cells were compared to assess the in vivo potency of 1) T lymphocytes that expressed wildtype (wt) TCR or high affinity TCR against tumor antigen (NY-ESO-1) and 2) lentiviral vector transduced T cells as compared to RNA electroporated T cells that expressed wildtype (wt) TCR or high affinity TCR in Naml6 leukemia and A549 lung cancer mouse models.
  • T cells were electroporated with TCR RNA and the cells were injected into a leukemia mouse model.
  • NOD/SCID (NSG) mouse models both lenti-virally transduced and RNA
  • T cells expressing NY-EOS- 1 wildtype TCR have similar treatment efficacies as higher affinity TCR ( Figures 63, 64 and 65).
  • the HLA-A2+, CD 19+ leukemia cell line, Naml6, was transduced with NY-ESO-1 to generate Naml6-ESO tumor cells.
  • One million of Naml6-ESO cells were injected into NSG mice and the mice were injected with T cells on day 5 or 7 (as indicated) after tumor inoculation.
  • the tumor bearing mice were treated with T cells electroporated with either NY-ESO-1 (1G4) wildtype TCR RNA (wtlG4), or its high affinity form (LY95a). It was found that T cells electroporated with NY-ESO-1 wildtype TCR RNA showed potent anti-tumor activity, while T cells with high affinity NY-ESO-1 TCR were much less potent ( Figure 63).
  • TCR high affinity or wildtype RNA electroporated T cells showed significantly better cancer treatment efficacy than lenti-transduced T cells with either the high affinity or wildtype TCRs ( Figures 64 and 65).
  • Multiple infusions of TCR RNA electroporated T cells controlled tumor growth longer than a single dose of lentiviral transduced T cells expressing either the high affinity TCR or wildtype TCR. This indicated that the electroporated T cells only transient treatment effect (Figure 64).
  • lenti-TCR transduced T cells both wildtype and high affinity, expressed in a single dose of RNA ( Figures 64 and 65), indicating that lenti-TCR RNA T cells cannot be expended and persisted as efficiently as lenti-CAR T cells. This may be due to the lack of proper co-stimulation signals.
  • Co-electroporating TCR with CD3 RNA further enhanced T cell anti-tumor activities as shown in Figures 69-80.
  • Figure 69 is a panel of images showing an illustration of a CD3 construct and graphs showing TCR and CD3 expression in TCR and CD3 RNA electroporated T cells.
  • Figures 70 and 71 are graphs showing expression levels of TCR (vbl3.1), CD3 and TCR
  • FIG. 72-74 show tables showing infection efficiency.
  • Figures 75-80 show T cells electroporated with TCR RNA (y-axis) with or without CD3 and incubated with different tumor cell lines (x-axis).
  • CD3 is a very important component for TCR mediated T cell function.
  • the CD3/TCR complex is composed of six different molecules. In addition to the TCR alpha and beta chains, there are four CD3 units: gamma, delta, epsilon and zeta.
  • RNA encoding the TCR alpha and beta chains from an anti-NY-ESO-1 TCR (1G4) with different combination of CD3 subunits into 293 cells it was found that maximal TCR/CD3 expression was achieved by introducing all four CD3 subunits. As shown in Figures 81 and 82, maximal T cell function was achieved by co-introducing all four subunits of CD3 with TCR RNA.
  • CD3 and TCR subunits showed more or less T cell function enhancement with epsilon and zeta having the highest functionality.
  • CD3 zeta with TCR RNA showed significant functional enhancement, compared with TCR alone, or TCR with other subunits.
  • the CD3/TCR was expressed when only three or two subunits were co-electroporated, such as delta+epsilon+zeta, gamma+epsilon+zeta, and epsilon+zeta, indicating epsilon and zeta are relatively essential for TCR/CD3 expression ( Figures 81 and 82).
  • FIG 83 is a panel of flow graphs showing CD 107a up- regulation in TCR RNA and CD3 RNA co-electroporated T cells stimulated with tumor cells.
  • Figures 84, 85 and 86 show IFN-gamma and IL-2 expression in T cells electroporated with TCR RNA and different combinations of CD3 RNA after incubation with different tumor cell lines.
  • 1G4 TCR alpha-41BB, CD3 zeta-41-BB, and CD3 epsilon-4-lBB constructs were generated by directly fusing a 4-1BB intracellular moiety to the C terminus of the 1G4
  • TCR alpha, CD3 zeta or CD3 epsilon TCR alpha, CD3 zeta or CD3 epsilon.
  • RNA electroporation of these modified TCR or CD3 constructs showed that incorporation of 4- IBB into the TCR complex allowed TCR expression and functionality ( Figures 87 and 88).
  • Adding co-stimulatory signals to the C terminus of either the TCR apha and/or beta chains or CD3 zeta and/or CD3 epsilon still maintained T cell function ( Figures 89-92) and potentially provided T cells with a direct co-stimulatory signal.
  • T cells with second disulfide bond to either the alpha or beta chains were compared with T cells electroporated with wildtype TCR (wtlG4) or CD 19 CART cells (Figure 94). It was found that T cells with modified TCRs (mlG4) showed better treatment than the T cells with wildtype TCR (wtlG4), indicating that treatment may be improved by modifying the TCR with either a second disulfide bond and/or N-deglycosylation.
  • FIG. 95 is a panel of images showing N-deglycosylation in the TCR alpha chain impaired function of RNA electroporated T cells as compared to adding disulfide bonds to the TCR or hybrid TCRs.
  • FIG 96 is a panel of images showing transgene expression and functionality of T cells electroporated with RNA encoding hybrid TCR containing murine constant regions.
  • Figure 97 is a panel of images showing fluorescence of injected tumor and hybrid TCR T cells in mouse models over time.
  • Figure 98 is a panel of images showing the addition of disulfide bonds to the alpha and beta chains, or N-deglycosylation of the beta chain of the TCR enhanced transgene expression and function of electroporated T cells as compared to adding disulfide bonds to the TCR or hybrid TCRs.
  • Figure 103 is a graph showing 5E6 A549-ESO (HLA-A2 and NY-ESO-1 transduced A549) were injected subcutaneously at day 0. lxlO 6 transduced T cells were injected at day 14 and the tumor size was measured. The preliminary results indicated no effect for TCR alone (1G4), while tumor growth was delayed for CD27 co-stimulatory signal (1G4.CD27), or PD1-CD28 switch receptor (PD1-CD28.1G4), or both CD27 co- stimulatory signal and PD1-CD28 switch receptor (PD1-CD28.1G4.CD27).
  • CD27 co-stimulatory signal (1G4.CD27
  • PD1-CD28.1G4 PD1-CD28 switch receptor
  • PD1-CD28.1G4.CD27 both CD27 co- stimulatory signal and PD1-CD28 switch receptor
  • FIG. 104 A schematic diagram is shown in Figure 104 of a modified TCR capable of non-
  • FIGS 105 and 106 show the TCR recognized both cognate MHC/peptide and surface tumor antigens (like CAR molecules) without HLA restriction when combined with Bis- RNA technology.
  • IFN-gamma ( Figure 107) and IL-2 ( Figure 108) secretion was elevated in T cells modified with TCR co-introduced with bis-RNA.
  • mice injected with Nalm6-ESO (i.v.) and treated with T cells electroporated with modified TCRs show improved efficacy when the modified TCRs were co-delivered with bis-RNA against HAl and CD 19 (a+b/HAl-e/aHAl-aCD19, or HAl-A+b/aHAl-aCD19) as compared with the wild type TCR (a+b), wild type TCR plus HAl modified CD3 epsilon (a+b HAl -e) or high affinity TCR (TCR ly95) ( Figure 109).
  • T cells were co-electroporated with TCR alpha (a) and beta (b), or an ErbB2 small molecule (342, 342.15, 342 or 342.4).
  • VM3.1 TCR and His-tag were detected in the small molecule redirected TCR (Affi-TCR) RNA electroporated T cells.
  • the electroporated T cells were stimulated with the tumor cell lines, Nalm-6-ESO (NY-eso-l+, ErbB2-), A549-ESO (NY-eso-l+, ErbB2+), SK-OV3 (NY-eso-1-, ErbB2+),
  • the Affi-CD3 epsilon co-electroporated T cells (EP3 to EP6) showed higher antitumor activity than Affibody modified TCR (EP2) against ErbB2 positive tumor SK-OV3 and MDA231 ( Figure 113).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Biomedical Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Wood Science & Technology (AREA)
  • Hematology (AREA)
  • Biotechnology (AREA)
  • Diabetes (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Oncology (AREA)
  • Neurology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Dermatology (AREA)
  • Endocrinology (AREA)
  • Rheumatology (AREA)
PCT/US2015/058339 2014-10-31 2015-10-30 Methods and compositions for modified t cells Ceased WO2016070061A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
HK18102826.6A HK1243333A1 (zh) 2014-10-31 2015-10-30 用於修饰的t细胞的方法和组合物
US15/518,922 US20170258835A1 (en) 2014-10-31 2015-10-30 Methods and compositions for modified t cells
EP15855013.7A EP3212225B1 (en) 2014-10-31 2015-10-30 Methods and compositions for modified t cells
CN201580071613.7A CN107106670A (zh) 2014-10-31 2015-10-30 用于修饰的t细胞的方法和组合物
KR1020177014658A KR20170074243A (ko) 2014-10-31 2015-10-30 변형된 t 세포의 생성 방법 및 조성물
CA2964958A CA2964958A1 (en) 2014-10-31 2015-10-30 Methods and compositions for modified t cells
AU2015338984A AU2015338984A1 (en) 2014-10-31 2015-10-30 Methods and compositions for modified T cells
JP2017523266A JP7372728B2 (ja) 2014-10-31 2015-10-30 改変t細胞に関する方法および組成物
EP25207728.4A EP4653013A3 (en) 2014-10-31 2015-10-30 Methods and compositions for modified t cells
JP2023088510A JP7757343B2 (ja) 2014-10-31 2023-05-30 改変t細胞に関する方法および組成物
JP2025169833A JP2025188145A (ja) 2014-10-31 2025-10-08 改変t細胞に関する方法および組成物

