WO2016055592A1 - Bispecific antibodies against cd3epsilon and ror1 - Google Patents

Bispecific antibodies against cd3epsilon and ror1 Download PDF

Info

Publication number
WO2016055592A1
WO2016055592A1 PCT/EP2015/073308 EP2015073308W WO2016055592A1 WO 2016055592 A1 WO2016055592 A1 WO 2016055592A1 EP 2015073308 W EP2015073308 W EP 2015073308W WO 2016055592 A1 WO2016055592 A1 WO 2016055592A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
rorl
fab
cells
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2015/073308
Other languages
English (en)
French (fr)
Inventor
Minh Diem VU
Klaus Strein
Oliver Ast
Tanja FAUTI
Anne Freimoser-Grundschober
Ralf Hosse
Christian Klein
Ekkehard Moessner
Samuel Moser
Ramona MURR
Pablo Umana
Sabine JUNG-IMHOF
Stefan Klostermann
Michael MOLHOJ
Joerg Regula
Wolfgang Schaefer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Engmab SARL
Original Assignee
Engmab SARL
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Engmab SARL filed Critical Engmab SARL
Priority to ES15778294T priority Critical patent/ES2850325T3/es
Priority to US15/517,296 priority patent/US11952421B2/en
Priority to EP15778294.7A priority patent/EP3204415B1/en
Priority to JP2017518525A priority patent/JP6708635B2/ja
Priority to CA2963692A priority patent/CA2963692A1/en
Priority to AU2015329965A priority patent/AU2015329965A1/en
Publication of WO2016055592A1 publication Critical patent/WO2016055592A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell

Definitions

  • the present invention relates to novel bispecific antibodies against CD3s and RORl, their manufacture and use.
  • the receptor is described in Masiakowski P., Carroll R.D., J. Biol. Chem. 267:26181-26190(1992) "A novel family of cell surface receptors with tyrosine kinase-like domain.”
  • W09218149 and WO9527060 mention ROR-1 as Rtk-2 and antibodies against ROR-1.
  • WO2002087618 mentions a method of controlling the growth and differentiation of cancer by selectively inhibiting a growth factor receptor. Such a receptor would be Rorl or Ror2.
  • WO2005100605 mentions RORl as a therapeutic target for breast cancer and anti RORl antibodies which specifically bind to RORl, to the extracellular region of RORl (M1-V406) and RORl fragments Q73-V139, E165-I299, K312-C391.
  • WO2007051077 relates to an anti-RORl antibody and its use in lymphoma cell detection.
  • WO2008103849 also mentions anti- ROR1 antibodies. Rabbani H.
  • WO2011159847 relates to an anti-RORl antibody as a conjugate with a biologically active molecule for the treatment of RORl cancer like lymphoma or adenocarcinoma.
  • WO2008076868, WO2008103849, WO201008069, WO2010124188, WO2011079902, WO2011054007, WO2011159847, WO2012076066, WO2012076727, WO 2012045085, and WO2012097313 relate also to RORl binding molecules or anti RORl antibodies.
  • WO2012075158 relates to an anti-RORl antibody comprising as light chain variable domain (VL) the sequence of SEQ ID NO:2 and as variable heavy chain domain (VH) the sequence of SEQ ID NO:6, and as respective CDRs the sequences of SEQ ID NO: 3, 4, 5, 7, 8, 9.
  • This antibody is further named as MABl .
  • WO201209731 relates to an anti-RORl antibody comprising as light chain variable domain (VL) the sequence of SEQ ID NO:45 and as variable heavy chain domain (VH) the sequence of SEQ ID NO:42. This antibody is further named as MAB2.
  • WO2012075158 relates to an anti- RORl antibody comprising as light chain variable domain (VL) the sequence of SEQ ID NO:46 and as variable heavy chain domain (VH) the sequence of SEQ ID NO:43. This antibody is further named as MAB3.
  • WO2012075158 relates to an anti-RORl antibody comprising as light chain variable domain (VL) the sequence of SEQ ID NO:47 and as variable heavy chain domain (VH) the sequence of SEQ ID NO:44. This antibody is further named as MAB4.
  • WO2005040413 is directed to a screening method for the identification and/or validation of inhibitors of a receptor tyrosine kinase activity, including ROR1.
  • WO2008036449, WO2011014659 and WO2011050262 mention bispecific antibodies wherein one target can be ROR1.
  • WO2007146968 mention multivalent single-chain binding proteins with effector function and ROR1 and CD3 are mentioned as possible targets.
  • WO2011054007 is directed to a method of treatment of cancer administering an affinity reagent which binds to the extracellular domain of ROR1. Bispecific antibodies with CD3 are also mentioned.
  • WO2014031174 mentions bispecific antibodies which are specific to two different epitopes of RORl.
  • the preferred antibody D10 strongly internalizes at 37°C in MDA MB 231 epithelial breast adenocarcinoma.
  • Rebagay R. et al., Frontiers in Oncology (2012) 7, Article 34, 1-8 mention that RORs are pharmaceutical targets and a means to deliver cytotoxic agents in the cells which express the target on the cell surface.
  • Rebagay also mention bispecific antibodies such as BiTE. Strong internalization is favorable for armed antibodies i.e. antibody drug conjugates according to Rebagay. D.
  • Mezzanzanica D et al., Int. Journal of Cancer, 41 (1988) 609-615 investigated a therapeutic approach by retargeting CTLs by a bispecific antibody consisting of MOvl8 (a poorly internalizing folate receptor alpha antibody specific for human ovarian carcinoma cells) and an anti-CD3 antibody (OKT3 or TR66).
  • MOvl8 a poorly internalizing folate receptor alpha antibody specific for human ovarian carcinoma cells
  • OKT3 or TR66 anti-CD3 antibody
  • Hudecek M et al., Blood, 116 (2010), 4532-4541 mention that ROR1 is expressed by B cell chronic lymphocytic leukemia (B-CLL) and mantle cell lymphoma (MCL).
  • B-CLL B cell chronic lymphocytic leukemia
  • MCL mantle cell lymphoma
  • Such cells can be targeted by activated CD8 + T cells transfected with, and expressing scFv from murine anti-RORl antibody
  • Baskar S. et al., mAbs 4:3 (2012) 349-361 relate to the targeting of malignant B cells with an immunotoxin BT-1 comprising scFv 2A2 anti-RORl conjugated to PE38 toxin.
  • the immunotoxin is partially internalized and induces apoptosis.
  • the TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha (a)/beta ( ⁇ ) or TCR gamma (y)/delta ( ⁇ ) heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma ( ⁇ ), delta ( ⁇ ), epsilon ( ⁇ ), zeta ( ⁇ ), and eta ( ⁇ ).
  • Human CD3s is described under UniProt P07766 (CD3E HUMAN).
  • An anti CD3s antibody described in the state of the art is SP34 (Yang SJ, The Journal of Immunology (1986) 137; 1097-1100). SP34 reacts with both primate and human CD3.
  • a further anti CD3 antibody described in the state of the art is UCHT-1 (see WO2000041474).
  • a further anti CD3 antibody described in the state of the art is BC- 3 (Fred Hutchinson Cancer Research Institute; used in Phase I/II trials of GvHD, Anasetti C et al., Transplantation 54: 844 (1992)).
  • a wide variety of recombinant bispecific antibody formats have been developed in the recent past, e.g. by fusion of, e.g. an IgG antibody format and single chain domains (see Kontermann RE, mAbs 4:2, (2012) 1-16).
  • Bispecific antibodies wherein the variable domains VL and VH or the constant domains CL and CHI are replaced by each other are described in WO2009080251 and WO2009080252.
  • the percentage of heterodimer could be further increased by remodeling the interaction surfaces of the two CH3 domains using a phage display approach and the introduction of a disulfide bridge to stabilize the heterodimers (Merchant AM, et al, Nature Biotech 16 (1998) 677-681 ; Axwell S, Ridgway JB, Wells JA, Carter P., J Mol Biol 270 (1997) 26-35).