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US201462073467P 2014-10-31 2014-10-31
US201462073144P 2014-10-31 2014-10-31
US201462073681P 2014-10-31 2014-10-31
US201462073540P 2014-10-31 2014-10-31
US201462073343P 2014-10-31 2014-10-31
US62/073,681 2014-10-31
US62/073,144 2014-10-31
US62/073,540 2014-10-31
US62/073,467 2014-10-31
US62/073,343 2014-10-31

Publications (1)

Publication Number Publication Date
WO2016070061A1 true WO2016070061A1 (en) 2016-05-06

Family

ID=55858404

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/058339 Ceased WO2016070061A1 (en) 2014-10-31 2015-10-30 Methods and compositions for modified t cells

Country Status (10)

Country Link
US (1) US20170258835A1 (enExample)
EP (2) EP3212225B1 (enExample)
JP (4) JP7372728B2 (enExample)
KR (1) KR20170074243A (enExample)
CN (1) CN107106670A (enExample)
AU (1) AU2015338984A1 (enExample)
CA (1) CA2964958A1 (enExample)
HK (1) HK1243333A1 (enExample)
PT (1) PT3212225T (enExample)
WO (1) WO2016070061A1 (enExample)

Cited By (72)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017069958A2 (en) 2015-10-09 2017-04-27 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
WO2017087708A1 (en) 2015-11-19 2017-05-26 The Brigham And Women's Hospital, Inc. Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity
WO2018006880A1 (zh) * 2016-07-08 2018-01-11 生命序有限公司 重组免疫检查点受体及免疫检查点抑制分子的共表达及应用
WO2018006881A1 (zh) * 2016-07-08 2018-01-11 生命序有限公司 重组免疫检查点受体及其应用
WO2018049025A2 (en) 2016-09-07 2018-03-15 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses
WO2018067991A1 (en) 2016-10-07 2018-04-12 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
WO2018120842A1 (zh) * 2016-12-30 2018-07-05 上海欣百诺生物科技有限公司 一种双功能分子及其应用
CN108264562A (zh) * 2016-12-30 2018-07-10 上海欣百诺生物科技有限公司 一种结合cd3和t细胞正共刺激分子的双功能分子及其应用
WO2018191553A1 (en) 2017-04-12 2018-10-18 Massachusetts Eye And Ear Infirmary Tumor signature for metastasis, compositions of matter methods of use thereof
WO2018200784A1 (en) * 2017-04-26 2018-11-01 Memorial Sloan-Kettering Cancer Center Ready-to-use cryopreserved cells
US10208285B2 (en) 2016-10-07 2019-02-19 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
EP3340995A4 (en) * 2015-08-28 2019-04-03 The Trustees Of The University Of Pennsylvania METHOD AND COMPOSITIONS FOR CELLS FOR EXPRESSING A CHIMERIC INTRA-CELLULAR SIGNAL MOLECULE
WO2019070755A1 (en) 2017-10-02 2019-04-11 The Broad Institute, Inc. METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER
WO2019094983A1 (en) 2017-11-13 2019-05-16 The Broad Institute, Inc. Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway
US10358474B2 (en) 2015-05-18 2019-07-23 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
EP3569244A1 (en) 2015-09-23 2019-11-20 CytoImmune Therapeutics, LLC Flt3 directed car cells for immunotherapy
WO2019232542A2 (en) 2018-06-01 2019-12-05 Massachusetts Institute Of Technology Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients
EP3443014A4 (en) * 2016-04-15 2020-01-01 Zymeworks Inc. MULTI-SPECIFIC ANTIGEN-BINDING CONSTRUCTS AGAINST IMMUNOTHERAPEUTICS
WO2020033366A1 (en) 2018-08-08 2020-02-13 Nantbio, Inc. Recombinant cd1-restricted t cells and methods
WO2020072700A1 (en) 2018-10-02 2020-04-09 Dana-Farber Cancer Institute, Inc. Hla single allele lines
US20200113940A1 (en) * 2017-04-14 2020-04-16 The General Hospital Corporation Chimeric antigen receptor t cells targeting the tumor microenvironment
WO2020081730A2 (en) 2018-10-16 2020-04-23 Massachusetts Institute Of Technology Methods and compositions for modulating microenvironment
WO2020131586A2 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Methods for identifying neoantigens
WO2020186101A1 (en) 2019-03-12 2020-09-17 The Broad Institute, Inc. Detection means, compositions and methods for modulating synovial sarcoma cells
WO2020191079A1 (en) 2019-03-18 2020-09-24 The Broad Institute, Inc. Compositions and methods for modulating metabolic regulators of t cell pathogenicity
JP2020534296A (ja) * 2017-09-18 2020-11-26 トラスティーズ オブ ボストン ユニバーシティ ネトーシスおよび好中球活性化を処置するための方法
JP2020534034A (ja) * 2017-09-22 2020-11-26 ウーシー バイオロジクス アイルランド リミティド 新規二重特異性ポリペプチド複合体
WO2020236967A1 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Random crispr-cas deletion mutant
WO2020243371A1 (en) 2019-05-28 2020-12-03 Massachusetts Institute Of Technology Methods and compositions for modulating immune responses
WO2021030627A1 (en) 2019-08-13 2021-02-18 The General Hospital Corporation Methods for predicting outcomes of checkpoint inhibition and treatment thereof
WO2021041922A1 (en) 2019-08-30 2021-03-04 The Broad Institute, Inc. Crispr-associated mu transposase systems
WO2021050656A1 (en) * 2019-09-11 2021-03-18 The Trustees Of The Univeristy Of Pennsylvania Compositions and methods comprising prostate stem cell antigen (psca) chimeric antigen receptors (cars)
US11059880B2 (en) 2015-06-30 2021-07-13 Arizona Board Of Regents On Behalf Of The University Of Arizona Redirected cells with MHC chimeric receptors and methods of use in immunotherapy
CN113512126A (zh) * 2016-06-20 2021-10-19 深圳市体内生物医药科技有限公司 一种分子、表达其的细胞及其制备方法和用途
WO2021212069A1 (en) 2020-04-17 2021-10-21 City Of Hope Flt3-targeted chimeric antigen receptor modified cells for treatment of flt3-positive malignancies
US11180730B2 (en) 2015-10-28 2021-11-23 The Broad Institute, Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting GATA3
US11186825B2 (en) 2015-10-28 2021-11-30 The Broad Institute, Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting POU2AF1
US11242376B2 (en) 2016-08-02 2022-02-08 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
JP2022518530A (ja) * 2019-01-28 2022-03-15 ウーシー バイオロジクス アイルランド リミティド 新規二重特異性cd3/cd20ポリペプチド複合体
WO2022196719A1 (ja) 2021-03-17 2022-09-22 第一三共株式会社 抗アセチルコリン受容体自己抗体に対するキメラ受容体をコードする遺伝子
US11649435B2 (en) 2015-08-28 2023-05-16 The Trustees Of The University Of Pennsylvania Methods and compositions for cells expressing a chimeric intracellular signaling molecule
US11667723B2 (en) 2020-08-17 2023-06-06 Utc Therapeutics (Shanghai) Co., Ltd. Lymphocytes-antigen presenting cells co-stimulators and uses thereof
US11732257B2 (en) 2017-10-23 2023-08-22 Massachusetts Institute Of Technology Single cell sequencing libraries of genomic transcript regions of interest in proximity to barcodes, and genotyping of said libraries
US11739156B2 (en) 2019-01-06 2023-08-29 The Broad Institute, Inc. Massachusetts Institute of Technology Methods and compositions for overcoming immunosuppression
US11793787B2 (en) 2019-10-07 2023-10-24 The Broad Institute, Inc. Methods and compositions for enhancing anti-tumor immunity by targeting steroidogenesis
US11844800B2 (en) 2019-10-30 2023-12-19 Massachusetts Institute Of Technology Methods and compositions for predicting and preventing relapse of acute lymphoblastic leukemia
US11851491B2 (en) 2016-11-22 2023-12-26 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11897953B2 (en) 2017-06-14 2024-02-13 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
US11913075B2 (en) 2017-04-01 2024-02-27 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
WO2024077256A1 (en) 2022-10-07 2024-04-11 The General Hospital Corporation Methods and compositions for high-throughput discovery ofpeptide-mhc targeting binding proteins
US11957695B2 (en) 2018-04-26 2024-04-16 The Broad Institute, Inc. Methods and compositions targeting glucocorticoid signaling for modulating immune responses
US11963966B2 (en) 2017-03-31 2024-04-23 Dana-Farber Cancer Institute, Inc. Compositions and methods for treating ovarian tumors
US11981922B2 (en) 2019-10-03 2024-05-14 Dana-Farber Cancer Institute, Inc. Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment
US11994512B2 (en) 2018-01-04 2024-05-28 Massachusetts Institute Of Technology Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity
WO2024124044A1 (en) 2022-12-07 2024-06-13 The Brigham And Women’S Hospital, Inc. Compositions and methods targeting sat1 for enhancing anti¬ tumor immunity during tumor progression
US12036240B2 (en) 2018-06-14 2024-07-16 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
US12049643B2 (en) 2017-07-14 2024-07-30 The Broad Institute, Inc. Methods and compositions for modulating cytotoxic lymphocyte activity
US12165747B2 (en) 2020-01-23 2024-12-10 The Broad Institute, Inc. Molecular spatial mapping of metastatic tumor microenvironment
US12171783B2 (en) 2017-11-13 2024-12-24 The Broad Institute, Inc. Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas
US12195725B2 (en) 2019-10-03 2025-01-14 Dana-Farber Cancer Institute, Inc. Compositions and methods for modulating and detecting tissue specific TH17 cell pathogenicity
EP4495246A2 (en) 2018-03-01 2025-01-22 University of Kansas Techniques for generating cell-based therapeutics using recombinant t cell receptor genes
US12226479B2 (en) 2017-05-11 2025-02-18 The General Hospital Corporation Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof
US12227578B2 (en) 2016-11-11 2025-02-18 The Broad Institute, Inc. Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action
WO2025059533A1 (en) 2023-09-13 2025-03-20 The Broad Institute, Inc. Crispr enzymes and systems
WO2025097055A2 (en) 2023-11-02 2025-05-08 The Broad Institute, Inc. Compositions and methods of use of t cells in immunotherapy
US12297426B2 (en) 2019-10-01 2025-05-13 The Broad Institute, Inc. DNA damage response signature guided rational design of CRISPR-based systems and therapies
WO2025117544A1 (en) 2023-11-29 2025-06-05 The Broad Institute, Inc. Engineered omega guide molecule and iscb compositions, systems, and methods of use thereof
US12394502B2 (en) 2019-10-02 2025-08-19 The General Hospital Corporation Method for predicting HLA-binding peptides using protein structural features
US12421557B2 (en) 2019-08-16 2025-09-23 The Broad Institute, Inc. Methods for predicting outcomes and treating colorectal cancer using a cell atlas
US20250345424A1 (en) * 2022-06-06 2025-11-13 Caribou Biosciences, Inc. Treatment of autoimmune diseases with engineered immune cells
US12473343B2 (en) 2017-01-10 2025-11-18 The General Hospital Corporation Targeted t cells with cytotoxicity toward immunosuppressive cells
US12577289B2 (en) 2015-06-30 2026-03-17 Arizona Board Of Regents On Behalf Of The University Of Arizona Surrogate co-receptors for t cells and methods of use

Families Citing this family (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP7123794B2 (ja) * 2015-12-09 2022-08-23 メモリアル スローン ケタリング キャンサー センター 免疫細胞組成物及びそれを使用する方法
SG11201708680PA (en) * 2016-03-31 2017-11-29 Lion Tcr Pte Ltd Non-activated t cells expressing exogenous virus-specific t cell receptor (tcr)
CA3034691A1 (en) 2016-08-30 2018-03-08 Memorial Sloan Kettering Cancer Center Immune cell compositions and methods of use for treating viral and other infections
KR102379189B1 (ko) 2017-06-13 2022-03-25 엘지디스플레이 주식회사 연성 표시 패널을 포함하는 롤러블 디스플레이 장치
EP3681531A1 (en) * 2017-09-15 2020-07-22 Kite Pharma, Inc. Methods and systems for performing a patient-specific immunotherapy procedure with chain-of-custody and chain-of-identity biological sample tracking
CN109970864A (zh) * 2017-12-28 2019-07-05 上海细胞治疗研究院 一种双向激活共刺激分子受体及其用途
KR102795692B1 (ko) * 2018-01-19 2025-04-16 밀테니 비오텍 비.브이. & 씨오. 케이지 키메라 항원 수용체를 발현하는 조절 t 세포
US12492254B2 (en) * 2018-02-23 2025-12-09 H. Lee Moffitt Cancer Center and Research Intitute. Inc. CD83-binding chimeric antigen receptors
JP7462578B2 (ja) * 2018-03-15 2024-04-05 ファンダメンタル ソリューションズ コーポレーション プログラム可能な免疫細胞受容体複合体システム
WO2019222642A1 (en) * 2018-05-18 2019-11-21 Senti Biosciences, Inc. Engineered immune cells and methods of use
US20200038443A1 (en) * 2018-08-04 2020-02-06 AbCyte Therapeutics Inc. Multi-function and multi-targeting car system and methods for use thereof
CN109722437B (zh) * 2018-12-29 2020-01-07 广州百暨基因科技有限公司 一种通用型car-t细胞及其制备方法和用途
CN111378622B (zh) * 2018-12-29 2022-12-02 华东师范大学 核酸编码的car-t细胞及其制备方法和应用
US12551558B2 (en) 2019-04-12 2026-02-17 Emory University Compositions and methods for promoting hematopoietic cell cytotoxicity
US12018081B1 (en) * 2019-08-28 2024-06-25 The Regents Of The University Of Colorado, A Body Corporate Photoconjugation reactions for modification of specific proteins on live cells
CN112500492B (zh) * 2019-09-13 2023-08-04 中国科学院分子细胞科学卓越创新中心 一种嵌合抗原受体及其用途
CN111574616B (zh) * 2020-06-17 2021-02-02 深圳豪石生物科技有限公司 分离的t细胞受体和应用
CN116635519A (zh) * 2020-11-26 2023-08-22 上海医药集团生物治疗技术有限公司 一种经修饰的免疫细胞及其应用
CA3208203A1 (en) * 2021-03-12 2022-09-15 Harlan S. Robins Crohn's disease-associated t cell receptor-related methods
CN115505572B (zh) * 2021-06-22 2025-11-14 康立泰生物医药(青岛)有限公司 一种增强型抗肿瘤nk细胞及其制备方法和应用
CN116083369B (zh) * 2022-09-01 2025-05-09 华中科技大学同济医学院附属同济医院 双特异性抗体修饰囊泡、双特异性抗体、核酸、重组载体、基因工程细胞、方法和应用
WO2025064482A2 (en) * 2023-09-19 2025-03-27 Ginkgo Bioworks, Inc. Chimeric immune cell receptors
CN117106035B (zh) * 2023-10-25 2024-04-23 烟台药物研究所 一种肿瘤靶向多肽、多肽偶联药物及制备与应用

Citations (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4694778A (en) 1984-05-04 1987-09-22 Anicon, Inc. Chemical vapor deposition wafer boat
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5993434A (en) 1993-04-01 1999-11-30 Genetronics, Inc. Method of treatment using electroporation mediated delivery of drugs and genes
US6120766A (en) 1991-12-04 2000-09-19 Hale; Geoffrey CDW52-specific antibody for treatment of multiple sclerosis
US6181964B1 (en) 1997-08-01 2001-01-30 Genetronics, Inc. Minimally invasive apparatus and method to electroporate drugs and genes into tissue
US6241701B1 (en) 1997-08-01 2001-06-05 Genetronics, Inc. Apparatus for electroporation mediated delivery of drugs and genes
US6678556B1 (en) 1998-07-13 2004-01-13 Genetronics, Inc. Electrical field therapy with reduced histopathological change in muscle
US20040014645A1 (en) 2002-05-28 2004-01-22 Advisys, Inc. Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system
US20040059285A1 (en) 2002-07-04 2004-03-25 Inovio As Electroporation device and injection apparatus
US20040092907A1 (en) 1997-04-03 2004-05-13 Inovio As Method for muscle delivery of drugs, nucleic acids and other compounds
US20050052630A1 (en) 2002-03-07 2005-03-10 Advisys, Inc. Constant current electroporation device and methods of use
US20050070841A1 (en) 2002-07-04 2005-03-31 Inovio As Electroporation device and injection apparatus
AU2006265108A1 (en) 2005-07-01 2007-01-11 E. R. Squibb & Sons, L.L.C. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
US7171264B1 (en) 1999-05-10 2007-01-30 Genetronics, Inc. Intradermal delivery of active agents by needle-free injection and electroporation
US7173116B2 (en) 2000-03-03 2007-02-06 Genetronics Biomedical Corporation Nucleic acid formulations for gene delivery and methods of use
US20070128708A1 (en) 2005-12-07 2007-06-07 Genetronics, Inc. Variable volume electroporation chamber and methods therefore
US7585960B2 (en) 2005-05-11 2009-09-08 Theramab Gmbh Nucleic acids encoding superagonistic anti-CD28 antibodies
US8147834B2 (en) 2008-11-07 2012-04-03 Imclone Llc Anti-TGF-beta receptor II antibodies
US20120294874A1 (en) * 2009-11-19 2012-11-22 Paul Anthony Macary Method for Producing T Cell Receptor-Like Monoclonal Antibodies and Uses Thereof
US20130050275A1 (en) 2011-08-31 2013-02-28 Fujitsu Limited Pointer position correction method, storage medium storing pointer position correction program and server
WO2013123061A1 (en) * 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
US20130274203A1 (en) * 2010-09-21 2013-10-17 The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv Anti-ssx-2 t cell receptors and related materials and methods of use
WO2014011988A2 (en) * 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Enhancing activity of car t cells by co-introducing a bispecific antibody
WO2014138306A1 (en) * 2013-03-05 2014-09-12 Baylor College Of Medicine Engager cells for immunotherapy