  • New approaches for the knobs-into-holes technology are described in e.g. in EP 1870459A1. Although this format appears very attractive, no data describing progression towards the clinic are currently available.
  • One important constraint of this strategy is that the light chains of the two parent antibodies have to be identical to prevent mispairing and formation of inactive molecules.
  • WO 201302362 relate to heterodimerized polypeptides.
  • WO201312733 relates to polypeptides comprising heterodimeric Fc regions.
  • WO2012131555 relates to engineered heterodimeric immunoglobulins.
  • EP 2647707 relates to engineered hetero-dimeric immunoglobulins.
  • WO2009080251, WO 2009080252, WO 2009080253, WO 2009080254 and Schaefer, W. et al, PNAS, 108 (2011) 11187- 1191 relate to bivalent, bispecific IgG antibodies with a domain crossover.
  • the multispecific antibodies with VH/VL replacement/exchange in one binding to prevent light chain mispairing (CrossMabVH-VL) which are described in WO2009080252, (see also Schaefer, W. et al, PNAS, 108 (2011) 11187-1191) clearly reduce the byproducts caused by the mismatch of a light chain against a first antigen with the wrong heavy chain against the second antigen (compared to approaches without such domain exchange). However their preparation is not completely free of side products. The main side product is based on a Bence-Jones-type interaction (Schaefer, W. et al, PNAS, 108 (2011) 11187-1191). Accordingly there is a need for bispecific antibodies against CD3s and RORl with VH/VL exchange which can be produced in high yield and easily purified.
  • Ovarian cancer is the leading cause of death from gynecologic cancer in the United States and the seventh most common cancer and the eighth most common cause of death from cancers in women.
  • An estimated 21,980 new cases of ovarian cancer and 14,270 deaths related to ovarian cancers are expected in the United States in 2014.
  • the incidence of ovarian cancer increases with age and is most prevalent in the eighth decade of life. About half of the women diagnosed with ovarian cancer are 63 years or older.. Ovarian cancer usually has a relatively poor prognosis.
  • the 5-year survival rate is 92%, however, only 15% of all cases are detected at this stage. The majority of cases (61%) are diagnosed after the disease has already metastasized. For women diagnosed with distant metastases, the 5 -year survival rate is 27%.
  • advances in surgery and chemotherapy over the past two decades only modest progress has been achieved in improving the overall survival in patients with ovarian cancer. Although the majority of women with advanced ovarian cancer respond to first-line chemotherapy, most responses are not durable. More than 80%> of patients will have a recurrence of their disease after first- line treatment, and more than 50% will die of recurrent disease within 5 years of diagnosis (http://www.cancerresearch.org).
  • Targeted therapy is a newer type of cancer treatment that uses drugs or other substances to identify and attack cancer cells while doing little damage to normal cells.
  • the targeted therapy drug that has been studied the most in ovarian cancer is bevacizumab (Avastin®).
  • bevacizumab has been shown to shrink or slow the growth of advanced ovarian cancers.
  • Trials to see if bevacizumab works even better when given along with chemotherapy have shown good results in terms of shrinking (or stopping the growth of) tumors, but it has not yet been shown to help women live longer (http://www.cancer.org/cancer/ovariancancer).
  • WO2007146957 relate to inhibiting tumor growth with RORl -antagonizing agents. Such agents can be e.g.
  • US8212009 relates to a method for treating a RORl related cancer in a subject.
  • the RORl related cancer are among others also ovarian cancer.
  • WO2011054007 relates to a method for the treatment of ovarian cancer comprising administering an antibody against RORl . Accordingly there is a need for a RORl based agent for the treatment of ovarian cancer.
  • the invention relates to a bispecific antibody specifically binding to the two targets human CD3s (further named also as "CD3”) and the extracellular domain of human RORl (further named also as “RORl”).
  • the invention relates to a bispecific bi- or trivalent antibody specifically binding to CD3 and RORl, wherein the variable domains VL and VH in a light chain and the respective heavy chain are replaced by each other, characterized in comprising a constant domain CL wherein the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the respective constant domain CHI the amino acid at position 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat).
  • the antibody is monovalent for CD3 binding.
  • amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H).
  • the antibody is monovalent for CD3 binding and amino acid 124 is K, amino acid 147 is E, amino acid 213 is E, and amino acid 123 is R or K.
  • amino acid 123 is R for a kappa light chain and K for a lambda light chain.
  • the invention relates to a bispecific antibody specifically binding to CD3 and ROR1, characterized in comprising a) the first light chain and the first heavy chain of a first antibody which specifically binds to ROR1 ; and b) the second light chain and the second heavy chain of a second antibody which specifically binds to CD3, and wherein the variable domains VL and VH in the second light chain and second heavy chain of the second antibody are replaced by each other; and c) wherein in the constant domain CL of the first light chain under a) the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and wherein in the constant domain CHI of the first heavy chain under a) the amino acid at position 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat) (see e.g.
  • said bispecific antibody described in the last preceding paragraph is further characterized in that said bispecific antibody comprises in addition a Fab fragment of said first antibody (further named also as "RORl-Fab") and in the constant domain CL said RORl-Fab the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and wherein in the constant domain CHI of said RORl -Fab the amino acid at positions 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat) (see e.g. Figures 1 C, IF).
  • the invention further relates to a bispecific antibody specifically binding to CD3 and ROR1, characterized in comprising a) the first light chain and the first heavy chain of a first antibody which specifically binds to ROR1 ; and b) the second light chain and the second heavy chain of a second antibody which specifically binds to CD3, and wherein the variable domains VL and VH in the second light chain and second heavy chain of the second antibody are replaced by each other; and wherein c) in the constant domain CL of the second light chain under b) the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and wherein in the constant domain CHI of the second heavy chain under b) the amino acid at positions 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat) (see e.g. Figures IB, ID, 1G, II, I
  • said bispecific antibody described in the last preceding paragraph is further characterized in that said bispecific antibody comprises in addition a second Fab fragment of said first antibody ("ROR1 - Fab") (see e.g. Figure ID, 1G).
  • ROR1 - Fab second Fab fragment of said first antibody
  • Amino acid numbering is according to Kabat (see below).
  • amino acid replacement at position 124 in the constant domain CL of the first or second light chain the amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H).
  • the amino acid at position 124 is substituted by lysine (K)
  • the amino acid at position 147 and the amino acid at position 213 are substituted by glutamic acid (E).
  • the constant domain CL in the amino acid at position 123 is substituted by arginine (R).
  • the amino acid at position 124 is substituted by lysine (K)
  • the amino acid at position 147 and the amino acid at position 213 are substituted by glutamic acid (E).
  • the constant domain CL in the amino acid at position 123 is substituted by lysine (K).
  • the antibody according to the invention consists of one Fab fragment of an antibody specifically binding to CD3 (further named also as “CD3-Fab”), and one Fab fragment of an antibody specifically binding to ROR1 (further named also as “RORl-Fab(s)”) and a Fc part, wherein the CD3-Fab and the RORl-Fab are linked via their C-termini to the hinge region of said Fc part.
  • CD3-Fab or the RORl-Fab comprises aa substitution and the CD3-Fab comprises crossover ( Figures 1A and IB).
  • the antibody according to the invention consists of one CD3- Fab, and one RORl -Fab and an Fc part, wherein the CD3-Fab and the RORl-Fab are linked via their C- termini to the hinge region of said Fc part and a second RORl-Fab, which is linked with its C-terminus to the N-terminus of the CD3-Fab.
  • the CD3-Fab comprises crossover and either the CD3-Fab or both RORl-Fabs comprise aa substitution ( Figures 1 C, ID, 1F,1G).