Family Cites Families (64)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA120409A (en) 1909-05-13 1909-09-07 Hiram Lucas Piper Signal lamp
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
US4444887A (en) 1979-12-10 1984-04-24 Sloan-Kettering Institute Process for making human antibody producing B-lymphocytes
US4716111A (en) 1982-08-11 1987-12-29 Trustees Of Boston University Process for producing human antibodies
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
GB8607679D0 (en) 1986-03-27 1986-04-30 Winter G P Recombinant dna product
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5413923A (en) 1989-07-25 1995-05-09 Cell Genesys, Inc. Homologous recombination for universal donor cells and chimeric mammalian hosts
GB8928874D0 (en) 1989-12-21 1990-02-28 Celltech Ltd Humanised antibodies
ES2087997T3 (es) 1990-01-12 1996-08-01 Cell Genesys Inc Generacion de anticuerpos xenogenicos.
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
ES2108048T3 (es) 1990-08-29 1997-12-16 Genpharm Int Produccion y utilizacion de animales inferiores transgenicos capaces de producir anticuerpos heterologos.
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
DE69233482T2 (de) 1991-05-17 2006-01-12 Merck & Co., Inc. Verfahren zur Verminderung der Immunogenität der variablen Antikörperdomänen
US5199942A (en) 1991-06-07 1993-04-06 Immunex Corporation Method for improving autologous transplantation
ES2136092T3 (es) 1991-09-23 1999-11-16 Medical Res Council Procedimientos para la produccion de anticuerpos humanizados.
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
US6080840A (en) 1992-01-17 2000-06-27 Slanetz; Alfred E. Soluble T cell receptors
US5573905A (en) 1992-03-30 1996-11-12 The Scripps Research Institute Encoded combinatorial chemical libraries
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
DE69433970T2 (de) 1993-08-10 2005-08-11 W.L. Gore & Associates, Inc., Newark Zelleinkapselungsvorrichtung
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
EP0822830B1 (en) 1995-04-27 2008-04-02 Amgen Fremont Inc. Human anti-IL-8 antibodies, derived from immunized xenomice
CA2219486A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5626561A (en) 1995-06-07 1997-05-06 Gore Hybrid Technologies, Inc. Implantable containment apparatus for a therapeutical device and method for loading and reloading the device therein
WO1996039993A1 (en) 1995-06-07 1996-12-19 Gore Hybrid Technologies, Inc. An implantable containment apparatus for a therapeutical device and method for loading and reloading the device therein
AU6854696A (en) 1995-09-22 1997-04-09 Gore Hybrid Technologies, Inc. Improved cell encapsulation device
US5916771A (en) 1996-10-11 1999-06-29 Abgenix, Inc. Production of a multimeric protein by cell fusion method
EP2305027B1 (en) 1996-12-03 2014-07-02 Amgen Fremont Inc. Transgenic mammals having human Ig loci including plural VH and Vkappa regions and antibodies produced therefrom
SI0970126T1 (en) 1997-04-14 2001-08-31 Micromet Ag Novel method for the production of antihuman antigen receptors and uses thereof
US6235883B1 (en) 1997-05-05 2001-05-22 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
ES2637801T3 (es) 2000-04-11 2017-10-17 Genentech, Inc. Anticuerpos multivalentes y usos de los mismos
EP1188825A1 (en) * 2000-09-18 2002-03-20 Universiteit Leiden T cell receptor transfer into a candidate effector cell or a precursor thereof
DE10109854A1 (de) * 2001-03-01 2002-09-12 Thomas Stanislawski Polypeptide eines hdm2-Protein spezifischen murinen alpha/beta T-Zell Rezeptors, diese kodierende Nukleinsäuren und deren Verwendung
AU2003233197A1 (en) * 2002-04-29 2003-11-17 Genpat77 Pharmacogenetics Ag Novel antibody binding tcr and tirc7 and its use in therapy and diagnosis
US7446190B2 (en) * 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
DE10244457A1 (de) * 2002-09-24 2004-04-01 Johannes-Gutenberg-Universität Mainz Verfahren zur rationalen Mutagenese von alpha/beta T-Zell Rezeptoren und entsprechend mutierte MDM2-Protein spezifische alpha/beta T-Zell Rezeptoren
ATE416190T1 (de) 2003-07-04 2008-12-15 Affibody Ab Polypeptide mit bindungsaffinität für her2
JP5634008B2 (ja) 2004-04-06 2014-12-03 アフィボディ・アーベー 新規の使用および方法
EP1611850A1 (fr) * 2004-06-28 2006-01-04 Cardio Life Research S.A. Dispositif d'occlusion et de ponction étanche pour structure anatomique.
WO2006007539A1 (en) * 2004-07-01 2006-01-19 Virxsys Corporation Vector packaging cell line
GB0524788D0 (en) 2005-12-05 2006-01-11 Affibody Ab Polypeptides
WO2009019117A1 (en) 2007-08-03 2009-02-12 Affibody Ab Igf-1r binding polypeptides and their use
EP2072525A1 (en) 2007-12-21 2009-06-24 Affibody AB New polypeptides having affinity for HER2
SI2235064T1 (sl) 2008-01-07 2016-04-29 Amgen Inc. Metoda za izdelavo heterodimernih molekul - protitelesa fc z uporabo elektrostatičnih usmerjevalnih učinkov
CA2779436A1 (en) * 2008-10-31 2010-05-06 Biogen Idec Ma Inc. Light targeting molecules and uses thereof
GB0911566D0 (en) * 2009-07-03 2009-08-12 Immunocore Ltd T cell receptors
GB0917090D0 (en) 2009-09-29 2009-11-11 Ucl Biomedica Plc T-cell receptor
EP2494038B1 (en) * 2009-10-27 2019-06-26 Immunicum AB Method for proliferation of antigen-specific t cells
AU2011319727B2 (en) * 2010-10-27 2016-06-30 Baylor College Of Medicine Chimeric CD27 receptors for redirecting T cells to CD70-positive malignancies
CA2842368A1 (en) * 2011-07-29 2013-02-07 The Trustees Of The University Of Pennsylvania Switch costimulatory receptors
CA2848410A1 (en) * 2011-09-16 2013-03-21 The Trustees Of The University Of Pennsylvania Rna engineered t cells for the treatment of cancer
CN112458057A (zh) * 2012-10-02 2021-03-09 纪念斯隆-凯特琳癌症中心 用于免疫疗法的组合物和方法
EP2961831B1 (en) * 2013-02-26 2020-06-10 Memorial Sloan Kettering Cancer Center Compositions and methods for immunotherapy
TWI654206B (zh) * 2013-03-16 2019-03-21 諾華公司 使用人類化抗-cd19嵌合抗原受體治療癌症
MA41538A (fr) * 2014-10-17 2017-12-26 Baylor College Medicine Cellules immunitaires bipartites et tripartites de signalisation

Patent Citations (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4694778A (en) 1984-05-04 1987-09-22 Anicon, Inc. Chemical vapor deposition wafer boat
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US6120766A (en) 1991-12-04 2000-09-19 Hale; Geoffrey CDW52-specific antibody for treatment of multiple sclerosis
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
US6567694B2 (en) 1993-04-01 2003-05-20 Genetronics, Inc. Needle electrodes for mediated delivery of drugs and genes
US5993434A (en) 1993-04-01 1999-11-30 Genetronics, Inc. Method of treatment using electroporation mediated delivery of drugs and genes
US20040092907A1 (en) 1997-04-03 2004-05-13 Inovio As Method for muscle delivery of drugs, nucleic acids and other compounds
US6181964B1 (en) 1997-08-01 2001-01-30 Genetronics, Inc. Minimally invasive apparatus and method to electroporate drugs and genes into tissue
US6233482B1 (en) 1997-08-01 2001-05-15 Genetronics, Inc. Method of electroporation mediated delivery of drugs and genes
US6241701B1 (en) 1997-08-01 2001-06-05 Genetronics, Inc. Apparatus for electroporation mediated delivery of drugs and genes
US6516223B2 (en) 1997-08-01 2003-02-04 Genetronics, Inc. Apparatus for electroporation mediated delivery for drugs and genes
US6678556B1 (en) 1998-07-13 2004-01-13 Genetronics, Inc. Electrical field therapy with reduced histopathological change in muscle
US7171264B1 (en) 1999-05-10 2007-01-30 Genetronics, Inc. Intradermal delivery of active agents by needle-free injection and electroporation
US7173116B2 (en) 2000-03-03 2007-02-06 Genetronics Biomedical Corporation Nucleic acid formulations for gene delivery and methods of use
US20050052630A1 (en) 2002-03-07 2005-03-10 Advisys, Inc. Constant current electroporation device and methods of use
US20040014645A1 (en) 2002-05-28 2004-01-22 Advisys, Inc. Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system
US20050070841A1 (en) 2002-07-04 2005-03-31 Inovio As Electroporation device and injection apparatus
US20040059285A1 (en) 2002-07-04 2004-03-25 Inovio As Electroporation device and injection apparatus
US7585960B2 (en) 2005-05-11 2009-09-08 Theramab Gmbh Nucleic acids encoding superagonistic anti-CD28 antibodies
AU2006265108A1 (en) 2005-07-01 2007-01-11 E. R. Squibb & Sons, L.L.C. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
US20070128708A1 (en) 2005-12-07 2007-06-07 Genetronics, Inc. Variable volume electroporation chamber and methods therefore
US8147834B2 (en) 2008-11-07 2012-04-03 Imclone Llc Anti-TGF-beta receptor II antibodies
US20120294874A1 (en) * 2009-11-19 2012-11-22 Paul Anthony Macary Method for Producing T Cell Receptor-Like Monoclonal Antibodies and Uses Thereof
US20130274203A1 (en) * 2010-09-21 2013-10-17 The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv Anti-ssx-2 t cell receptors and related materials and methods of use
US20130050275A1 (en) 2011-08-31 2013-02-28 Fujitsu Limited Pointer position correction method, storage medium storing pointer position correction program and server
WO2013123061A1 (en) * 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2014011988A2 (en) * 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Enhancing activity of car t cells by co-introducing a bispecific antibody
WO2014138306A1 (en) * 2013-03-05 2014-09-12 Baylor College Of Medicine Engager cells for immunotherapy

Non-Patent Citations (47)

* Cited by examiner, † Cited by third party
Title
BARRETT ET AL., HUM GENE THER, vol. 22, pages 1575 - 1586
BARRETT ET AL., HUMAN GENE THERAPY, vol. 22, no. 12, 2011, pages 1575 - 1586
BIERER ET AL., CURR. OPIN. IMMUN., vol. 5, 1993, pages 763 - 773
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
COLIGAN: "Short Protocols in Molecular Biology", 2002
COUGOT ET AL., TRENDS IN BIOCHEM. SCI., vol. 29, 2001, pages 436 - 444
DUDLEY ET AL., J. IMMUNOL., vol. 26, no. 4, 2003, pages 332 - 342
ELANGO ET AL., BIOCHIM. BIOPHYS. RES. COMMUN., vol. 330, 2005, pages 958 - 966
FEDWISCH ET AL., JOURNAL OF MOLECULAR BIOLOGY, vol. 398, no. 2, 2010, pages 232 - 247
FRIEDMAN ET AL., JOURNAL OF MOLECULAR BIOLOGY, vol. 376, no. 5, 2008, pages 1388 - 1402
FRIEDMAN ET AL., PROTEIN ENGINEERING, DESIGN & SELECTION : PEDS, vol. 20, no. 4, 2007, pages 189 - 199
GAIT: "Oligonucleotide Synthesis", 1984
GHOSH ET AL., GLYCOBIOLOGY, vol. 5, 1991, pages 505 - 10
GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368
HENDERSON ET AL., IMMUN., vol. 73, 1991, pages 316 - 321
HERMANS ET AL., J IMMUNOL METHODS, vol. 285, 2004, pages 25 - 40
HOLLIGER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 90, 1993, pages 6444 - 48
HOOGENBOOM ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
HOUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
J IMMUNOL, vol. 180, no. 9, 2008, pages 6116 - 6131
JOHNSON, KEVIN SCHISWELL, DAVID J., CURRENT OPINION IN STRUCTURAL BIOLOGY, vol. 3, 1993, pages 564 - 571
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
LAMER ET AL., BLOOD, vol. 117, 2011, pages 72 - 82
LIU ET AL., CELL, vol. 66, 1991, pages 807 - 815
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553
MILLERCALOS: "Gene Transfer Vectors for Mammalian Cells", 1987
MILSTEIN ET AL., NATURE, vol. 305, 1983, pages 537 - 39
NACHEVABERZAL-HERRANZ, EUR. J. BIOCHEM., vol. 270, 2003, pages 1485 - 65
NISHIKAWA ET AL., HUM GENE THER., vol. 12, no. 8, 2001, pages 861 - 70
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 106, no. 9, 2009, pages 3360 - 3365
REICHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
RIECHMANN, JOURNAL OF IMMUNOLOGICAL METHODS, vol. 231, 1999, pages 25 - 38
ROSENBERG ET AL., NEW ENG. J. OF MED., vol. 319, 1988, pages 1676
SAMBROOK: "Molecular Cloning: A Laboratory Manual", 2012
SCHENBORNMIERENDORF, NUC ACIDS RES., vol. 13, 1985, pages 6223 - 36
See also references of EP3212225A4
SKERRA ET AL., SCIENCE, vol. 242, 1988, pages 1038 - 1041
STEPINSKI ET AL., RNA, vol. 7, 2001, pages 1468 - 95
THE JOURNAL OF EXPERIMENTAL MEDICINE, vol. 201, no. 8, 2005, pages 1243 - 1255
VAUGHAN ET AL., NATURE BIOTECH., vol. 14, 1996, pages 309
WARD ET AL., NATURE, vol. 334, 1989, pages 54454
WEIR: "Handbook of Experimental Immunology", 1997
ZHAO ET AL., BLOOD, vol. 102, 2003, pages 4137 - 4142
ZHAO ET AL., CANCER RES, vol. 70, 2010, pages 9053 - 9061
ZHAO ET AL., CANCER RESEARCH, vol. 70, no. 22, 2010, pages 9053 - 9061