  • a bispecific antibody comprising R0R1 -Fab-Fc-CD3-Fab-R0R1-Fab, wherein both RORl -Fabs comprise aa substitution and the CD3-Fab comprises VL/VH crossover ( Figure 1C).
  • a bispecific antibody consisting of R0R1-Fab-Fc-CD3-Fab-R0R1-Fab, wherein both RORl-Fabs comprise aa substitution Q124K, E123R, K147E and K213E (kappa light chain) or E124K, E123K, K147E and K213E (lambda light chain) and the CD3-Fab comprises VL/VH crossover.
  • a bispecific antibody consisting of RORl -Fab-Fc-CD3-Fab-RORl -Fab, wherein both RORl-Fabs comprise aa substitution Q124K, E123R, K147E and K213E (kappa light chain) or E124K, E123K, K147E and K213E (lambda light chain) and the CD3-Fab comprises VL/VH crossover.
  • both RORl -Fabs comprise as CDRs the CDRs of antibody MAB 1 , or as VH/VL the VH/VL of MAB 1.
  • the antibody according to the invention consists of two RORl-Fabs and an Fc part, wherein the RORl-Fabs are linked via their C-termini to the hinge region of said Fc part and a CD3-Fab, which is linked with its C-terminus to the N-terminus of one RORl -Fab.
  • the CD3-Fab comprises crossover and either the CD3-Fab or both RORl-Fabs comprise aa substitution ( Figures IF and 1G).
  • the antibody according to the invention consists of one CD3- Fab, which is linked via its C-terminus to the hinge region of said Fc part and a RORl -Fab, which is linked with its C-terminus to the N-terminus of the CD3-Fab.
  • the CD3-Fab comprises crossover and either the CD3-Fab or the RORl -Fab comprise aa substitution ( Figures 1H and II).
  • the antibody according to the invention consists of one RORl -Fab, which is linked via its C-terminus to the hinge region of said Fc part and a CD3-Fab, which is linked with its C-terminus to the N-terminus of the RORl -Fab.
  • the CD3-Fab comprises crossover and either the CD3-Fab or the RORl -Fab comprise aa substitution ( Figures 1J and IK).
  • the bispecific antibody according to the invention is a) of construct RORl Fab - Fc - CD3 Fab - RORl Fab,
  • b) comprises VL/VH crossover within the Fab fragment of the anti-CD3 antibody
  • c) comprises a human IgGlFc part
  • d) comprises within the Fc part substitution of Pro329 with glycine and substitutions of Leu234 by alanine and Leu235 by alanine, and
  • the Fab fragments are chemically linked together by the use of an appropriate linker according to the state of the art.
  • Appropriate linkers are described e.g. in US 20140242079.
  • a (Gly4-Serl)2 linker (SEQ ID NO: 19) is used (Desplancq DK et al., Protein Eng. 1994 Aug; 7(8):1027-33 and Mack M. et al., PNAS July 18, 1995 vol. 92 no. 15 7021 -7025).
  • Linkage between two Fab fragments is performed between the heavy chains. Therefore the C-terminus of CHI of a first Fab fragment is linked to the N- terminus of VH of the second Fab fragment (no crossover) or to VL (crossover).
  • Linkage between a Fab fragment and the Fc part is performed according to the invention as linkage between CHI and CH2.
  • the first and a second Fab fragment of an antibody specifically binding to ROR1 are preferably derived from the same antibody and preferably identical in the CDR sequences, variable domain sequences VH and VL and/or the constant domain sequences CHI and CL.
  • the amino acid sequences of the first and a second Fab fragment of an antibody specifically binding to ROR1 are identical.
  • the ROR1 antibody is an antibody comprising the CDR sequences of antibody MAB1 , an antibody comprising the VH and VL sequences of antibody MAB1, or an antibody comprising the VH, VL, CHI, and CL sequences of antibody MAB 1.
  • the bispecific antibody comprises as Fab fragments and Fc part, not more than one Fab fragment of an anti-CD3 antibody, not more than two Fab fragments of an anti-RORl antibody and not more than one Fc part, preferably a human Fc part.
  • the second Fab fragment of an anti-RORl antibody is linked via its C-terminus either to the N-terminus of the Fab fragment of an anti-CD3 antibody or to the hinge region of the Fc part.
  • linkage is performed between CHI of ROR1- Fab and VL of CD3-Fab (VL/VH crossover).
  • the antibody portion specifically binding to human CD3, preferably the Fab fragment is characterized in comprising a variable domain VH comprising the heavy chain CDRs of SEQ ID NO: 12, 13 and 14 as respectively heavy chain CDR1, CDR2 and CDR3 and a variable domain VL comprising the light chain CDRs of SEQ ID NO: 15, 16 and 17 as respectively light chain CDR1, CDR2 and CDR3 of the anti-CD3s antibody (CDR MAB CD3 H2C).
  • the antibody portion specifically binding to human CD3 is characterized in that the variable domains are of SEQ ID NO: 10 and 11 (VHVL MAB CD3 H2C).
  • the antibody portion specifically binding to human CD3, preferably the Fab fragment is characterized in comprising a variable domain VH comprising the heavy chain CDRs of SEQ ID NO: 23, 24 and 25 as respectively heavy chain CDR1, CDR2 and CDR3 and a variable domain VL comprising the light chain CDRs of SEQ ID NO: 26, 27 and 28 as respectively light chain CDR1, CDR2 and CDR3 of the anti-CD3s antibody (CDR MAB CD3 CH2527).
  • the antibody portion specifically binding to human CD3 is characterized in that the variable domains are of SEQ ID NO:21 and 22 (VHVL MAB CD3).
  • the antibody portion, preferably the Fab fragment, specifically binding to human ROR1 is characterized in comprising a variable domain VH comprising the heavy chain CDRs CDR1H of SEQ ID NO:7, a CDR2H of SEQ ID NO:8, a CDR3H of SEQ ID NO: 9 and comprising a variable domain VL comprising the light chain CDRs CDR1L of SEQ ID NO:3, a CDR2L of SEQ ID NO:4, a CDR3L of SEQ ID NO: 5 (CDR MAB1).
  • VH comprising the heavy chain CDRs CDR1H of SEQ ID NO:7, a CDR2H of SEQ ID NO:8, a CDR3H of SEQ ID NO: 9
  • VL comprising the light chain CDRs CDR1L of SEQ ID NO:3, a CDR2L of SEQ ID NO:4, a CDR3L of SEQ ID NO: 5 (CDR MAB1).
  • the antibody portion, preferably the Fab fragment, specifically binding to human ROR1 is characterized in comprising a VH of SEQ ID NO: 6 and a VL of SEQ ID NO: 2 (VHVL MAB 1 ).
  • the invention relates to a bispecific antibody specifically binding to the extracellular domain of human RORl and to human CD3s, characterized in comprising a heavy and light chain set of polypeptides SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, and SEQ ID NO:40.
  • the invention relates to a bispecific antibody specifically binding to the extracellular domain of human RORl and to human CD3s, characterized in comprising a heavy and light chain set of polypeptides SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, and SEQ ID NO:41
  • the invention further relates to a nucleic acid set encoding a respective heavy and light chain set.
  • the bispecific antibody according to the invention comprising constant heavy regions CH2/CH3 of IgGl subclass is characterized in comprising the mutations L234A, L235A and P239G (numbering according to Kabat) to avoid FcR and Clq binding and minimizing ADCC/CDC.
  • L234A, L235A and P239G numbering according to Kabat
  • the invention comprises preferably a heavy chain of an antibody according to the invention consisting of (from N-to-C-terminus) VH(R0R1)-CH1(R0R1)-VL(CD3)-CH1(CD3)-CH2-CH3, preferably of SEQ ID NO: 37, as well as the respective encoding nucleic acids.