Cited By (99)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10358474B2 (en) 2015-05-18 2019-07-23 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US10358473B2 (en) 2015-05-18 2019-07-23 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11965012B2 (en) 2015-05-18 2024-04-23 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
EP3298033B2 (en) 2015-05-18 2023-07-12 TCR2 Therapeutics Inc. Compositions and medical uses for tcr reprogramming using fusion proteins
US10442849B2 (en) 2015-05-18 2019-10-15 Tcr2 Therabeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11028142B2 (en) 2015-05-18 2021-06-08 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11059880B2 (en) 2015-06-30 2021-07-13 Arizona Board Of Regents On Behalf Of The University Of Arizona Redirected cells with MHC chimeric receptors and methods of use in immunotherapy
US12577289B2 (en) 2015-06-30 2026-03-17 Arizona Board Of Regents On Behalf Of The University Of Arizona Surrogate co-receptors for t cells and methods of use
US11649435B2 (en) 2015-08-28 2023-05-16 The Trustees Of The University Of Pennsylvania Methods and compositions for cells expressing a chimeric intracellular signaling molecule
US11890301B2 (en) 2015-08-28 2024-02-06 The Trustees Of The University Of Pennsylvania Methods and compositions for cells expressing a chimeric intracellular signaling molecule
EP3340995A4 (en) * 2015-08-28 2019-04-03 The Trustees Of The University Of Pennsylvania METHOD AND COMPOSITIONS FOR CELLS FOR EXPRESSING A CHIMERIC INTRA-CELLULAR SIGNAL MOLECULE
EP3569244A1 (en) 2015-09-23 2019-11-20 CytoImmune Therapeutics, LLC Flt3 directed car cells for immunotherapy
WO2017069958A2 (en) 2015-10-09 2017-04-27 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
US11186825B2 (en) 2015-10-28 2021-11-30 The Broad Institute, Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting POU2AF1
US11180730B2 (en) 2015-10-28 2021-11-23 The Broad Institute, Inc. Compositions and methods for evaluating and modulating immune responses by detecting and targeting GATA3
US11001622B2 (en) 2015-11-19 2021-05-11 The Brigham And Women's Hospital, Inc. Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein
US11884717B2 (en) 2015-11-19 2024-01-30 The Brigham And Women's Hospital, Inc. Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein
WO2017087708A1 (en) 2015-11-19 2017-05-26 The Brigham And Women's Hospital, Inc. Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity
EP3443014A4 (en) * 2016-04-15 2020-01-01 Zymeworks Inc. MULTI-SPECIFIC ANTIGEN-BINDING CONSTRUCTS AGAINST IMMUNOTHERAPEUTICS
CN113512126A (zh) * 2016-06-20 2021-10-19 深圳市体内生物医药科技有限公司 一种分子、表达其的细胞及其制备方法和用途
CN113512126B (zh) * 2016-06-20 2023-05-05 深圳市体内生物医药科技有限公司 一种分子、表达其的细胞及其制备方法和用途
WO2018006881A1 (zh) * 2016-07-08 2018-01-11 生命序有限公司 重组免疫检查点受体及其应用
WO2018006880A1 (zh) * 2016-07-08 2018-01-11 生命序有限公司 重组免疫检查点受体及免疫检查点抑制分子的共表达及应用
US11242376B2 (en) 2016-08-02 2022-02-08 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
WO2018049025A2 (en) 2016-09-07 2018-03-15 The Broad Institute Inc. Compositions and methods for evaluating and modulating immune responses
US10208285B2 (en) 2016-10-07 2019-02-19 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US11377638B2 (en) 2016-10-07 2022-07-05 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
WO2018067991A1 (en) 2016-10-07 2018-04-12 The Brigham And Women's Hospital, Inc. Modulation of novel immune checkpoint targets
US11085021B2 (en) 2016-10-07 2021-08-10 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US12447213B2 (en) 2016-10-07 2025-10-21 The Broad Institute, Inc. Modulation of novel immune checkpoint targets
US12227578B2 (en) 2016-11-11 2025-02-18 The Broad Institute, Inc. Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action
US11851491B2 (en) 2016-11-22 2023-12-26 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
US12234479B2 (en) 2016-12-30 2025-02-25 Cytocares (Shanghai) Inc. Bifunctional molecule and use thereof
CN108264562A (zh) * 2016-12-30 2018-07-10 上海欣百诺生物科技有限公司 一种结合cd3和t细胞正共刺激分子的双功能分子及其应用
WO2018120842A1 (zh) * 2016-12-30 2018-07-05 上海欣百诺生物科技有限公司 一种双功能分子及其应用
CN108264562B (zh) * 2016-12-30 2021-08-10 惠和生物技术(上海)有限公司 一种结合cd3和t细胞正共刺激分子的双功能分子及其应用
US12473343B2 (en) 2017-01-10 2025-11-18 The General Hospital Corporation Targeted t cells with cytotoxicity toward immunosuppressive cells
US11963966B2 (en) 2017-03-31 2024-04-23 Dana-Farber Cancer Institute, Inc. Compositions and methods for treating ovarian tumors
US11913075B2 (en) 2017-04-01 2024-02-27 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
WO2018191553A1 (en) 2017-04-12 2018-10-18 Massachusetts Eye And Ear Infirmary Tumor signature for metastasis, compositions of matter methods of use thereof
US12378297B2 (en) * 2017-04-14 2025-08-05 The General Hospital Corporation Chimeric antigen receptor T cells targeting the tumor microenvironment
US20200113940A1 (en) * 2017-04-14 2020-04-16 The General Hospital Corporation Chimeric antigen receptor t cells targeting the tumor microenvironment
JP2020517281A (ja) * 2017-04-26 2020-06-18 メモリアル スローン ケタリング キャンサー センター すぐに使える凍結保存細胞
CN110868853A (zh) * 2017-04-26 2020-03-06 纪念斯隆-凯特琳癌症中心 即用型冷冻保存细胞
WO2018200784A1 (en) * 2017-04-26 2018-11-01 Memorial Sloan-Kettering Cancer Center Ready-to-use cryopreserved cells
US12226479B2 (en) 2017-05-11 2025-02-18 The General Hospital Corporation Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof
US11897953B2 (en) 2017-06-14 2024-02-13 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
US12049643B2 (en) 2017-07-14 2024-07-30 The Broad Institute, Inc. Methods and compositions for modulating cytotoxic lymphocyte activity
US12440545B2 (en) 2017-09-18 2025-10-14 Trustees Of Boston University Methods for treating NETosis and neutrophil activation
JP2020534296A (ja) * 2017-09-18 2020-11-26 トラスティーズ オブ ボストン ユニバーシティ ネトーシスおよび好中球活性化を処置するための方法
JP7404230B2 (ja) 2017-09-18 2023-12-25 トラスティーズ オブ ボストン ユニバーシティ ネトーシスおよび好中球活性化を処置するための方法
JP2024012612A (ja) * 2017-09-22 2024-01-30 ウーシー バイオロジクス アイルランド リミテッド 新規二重特異性ポリペプチド複合体
JP7387611B2 (ja) 2017-09-22 2023-11-28 ウーシー バイオロジクス アイルランド リミテッド 新規二重特異性ポリペプチド複合体
US11845796B2 (en) 2017-09-22 2023-12-19 WuXi Biologics Ireland Limited Bispecific polypeptide complexes
JP2020534034A (ja) * 2017-09-22 2020-11-26 ウーシー バイオロジクス アイルランド リミティド 新規二重特異性ポリペプチド複合体
US12043870B2 (en) 2017-10-02 2024-07-23 The Broad Institute, Inc. Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer
WO2019070755A1 (en) 2017-10-02 2019-04-11 The Broad Institute, Inc. METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER
US11732257B2 (en) 2017-10-23 2023-08-22 Massachusetts Institute Of Technology Single cell sequencing libraries of genomic transcript regions of interest in proximity to barcodes, and genotyping of said libraries
US12171783B2 (en) 2017-11-13 2024-12-24 The Broad Institute, Inc. Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas
WO2019094983A1 (en) 2017-11-13 2019-05-16 The Broad Institute, Inc. Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway
US11994512B2 (en) 2018-01-04 2024-05-28 Massachusetts Institute Of Technology Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity
EP4495246A2 (en) 2018-03-01 2025-01-22 University of Kansas Techniques for generating cell-based therapeutics using recombinant t cell receptor genes
US11957695B2 (en) 2018-04-26 2024-04-16 The Broad Institute, Inc. Methods and compositions targeting glucocorticoid signaling for modulating immune responses
WO2019232542A2 (en) 2018-06-01 2019-12-05 Massachusetts Institute Of Technology Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients
US12036240B2 (en) 2018-06-14 2024-07-16 The Broad Institute, Inc. Compositions and methods targeting complement component 3 for inhibiting tumor growth
WO2020033366A1 (en) 2018-08-08 2020-02-13 Nantbio, Inc. Recombinant cd1-restricted t cells and methods
EP3833743A4 (en) * 2018-08-08 2022-05-04 NantBio, Inc. RECOMBINANT CD1-RESTRICTED T-CELLS AND METHODS
WO2020072700A1 (en) 2018-10-02 2020-04-09 Dana-Farber Cancer Institute, Inc. Hla single allele lines
WO2020081730A2 (en) 2018-10-16 2020-04-23 Massachusetts Institute Of Technology Methods and compositions for modulating microenvironment
WO2020131586A2 (en) 2018-12-17 2020-06-25 The Broad Institute, Inc. Methods for identifying neoantigens
US11739156B2 (en) 2019-01-06 2023-08-29 The Broad Institute, Inc. Massachusetts Institute of Technology Methods and compositions for overcoming immunosuppression
JP2022518530A (ja) * 2019-01-28 2022-03-15 ウーシー バイオロジクス アイルランド リミティド 新規二重特異性cd3/cd20ポリペプチド複合体
JP7261307B2 (ja) 2019-01-28 2023-04-19 ウーシー バイオロジクス アイルランド リミテッド 新規二重特異性cd3/cd20ポリペプチド複合体
WO2020186101A1 (en) 2019-03-12 2020-09-17 The Broad Institute, Inc. Detection means, compositions and methods for modulating synovial sarcoma cells
WO2020191079A1 (en) 2019-03-18 2020-09-24 The Broad Institute, Inc. Compositions and methods for modulating metabolic regulators of t cell pathogenicity
WO2020236967A1 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Random crispr-cas deletion mutant
WO2020243371A1 (en) 2019-05-28 2020-12-03 Massachusetts Institute Of Technology Methods and compositions for modulating immune responses
WO2021030627A1 (en) 2019-08-13 2021-02-18 The General Hospital Corporation Methods for predicting outcomes of checkpoint inhibition and treatment thereof
US12421557B2 (en) 2019-08-16 2025-09-23 The Broad Institute, Inc. Methods for predicting outcomes and treating colorectal cancer using a cell atlas
WO2021041922A1 (en) 2019-08-30 2021-03-04 The Broad Institute, Inc. Crispr-associated mu transposase systems
WO2021050656A1 (en) * 2019-09-11 2021-03-18 The Trustees Of The Univeristy Of Pennsylvania Compositions and methods comprising prostate stem cell antigen (psca) chimeric antigen receptors (cars)
US11766453B2 (en) 2019-09-11 2023-09-26 The Trustees Of The University Of Pennsylvania Compositions and methods comprising prostate stem cell antigen (PSCA) chimeric antigen receptors (CARs)
US12297426B2 (en) 2019-10-01 2025-05-13 The Broad Institute, Inc. DNA damage response signature guided rational design of CRISPR-based systems and therapies
US12394502B2 (en) 2019-10-02 2025-08-19 The General Hospital Corporation Method for predicting HLA-binding peptides using protein structural features
US11981922B2 (en) 2019-10-03 2024-05-14 Dana-Farber Cancer Institute, Inc. Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment
US12195725B2 (en) 2019-10-03 2025-01-14 Dana-Farber Cancer Institute, Inc. Compositions and methods for modulating and detecting tissue specific TH17 cell pathogenicity
US11793787B2 (en) 2019-10-07 2023-10-24 The Broad Institute, Inc. Methods and compositions for enhancing anti-tumor immunity by targeting steroidogenesis
US11844800B2 (en) 2019-10-30 2023-12-19 Massachusetts Institute Of Technology Methods and compositions for predicting and preventing relapse of acute lymphoblastic leukemia
US12165747B2 (en) 2020-01-23 2024-12-10 The Broad Institute, Inc. Molecular spatial mapping of metastatic tumor microenvironment
WO2021212069A1 (en) 2020-04-17 2021-10-21 City Of Hope Flt3-targeted chimeric antigen receptor modified cells for treatment of flt3-positive malignancies
US11667723B2 (en) 2020-08-17 2023-06-06 Utc Therapeutics (Shanghai) Co., Ltd. Lymphocytes-antigen presenting cells co-stimulators and uses thereof
KR20230157371A (ko) 2021-03-17 2023-11-16 다이이찌 산쿄 가부시키가이샤 항아세틸콜린 수용체 자기 항체에 대한 키메라 수용체를 코드하는 유전자
WO2022196719A1 (ja) 2021-03-17 2022-09-22 第一三共株式会社 抗アセチルコリン受容体自己抗体に対するキメラ受容体をコードする遺伝子
US20250345424A1 (en) * 2022-06-06 2025-11-13 Caribou Biosciences, Inc. Treatment of autoimmune diseases with engineered immune cells
WO2024077256A1 (en) 2022-10-07 2024-04-11 The General Hospital Corporation Methods and compositions for high-throughput discovery ofpeptide-mhc targeting binding proteins
WO2024124044A1 (en) 2022-12-07 2024-06-13 The Brigham And Women’S Hospital, Inc. Compositions and methods targeting sat1 for enhancing anti¬ tumor immunity during tumor progression
WO2025059533A1 (en) 2023-09-13 2025-03-20 The Broad Institute, Inc. Crispr enzymes and systems
WO2025097055A2 (en) 2023-11-02 2025-05-08 The Broad Institute, Inc. Compositions and methods of use of t cells in immunotherapy
WO2025117544A1 (en) 2023-11-29 2025-06-05 The Broad Institute, Inc. Engineered omega guide molecule and iscb compositions, systems, and methods of use thereof