  • VH(R0R1)-CH1(R0R1)-VL(CD3)-CH1(CD3)-CH2-CH3 preferably of SEQ ID NO: 37
  • polypeptides and respective nucleic acids are useful for the production of a bispecific antibody according to the invention.
  • amino acid (aa) exchanges outside of the CDRs of the bispecific antibodies according to the invention provide considerably improved production/purification without changing biological properties like binding to RORl.
  • aa exchanges charge variants
  • light chain LC mispairing and the formation of side products in production is significantly reduced and therefore purification is facilitated.
  • the invention relates to a bispecific antibody specifically binding to the two targets human CD3s and the extracellular domain of human RORl which does not internalize.
  • the bispecific antibody according to the invention is preferably characterized in not internalizing in a concentration of InM in primary B-CLL cells at 37°C during two hours.
  • the bispecific antibody according to the invention is preferably characterized in that the bispecific antibody does not internalize in a cell based assay at 37°C during 2 hrs, using RORl -positive primary B-CLL cells and used at an antibody concentration of 1 nM, whereby not internalize means, that the mean fluorescence intensity (MFI), as detected by flow cytometry, of a bispecific antibody upon binding to RORl -positive primary B-CLL cells measured at time 0 is not reduced more than 50%, preferably not more than 30% when re -measured after a 2hr-incubation at 37°C.
  • MFI mean fluorescence intensity
  • the bispecific antibody according to the invention is a bivalent antibody and characterized in comprising a monovalent anti-RORl antibody specifically binding to RORl, and a monovalent antibody specifically binding to CD3.
  • a bivalent antibody is preferred if its said mean fluorescence intensity (MFI), as detected by flow cytometry, upon binding to ROR1 -positive cells measured at time 0 is not reduced more than 50%, preferably not more than 30% by internalization when re -measured after a 2hr- incubation at 37°C.
  • MFI mean fluorescence intensity
  • the bispecific antibody according to the invention is a bivalent antibody and characterized in comprising a monovalent anti-RORl antibody specifically binding to ROR1, and a monovalent antibody specifically binding to CD3.
  • the monovalent antibody specifically binding to CD3 is a Fab fragment, preferably a CD3 crossFab.
  • a bivalent antibody is preferred if its said mean fluorescence intensity (MFI), as detected by flow cytometry, upon binding to ROR1 -positive cells measured at time 0 is not reduced more than 50%, preferably not more than 30% by internalization when re-measured after a 2hr-incubation at 37°C.
  • the bispecific antibody according to the invention is a trivalent antibody and characterized in comprising a bivalent anti-RORl antibody specifically binding to ROR1, and a monovalent antibody specifically binding to CD3.
  • the monovalent antibody specifically binding to CD3 is a Fab fragment or preferably a CD3 crossFab.
  • a trivalent antibody is preferred if its said mean fluorescence intensity (MFI), as detected by flow cytometry, upon binding to ROR1 -positive cells measured at time 0 is not reduced more than 50%, preferably not more than 30% by internalization when re-measured after a 2hr-incubation at 37°C.
  • MFI mean fluorescence intensity
  • the bispecific antibody according to the invention does not internalize in said cell based assay at 37°C during 24 hrs.
  • the bispecific antibody according the invention does not internalize in said cell based assay if used in a concentration between 0.1 pM and 200 nM.
  • a further embodiment of the invention is an antibody according to this invention with an affinity ratio of ROR1 to CD3 of 5000:1 to 5 :1, as determined by Kd values using surface plasmon resonance. Such an antibody is favorable because of its stronger binding to malignant cells over T cells.
  • the Kd values are about 100 nM for the CD3 antibody and about 50 pM to 50 nM for the ROR1 antibody.
  • the B-CLL cells are used according to the invention in a cell concentration of 1 x 10 6 cells/mL (primary PBMC from CLL patients) or 1 x 10 6 cells/mL (ATCC CCL-155) or 1 x 10 6 cells/mL (ATCC CRL-3004).
  • the antibody portion specifically binding to CD3 is characterized in being humanized.
  • the CD3 Mab according to the invention binds to the same epitope of CD3s as antibody H2C (described in WO2008119567) and/or antibody CH2527 (described in WO2013026839) or is preferably antibody H2C or CH2527.
  • the antibody portion specifically binding to ROR1 is characterized in comprising a light chain variable domain (VL) comprising as respective variable light chain CDRs the CDRs of SEQ ID NO: 3, 4, 5 and a heavy chain variable domain (VH) comprising as respective variable heavy chain CDRs the CDRs of SEQ ID NO:7, 8, 9.
  • VL light chain variable domain
  • VH heavy chain variable domain
  • the antibody portion specifically binding to ROR1 is characterized in comprising as light chain variable domain (VL) a sequence being at least 90% identical to the sequence of SEQ ID NO:2 and as variable heavy chain domain (VH) a sequence being at least 90% identical to the sequence of SEQ ID NO:6,
  • the antibody portion specifically binding to RORl is characterized in comprising as light chain variable domain (VL) the sequence of SEQ ID NO:2 and as variable heavy chain domain (VH) the sequence of SEQ ID NO:6.
  • the antibody portion specifically binding to RORl is characterized in being humanized.
  • the RORl Mab according 5 to the invention binds to the same epitope of RORl as the Mab mentioned above.
  • a further embodiment of the invention is a method for the preparation of a bispecific antibody according to the invention comprising the steps of transforming a host cell with one or more vectors comprising nucleic acid molecules encoding the respective antibodies or fragments, culturing the host cell under conditions that allow synthesis of said antibody molecule; and recovering said antibody molecule from 10 said culture.
  • the method for the preparation of a bispecific antibody comprising the steps of a) transforming a host cell with one or more vectors comprising nucleic acid molecules encoding the heavy and light chain set of polypeptides SEQ ID NO:37, 38, 39, and 40, or the set of SEQ ID NO:37, 38,
  • a further embodiment of the invention is a host cell comprising vectors comprising nucleic acid molecules encoding an antibody according to the invention.
  • a further embodiment of the invention is a host cell comprising vectors comprising nucleic acid molecules encoding the light chain and heavy chain of an antibody specifically binding to the first target and vectors comprising nucleic acid molecules encoding the light chain and heavy chain of an antibody specifically binding to the second target, wherein the variable domains VL and VH are replaced by each other.
  • a further preferred embodiment of the invention is a pharmaceutical composition comprising an antibody according to the invention and a pharmaceutically acceptable excipient.
  • a further preferred embodiment of the invention is a pharmaceutical composition comprising an antibody according to the invention for use as a medicament.
  • a further preferred embodiment of the invention is an antibody according to the invention or a pharmaceutical composition comprising an antibody according to 30 the invention for use as a medicament in the treatment of RORl -positive hematological malignancies comprising chronic lymphocytic leukemia (CLL), hairy cell leukemia (HCL), acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), mantle cell lymphoma (MCL), marginal zone lymphoma (MZL), diffuse large B cell lymphoma (DLBCL), multiple myeloma (MM) and follicular lymphoma (FL).
  • CLL chronic lymphocytic leukemia
  • HCL hairy cell leukemia
  • ALL acute lymphoblastic leukemia
  • AML acute myeloid leukemia
  • CML chronic myeloid leukemia
  • a further embodiment of the invention is an antibody according to the invention or a pharmaceutical composition comprising an antibody according to the invention for use as a medicament in the treatment of leukemias and non-Hodgkin lymphomas expressing RORl.
  • a preferred embodiment of the invention is an antibody according to the invention or a pharmaceutical 5 composition comprising an antibody according to the invention for use as a medicament in the treatment of chronic lymphocytic leukemia (CLL) of B-cell lineage (B-CLL).
  • CLL chronic lymphocytic leukemia
  • B-CLL B-cell lineage
  • CLL symptoms usually develop over time with some patients being asymptomatic with only abnormal blood test results (e.g. increase in white blood cells). CLL patients with symptoms experience fatigue, short of breath, anemia, weight loss, decrease in appetite, lymph nodes and spleen enlargement and recurrent infections due to low immunoglobulin levels and decreased neutrophil counts (Leukemia & Lymphoma Society, 2009).
  • a further preferred embodiment of the invention is an antibody according to the invention or a pharmaceutical composition comprising an antibody according to the invention for use as a medicament in the treatment of Multiple Myeloma.
  • a further embodiment of the invention is an antibody according to the invention or a pharmaceutical composition comprising an antibody according to the invention for use as a medicament the treatment of plasma cell disorders like Multiple Myeloma MM or other B-cell
  • MM is a B-cell malignancy characterized by a monoclonal expansion and accumulation of abnormal plasma cells in the bone marrow compartment. MM also involves circulating clonal B cells with same IgG gene rearrangement and somatic hypermutation. MM arises from an asymptomatic, premalignant condition called monoclonal gammopathy of unknown significance (MGUS), characterized by low levels of bone marrow plasma cells and a monoclonal protein. MM cells
  • MGUS monoclonal gammopathy of unknown significance
  • MM results from a progressive occurrence of multiple structural chromosomal changes (e.g. unbalanced translocations).
  • MM involves the mutual interaction of malignant plasma cells and bone marrow microenvironment (e.g. normal bone marrow stromal cells).
  • Clinical signs of active MM include monoclonal antibody spike, plasma cells overcrowding the bone marrow, lytic bone lesions and bone destruction resulting from overstimulation of osteoclasts (Dimopulos & Terpos, Ann Oncol
  • a further embodiment of the invention is an antibody according to the invention or a pharmaceutical composition comprising an antibody according to the invention for use as a medicament in the treatment of RORl -positive solid tumors such as human breast cancers (Zhang S, PLoS One 2012; 7(3): e31127) and lung cancers (Yamaguchi T, Cancer Cell 2012; 21(3): 348).
  • RORl -positive solid tumors such as human breast cancers (Zhang S, PLoS One 2012; 7(3): e31127) and lung cancers (Yamaguchi T, Cancer Cell 2012; 21(3): 348).
  • a further embodiment of the invention is the use of an antibody according to the invention or the 35 pharmaceutical composition according to the invention for such treatments.
  • a further embodiment of the invention is the use of an antibody according to the invention or the pharmaceutical composition according to the invention for the treatment of a disease selected from the group consisting of ovarian cancer, lung cancer, breast cancer, gastric cancer, and /or pancreatic cancer.
  • a further embodiment of the invention is an antibody according to the invention or the pharmaceutical composition according to the invention for use in the treatment of ovarian cancer, lung cancer, breast cancer, gastric cancer, and /or pancreatic cancer.
  • a further embodiment of the invention is the use of an antibody according to the invention or the pharmaceutical composition according to the invention for the treatment of ovarian cancer.
  • a further embodiment of the invention is an antibody according to the invention or the pharmaceutical composition according to the invention for use in the treatment of ovarian cancer.
  • a further embodiment of the invention is a method of treatment comprising administering to a cancer patient a therapeutically effect dose of the antibody according to the invention.
  • a further embodiment of the invention is such method wherein the cancer is a selected from the group consisting of ovarian cancer, lung cancer, breast cancer, gastric cancer, and /or pancreatic cancer and hematologic malignancy.
  • a further embodiment of the invention is such a method wherein chemotherapy or radiation is administered before, after, or concurrently with the antibody.
  • a further embodiment of the invention is a method of treatment comprising administering to a patient having such disease an antibody according to the invention.
  • a further embodiment of the invention is a method of treatment comprising administering to a patient having ovarian cancer an antibody according to the invention.
  • a further embodiment of the invention is the use of an antibody according to the invention as a medicament for treating a cancer, preferably ovarian cancer.
  • a further embodiment of the invention is the use of an antibody according to the invention in the manufacture of a medicament for treating a cancer, preferably ovarian cancer..
  • the antibody according to the invention or the pharmaceutical composition is administered once or twice a week preferably via subcutaneous administration (e.g. preferably in the dose range of 0.1 to 10 mg/m 2 once or twice a week).
  • the antibody according to the invention Due to superior cytotoxicity activities of the antibody according to the invention, it can be administered at a lower magnitude of clinical dose range as compared to conventional monospecific antibodies or conventional bispecific antibodies that are not T cell bispecifics (i.e. do not bind to CD3 on one arm). It is envisaged that for an antibody according to the invention subcutaneous administration is preferred in the clinical settings (e.g. in the dose range of 0.1 - 10 mg/m 2 once or twice a week). An antibody according to the invention is eliminated with a half-life of about several days which allows at least once or twice/week administration. Another advantage of the antibody according to the invention is a molecular weight (i.e. approximately 150 - 200 kDa) higher than the kidney filtration size limit (50 -70 kDa). This molecular weight allows long elimination half-life and makes subcutaneous administrations once or twice a week possible.
  • a molecular weight i.e. approximately 150 - 200 kDa
  • the kidney filtration size limit 50 -
  • an antibody according to the invention is characterized by showing tumor growth inhibition of more than 70%, preferably of more than 85%, preferably of close to 100%> in a xenograft model with a ROR1 expressing tumor cell line (for example CLL, MM, MCL cell lines) at a dose of 1 mg/kg body weight (BW) administered intravenously (i.v.) or subcutaneously (s.c.) or intraperitoneal (i.p.) twice a week or once a week, preferably 0.5 mg/kg BW administered i.v. or i.p. or s.c. twice a week or once a week, preferably at 0.1 mg/kg BW administered i.v. or i.p.
  • BW body weight
  • s.c. subcutaneously
  • i.p. intraperitoneal
  • s.c. twice a week or once a week preferably at 0.05 mg/kg BW administered i.v. or i.p. or s.c. twice a week or once a week, preferably at 0.01 mg/kg BW administered i.v. or i.p. or s.c twice a week or once a week, preferably at 5 ⁇ g/kg BW administered i.v. or i.p. or s.c. twice a week or once a week.
  • an antibody according to the invention is characterized by an elimination half-life in mice, preferably cynomolgus monkeys of longer than 12 hours, preferably 3 days or longer.
  • Bispecific antibodies binding to a target on tumor cells and to CD3 and having the molecular format (scFv) 2 have very short elimination half-life of 1 to 4 hours.
  • this compound had to be administered via a pump carried by the patients over weeks and months (Topp et al. J Clin Oncol 2011 ; 29(18): 2493-8).
  • treatment administered via a pump is much less convenient for the patients and also much more risky (e.g. failure of pump, issues with the catheter).
  • an antibody according to the invention is characterized in showing an EC50 value for binding to RORl -positive cell lines (e.g. RPMI8226 cells, Rec-1 cells, Jeko cells) of 30 nM or lower, preferably an EC50 value of 15 nM and lower.
  • RORl -positive cell lines e.g. RPMI8226 cells, Rec-1 cells, Jeko cells
  • an antibody according to the invention is characterized by its capability to induce redirected killing of RORl expressing tumor cells (e.g. RPMI8226 cells, Rec-1 cells, Jeko cells) in the presence of human T cells with an EC50 lower than 10 nM, preferably 1 nM, preferably 0.05 nM, preferably 0.02 nM, preferably 0.002 nM and lower.
  • RORl expressing tumor cells e.g. RPMI8226 cells, Rec-1 cells, Jeko cells
  • an antibody according to this invention is characterized in that said antibody stored in standard formulation buffer at 37°C preferably at 40°C, for 10 days, preferably up to 2 weeks, preferably up to 4 weeks, does not result in more than 10% changes ( ⁇ ), preferably not more than 5% changes ( ⁇ ), in high molecular weight (HMW) species and/or low molecular weight (LMW) species and/or monomer content as compared to the said antibody stored in the same formulation buffer at -80°C for the same period of storage.