Also Published As

Publication number Publication date
JP2025188145A (ja) 2025-12-25
PT3212225T (pt) 2026-02-26
JP2021121208A (ja) 2021-08-26
JP7372728B2 (ja) 2023-11-01
KR20170074243A (ko) 2017-06-29
AU2015338984A1 (en) 2017-04-27
CA2964958A1 (en) 2016-05-06
CN107106670A (zh) 2017-08-29
JP7757343B2 (ja) 2025-10-21
HK1243333A1 (zh) 2018-07-13
JP2023123445A (ja) 2023-09-05
EP4653013A3 (en) 2026-03-04
EP3212225A4 (en) 2018-10-17
JP2017533706A (ja) 2017-11-16
US20170258835A1 (en) 2017-09-14
EP4653013A2 (en) 2025-11-26
EP3212225A1 (en) 2017-09-06
EP3212225B1 (en) 2025-11-19

Similar Documents

Publication Publication Date Title
JP7757343B2 (ja) 改変t細胞に関する方法および組成物
US20240342213A1 (en) Methods and Compositions for Cells Expressing a Chimeric Intracellular Signaling Molecule
AU2015339743B2 (en) Altering gene expression in modified T cells and uses thereof
US20230110342A1 (en) Compositions and methods of stimulating and expanding t cells
AU2015380397A1 (en) Compositions and methods for T cell delivery of therapeutic molecules
US20240026293A1 (en) Methods and Compositions for Cells Expressing a Chimeric Intracellular Signaling Molecule
WO2017011316A1 (en) Treatment of a canine cd20 positive disease or condition using a canine cd20-specific chimeric antigen receptor
HK1243334B (en) Compositions and methods of stimulating and expanding t cells
HK1257442B (en) Methods and compositions for cells expressing a chimeric intracellular signaling molecule

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15855013

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2964958

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2015338984

Country of ref document: AU

Date of ref document: 20151030

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017523266

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20177014658

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015855013

Country of ref document: EP

WWG Wipo information: grant in national office

Ref document number: 2015855013

Country of ref document: EP