  • HMW high molecular weight
  • LMW low molecular weight
  • FIG. 1A-K Preferred bispecific antibodies comprising the Fab fragments (specific to CD3 and RORl) as specified: (1A, IB) Fab RORl-Fc- Fab CD3; (1C, ID) Fab RORl-Fc-Fab CD3-Fab RORl ; (IF, 1G) Fab RORl-Fc-Fab RORl -Fab CD3; (1H, II) Fc-Fab CD3-Fab RORl; (1J, IK) Fc-Fab RORl -Fab CD3.
  • the Fabs CD3 include a VH-VL crossover to reduce LC mispairing and side-products.
  • Fab CD3 and Fab ROR1 are linked to each other with flexible linkers.
  • FIG. 1 Binding of anti-RORl IgGl antibody on RORl-positive RPMI8226 cells (A) and non-binding to ROR1 -negative MK 45 cells (B). Mean fluorescence intensity for anti-RORl IgG plotted in function of anti-RORl antibody concentrations (from 0.14 to 100 nM).
  • FIG. 3-1 Production and purification of 83A10-TCB without charge variant vs. 83A10-TCBcv with charge variant.
  • CE-SDS non-reduced graphs of the final protein preparations after different methods of purification for 83A10-TCB and 83A10-TCBcv antibodies.
  • clEX cation exchange chromatography
  • re-SEC final size exclusion chromatographic
  • Figure 3-2 Head-to-head comparison study: Production of 83A10-TCB without charge vs. 83A10- TCBcv with charge variant.
  • Properties e.g. purity, yield, monomer content
  • PA affinity chromatography only A, B
  • PA affinity chromatography then SEC C, D
  • PA affinity chromatography then SEC SEC then clEX and re-SEC (E, F).
  • CE-SDS non-reduced graphs of the final protein solutions after the respective methods of purification for 83A10-TCB and 83A10-TCBcv antibodies.
  • PA affinity chromatography purification step applied to 83A10-TCB antibody.
  • B PA affinity chromatography purification step applied to 83A10-TCBcv antibody.
  • C PA affinity chromatography + SEC purification steps applied to 83A10-TCB antibody.
  • D PA affinity chromatography + SEC purification steps applied to 83A10-TCBcv antibody.
  • E PA affinity chromatography +/- SEC + clEX + SEC purification steps applied to 83A10-TCB antibody.
  • FIG. 3-3 Binding of ROR1 IgG (ROR1 Mab2, open symbols) and anti-RORl/anti-CD3 TCB antibodies (ROR1 Mab2-TCBcv, closed symbols) to ovarian cancer cell lines SK-OV-3 (A) and PA-1 (B) as measured by an increase in the median fluorescence intensity signal in function of antibody concentrations. No signal was observed with the control-TCB binding to CD3 only and not to ROR1 tested on both SK-OV-3 and PA-1 ovarian cancer cell lines (A and B; closed circles).
  • Figure 3-4 Binding of anti-RORl/anti-CD3 TCB antibodies to Jurkat T cells. A concentration-dependent binding of ROR1 Mab2-TCBcv (squares) and control-TCB (circles) was observed on Jurkat T cells confirming that both TCB antibodies bind to CD3 on T cells.
  • Figure 7 Binding of anti-RORl/anti-CD3 TCB antibodies on Jurkat T cells. Mean fluorescence intensity for anti-RORl/anti-CD3 T cell bispecific antibodies plotted in function of antibody concentrations (from 25 3 to 500 nM); anti-RORl/anti-CD3 TCBl+1 and anti-RORl/anti-CD3 TCB2+1 antibodies on Jurkat cells. EC50 values and maximal binding of anti-RORl/anti-CD3 TCBl+1 and anti-RORl/anti-CD3 TCB2+1 antibodies to Jurkat cells were not reached. DP47 isotype control antibody or anti-RORl IgG antibody did not bind to Jurkat T cells.
  • Figure 8 Binding of anti-RORl/anti-CD3 TCB antibodies on ROR1 -positive RPMI8226 cells. Mean 30 fluorescence intensity plotted in function of antibody concentrations (from 0.136 to 13.6 nM).
  • FIG. 9 Up-regulation of T-cell activation markers by anti-RORl/anti-CD3 TCB antibodies in presence of ROR1 -positive
  • Rec-1 cells and B RPMI8226 cells. Mean fluorescence intensity plotted in function of antibody concentrations (from 0.01 pM to 100 nM).
  • a concentration dependent increase in the mean fluorescence intensity of the late activation marker CD25 gated on CD8 T cells was observed in Rec-1 cells.
  • FIG. 9-1 Up-regulation of T-cell activation markers by anti-RORl/anti-CD3 TCB antibodies in presence of ovarian cancer target cells.
  • the expression of activation markers was determined by measuring the median fluorescence intensity gated on CD4+ and CD8+ T cell populations.
  • ROR1 Mab2- TCBcv squares
  • At a clinically relevant concentration of 1 nM of ROR1 Mab2-TCBcv there was already up to 40% of activated CD4 T cells and 25 %> of activated CD8 T cells after 48h of incubation.
  • FIG. 10 Redirected T cell killing of ROR1 -positive RPMI8226 MM target cells by CD8 T cells activated by anti-RORl/anti-CD3 TCB antibodies.
  • Specific cytotoxicity of target cells (tumor lysis) induced by anti-RORl/anti-CD3 TCB antibodies was measured by LDH release.
  • FIG. 11 Redirected T cell killing of ROR1 -positive RPMI8226 MM target cells by T cells from PBMCs activated by anti-RORl/anti-CD3 TCB antibodies at different effector cells to tumor cells (E:T) ratios. Specific cytotoxicity of target cells (tumor lysis) induced by anti-RORl/anti-CD3 TCB antibodies was measured by LDH release.
  • E:T ratio 10 PBMCs : 1 RPMI8226 MM cell (24h time point): there was a concentration dependent response with increasing concentrations for up to 100 nM.
  • a maximum mean of 25% of tumor lysis was observed with 100 nM concentration anti-RORl/anti-CD3 TCBl+1 and anti-RORl/anti-CD3 TCB2+1 antibodies in experimental conditions with E:T ratio of 10:1 i.e. 10 PBMCs for 1 RPMI8226 target cell.
  • the 25% tumor lysis observed at 100 nM as detected by LDH release could not have been attributed only to unspecific killing of target cells as there was only 9%> unspecific target cell lysis with 100 nM of non-binder TCB2+1 (i.e. binds to effector cells but not to target cells).
  • FIG. 12 Redirected T cell killing of RORl-positive ovarian cancer target cells with different level of surface RORl : high expressing PA-1 (A),medium expressing COLO-704 (B) and OVCAR-5 (C), and low expressing SK-OV-3 (D). Effector cells to tumor cells (E:T) ratios of 10 PBMCs : 1 target cell. Specific cytotoxicity of target cells (tumor lysis) induced by anti-RORl/anti-CD3 TCB antibodies was measured by LDH release (48h culture). There was a concentration dependent response with increasing concentrations from 0.5 pM to 50 nM.
  • RORl Mab2-TCBcv (squares) induced a concentration-dependent increase in tumor cell lysis of RORl high-expressing PA-1 ovarian cancer cells (A), RORl medium- expressing COLO-704 (B) and OVCAR-5 (C) ovarian cancer cells and RORl low-expressing SK-OV-3 ovarian cancer cells (D).
  • bispecific antibodies against CD3s and RORl with VH/VL exchange can be produced in high yield and easily purified if in the light chain CL of either the antibody portion against CD3s or RORl the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the respective constant domain CHI the amino acid at position 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat).
  • the VH/VL exchange is in the CD3 binding portion.
  • the bispecific antibody is monovalent for CD3 binding.
  • the amino acid substitutions described above can be either in the RORl binding portion or in the CD3 binding portion. Therefore in a certain embodiment of the invention the CD3 binding portion can comprise the VH/VL exchange and the amino acid substitutions. In this case the RORl binding portion does not comprise any VH/VL exchange or amino acid substitutions at amino acids 124, 147, 213, or 123.
  • the bispecific antibody is monovalent for CD3 binding and bivalent for ROR1 binding. As described, the bispecific antibody can therefore comprise a second ROR1 binding portion, which is identical to the first one.
  • the first ROR1 binding portion comprises the amino acid substitutions
  • the second ROR1 binding portion comprises the same substitutions and if the first ROR1 binding portion does not comprise the amino acid substitutions, the second ROR1 binding portion does also not comprise the substitutions.
  • amino acid 124 is K
  • amino acid 147 is E
  • amino acid 213 is E
  • amino acid 123 is R.
  • the CD3 binding portion and the RORlbinding portion are Fab fragments, whereby when two ROR1 binding portions are present one ROR1 portion is chemically linked to the CD3 binding portion via CH1/VL (C- terminus of ROR1 binding portion (CHI) to N-terminus of crossover CD3 binding portion(VL)) or CH1/VH (C-terminus of crossover CD3 binding portion (CHI) to N-terminus of ROR1 binding portion(VH)).
  • the bispecific antibody can comprise or not comprise an Fc part.
  • the extracellular domain of ROR1 consists according to UniProt of amino acids 30 - 406.
  • antibody against ROR1 , anti ROR1 antibody or ROR1 Mab as used herein relates to an antibody specifically binding to human ROR1.
  • the antibody binds specifically to the extracellular domain of ROR1 (amino acids M1-V406 of SEQ ID NO: l).
  • the antibody binds specifically to fragments of the extracellular domain, which are the Ig-like C2-type domain (amino acids Q73-V139 of SEQ ID NO: l), the frizzled domain (amino acids E165-I299 of SEQ ID NO: 1), or the kringle domain (amino acids K312-C391 of SEQ ID NO: l). These fragments are mentioned in WO2005100605. It is further preferred that the antibody binds specifically to the extracellular domain fragment WNISSELNKDSYLTL (SEQ ID NO.18) of ROR1.
  • anti-RORl antibodies are Mab2 (WO201209731, Mab 4A5) and Mabl, Mab3 and Mab4 (WO2012075158 , Mabs R12, Y31 and Rl l).
  • ROR1 IgG or TCB antibodies referred to Mabl .
  • CD3s or CD3 as used herein relates to human CD3s described under UniProt P07766 (CD3E HUMAN).
  • antibody against CD3, anti CD3 antibody relates to an antibody binding to CD3s.
  • the antibody comprises a variable domain VH comprising the heavy chain CDRs of SEQ ID NO: 12, 13 and 14 as respectively heavy chain CDRl, CDR2 and CDR3 and a variable domain VL comprising the light chain CDRs of SEQ ID NO: 15, 16 and 17 as respectively light chain CDRl, CDR2 and CDR3.
  • the antibody comprises the variable domains of SEQ ID NO: 10 (VH) and SEQ ID NO: 11 (VL).
  • the antibody comprises a variable domain VH comprising the heavy chain CDRs of SEQ ID NO: 23, 24 and 25 as respectively heavy chain CDRl, CDR2 and CDR3 and a variable domain VL comprising the light chain CDRs of SEQ ID NO: 26, 27 and 28 as respectively light chain CDRl, CDR2 and CDR3.
  • the antibody comprises the variable domains of SEQ ID NO:21 (VH) and SEQ ID NO:22 (VL).
  • the anti-CD3 antibodies shown in SEQ ID NO: 10 and 11 and 21 and 22 are derived from SP34 and have similar sequences and the same properties in regard to epitope binding as antibody SP34.
  • Specifically binding to CD3 or RORl refer to an antibody that is capable of binding CD3 or RORl (the targets) with sufficient affinity such that the antibody is useful as a therapeutic agent in targeting CD3 or RORl .
  • the extent of binding of an anti-CD3 or RORl antibody to an unrelated, non-CD3 or non-RORl protein is about 10-fold preferably >100-fold less than the binding of the antibody to CD3 or RORl as measured, e.g., by surface plasmon resonance (SPR) e.g. Biacore®, enzyme-linked immunosorbent (ELISA) or flow cytometry (FACS).
  • SPR surface plasmon resonance
  • ELISA enzyme-linked immunosorbent
  • FACS flow cytometry
  • the antibody that binds to CD3 or RORl has a dissociation constant (Kd) of 10 ⁇ 8 M or less, preferably from 10 ⁇ 8 M to 10 ⁇ 13 M, preferably from 10 "9 M to 10 ⁇ 13 M.
  • Kd dissociation constant
  • the bispecific antibody according to the invention binds to an epitope of RORl that is conserved among RORl from different species and/or an epitope of CD3 that is conserved among CD3 from different species, preferably among human and cynomolgus.
  • Bispecific antibody specifically binding to CD3 and RORl or “antibody according to the invention” refers to a respective definition for binding to both targets.
  • OD values for such unrelated targets will be equal or lower to that of the limit of detection of the specific assay, preferably equal or lower as 1.5 pM, or equal or lower to OD values of control samples without plate-bound-RORl or with untransfected HEK293 cells.
  • Antibodies according to the invention are analyzed by ELISA for binding to human RORl using plate- bound RORl .
  • an amount of plate-bound RORl preferably or 1.5 nM and concentration(s) preferably ranging from 1 pM to 200 nM of anti-RORl antibody are used.
  • An antibody according to the invention for which its RORl binding is at least 20% higher than the OD values of the control samples without plate-bound RORl or with untransfected HEK293 cells according to the invention is an antibody "binding to human RORl in an ELISA assay".
  • An exemplary antibody according to the invention is characterized by the heavy and light chain set of polypeptides SEQ ID NO:37, 38, 39, and 40.
  • Another exemplary antibody according to the invention is characterized by the heavy and light chain set of polypeptides SEQ ID NO:37, 38, 39, and 41.
  • antibody according to the invention which does not internalize means a bispecific antibody according to the invention with MFI reduction properties characterized in that in a cell based assay at 37°C during 2 hrs., using RORl -positive B-CLL cells, and used at an antibody concentration of 1 nM, whereby not internalize means, that the mean fluorescence intensity (MFI), as detected by flow cytometry, upon binding to RORl -positive cells measured at time 0 is not reduced more than 50%, preferably not more than 30% by internalization when re-measured after a 2hr-incubation at 37°C.
  • MFI mean fluorescence intensity
  • the bispecific antibody according to the invention does not internalize in RORl -positive B-CLL cells, therefore the binding of the said anti-RORl antibody to RORl -positive B-CLL cells is not reduced more than 50%, preferably not more than 30%, when the said antibody is incubated at 37°C for 2 h in such cell based assay as described herein.
  • a bispecific antibody according to the invention shows in a cell based assay at 37°C during 2 hrs, using RORl -positive B-CLL cells, and at an antibody concentration of 1 nM, a decrease in the mean fluorescence intensity by internalization from time 0 to 2 hrs at 37°C (AMFI), as measured by flow cytometry is between 120% to 0%, preferably from 100% to 0%, of the AMFI of an anti-RORl bivalent antibody of human IgGl kappa ( ⁇ ) type comprising as light chain variable domain (VL) the sequence of SEQ ID NO:2 and as variable heavy chain domain (VH) the sequence of SEQ ID NO:6, in the same concentration and experimental conditions.
  • AMFI mean fluorescence intensity by internalization from time 0 to 2 hrs at 37°C
  • the antibody does not internalize as defined above for facilitating a stable immune synapse between the tumor cell and the T cell and effective T cell-mediated redirected cytotoxicity.
  • AMFI mean fluorescence intensity reflecting the internalization of the said anti-RORl antibody to ROR1 -positive cells
  • MFI experimental is the MFI measured with said ROR1 antibody after 2h incubation at 37°C.
  • An MFI reduction which is at least 75% blocked and reversed by 10 ⁇ endocytosis inhibitor phenylarsine oxide is for example caused by antibody internalization while an MFI reduction which is not blocked by phenylarsine oxide is caused by antibody dissociation.
  • Internalizing anti-RORl antibodies are known in the state of the art (Baskar et al., Clin. Cancer Res., 14(2): 396-404 (2008)).
  • the bispecific antibody according to the invention is characterized in that an increase in MFI value at time 2hrs in the presence of 3 ⁇ phenylarsine oxide (PAO) as compared to MFI value at time 2hrs in the absence of PAO is not more than 30% , preferably not more than 20%, preferably not more that 10%, even not more than detection level of the MFI value at time 0.
  • PAO 3 ⁇ phenylarsine oxide
  • target means either ROR1 or CD3.
  • first target and second target means either CD3 as first target and ROR1 as second target or means ROR1 as first target and CD3 as second target.
  • antibody refers to a monoclonal antibody. An antibody consists of two pairs of a "light chain” (LC) and a “heavy chain” (HC) (such light chain (LC) /heavy chain pairs are abbreviated herein as LC/HC). The light chains and heavy chains of such antibodies are polypeptides consisting of several domains. Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
  • HCVR heavy chain variable region
  • the heavy chain constant region comprises the heavy chain constant domains CHI, CH2 and CH3 (antibody classes IgA, IgD, and IgG) and optionally the heavy chain constant domain CH4 (antibody classes IgE and IgM).
  • Each light chain comprises a light chain variable domain VL and a light chain constant domain CL.
  • the variable domains VH and VL can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • FR framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the "constant domains" of the heavy chain and of the light chain are not involved directly in binding of an antibody to a target, but exhibit various effector functions.
  • the "light chain of an antibody” as used herein is a polypeptide comprising in N-terminal to C-terminal direction a light chain variable domain (VL), and a light chain constant domain (CL), abbreviated as VL- CL.
  • VL- CL light chain variable domain
  • a “crossover light chain (VH-CL)” as used herein is a light chain wherein the VL domain is replaced by the respective VH domain.
  • the “heavy chain of an antibody” as used herein is a polypeptide comprising in N-terminal to C-terminal direction a heavy chain variable domain (VH) and a constant heavy chain domain 1 (CHI).
  • a “crossover heavy chain (VL-CH1)” as used herein is a heavy chain wherein the VH domain is replaced by the respective VL domain.
  • first CH3 domain and the second CH3 domains are both engineered in a complementary manner so that each CH3 domain (or the heavy chain comprising it) cannot longer homodimerize with itself but is forced to heterodimerize with the complementary engineered other CH3 domain ( so that the first and second CH3 domain heterodimerize and no homodimers between the two first or the two second CH3 domains are formed).
  • aa substitution or charge variant is applied to the constant domain CL at positions 123 and 124 and/or to the constant domain CHI at positions 147 and 213 in the antibodies according to the invention which reduce light chain mispairing.
  • the CH3 domains of said multispecific antibody according to the invention can be altered by the "knob-into-holes" technology which is described in detail with several examples in e.g. WO 96/027011, Ridgway, J.B., et al., Protein Eng. 9 (1996) 617-621 ; and Merchant, A.M. et al., Nat. Biotechnol. 16 (1998) 677-681 ; W098/ 050431.
  • the interaction surfaces of the two CH3 domains are altered to increase the heterodimerisation of both heavy chains containing these two CH3 domains.
  • Each of the two CH3 domains (of the two heavy chains) can be the "knob", while the other is the "hole”.
  • said antibody according to the invention (comprises a CH3 domain in each heavy chain and) is further characterized in that the first CH3 domain of the first heavy chain of the antibody under a) and the second CH3 domain of the second heavy chain of the antibody under b) each meet at an interface which comprises an original interface between the antibody CH3 domains, wherein said interface is altered to promote the formation of the antibody according to the invention, wherein the alteration is characterized in that: i) the CH3 domain of one heavy chain is altered, so that within the original interface of the CH3 domain of one heavy chain that meets the original interface of the CH3 domain of the other heavy chain within the antibody according to the invention, an amino acid residue is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the interface of the CH3 domain of one heavy chain which is positionable in a cavity within the interface of the CH3 domain of the other heavy chain and ii) the CH3 domain of the other heavy chain is altered, so that within the original interface of the second
  • amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), tryptophan (W).
  • both CH3 domains are further altered by the introduction of cysteine (C) as amino acid in the corresponding positions of each CH3 domain such that a disulfide bridge between both CH3 domains can be formed.
  • C cysteine
  • CH3 -modifications to enforcing the heterodimerization are contemplated as alternatives of the invention and described e.g. in WO96/27011, WO98/050431, EP1870459, WO2007/110205, WO2007/147901, WO2009/089004, WO2010/129304, WO2011/90754, WO2011/143545, WO2012/058768, WO2013/157954, WO2013/157953, WO2013/096291.
  • the antibody according to the invention is of IgG2 isotype and the heterodimerization approach described in WO2010/129304 can be used alternatively.
  • the term “antibody” includes e.g. mouse antibodies, human antibodies, chimeric antibodies, humanized antibodies and genetically engineered antibodies (variant or mutant antibodies) as long as their characteristic properties are retained. Especially preferred are human or humanized antibodies, especially as recombinant human or humanized antibodies.
  • the terms "monoclonal antibody” or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of a single amino acid composition.
  • bispecific antibody comprises as CD3 and ROR1 binders only those binders mentioned. Therefore a bispecific antibody according the invention comprising a monovalent anti-RORl antibody specifically binding to ROR1, and a monovalent antibody specifically binding to CD3 has in regard to CD3 and ROR1 binding only one binding valence for CD3 and only one valence for RORland is therefore bivalent.
  • a bispecific antibody according the invention comprising a bivalent anti-RORl antibody specifically binding to ROR1, and a monovalent antibody specifically binding to CD3 has in regard to ROR1 binding two binding valences and in regard to CD3 binding one valence and is therefore trivalent.
  • the monovalent antibody specifically binding to CD3 is covalently linked at its C-terminus to the N-terminus of one variable chain of the antibody specifically binding to ROR1.
  • a "Fab fragment of an antibody” as used herein is a fragment on an antibody that binds to antigens.
  • a Fab fragment of an antibody consists of two pairs of domains. In a wild-type antibody it is composed of one constant and one variable domain of each of the heavy chain (CHI and VH) and the light chain (CL and VL). According to the invention such domain pairs can be, due to a crossover, also VH-CL and VL- CHI . In a wild-type antibody and according to the invention the domain of the heavy and light chain domain pairs of a Fab fragment are not chemically linked together and are therefore not scFvs (single chain variable fragments).
  • Cross means that preferably in one Fab the domains VL and VH are replaced by each other.
  • Fab fragment also includes parts or all of the hinge region, like Fab' fragment.
  • F(ab) 2 fragment refers to a bivalent monospecific antibody fragment preferably with a Fc part.
  • amino acid substitution or charge variant means amino acid substitution according to the invention in that in a constant domain CL the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and wherein in the respective constant domain CHI the amino acid at position 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D), and preferably in addition in the constant domain CL in the amino acid at position 123 is substituted independently by lysine (K), arginine (R) or histidine (H) and preferably by arginine (R).
  • a preferred combination of aa substitution is Q124K, E123R, K147E and K213E (for example: E123R means that glutamic acid (E) at position 123 is replaced by arginine (R).
  • E123R means that glutamic acid (E) at position 123 is replaced by arginine (R).
  • a F(ab) 2 fragment is linked at the C-terminus by disulphide bond(s) in the hinge region and usually such a "F(ab) 2 fragment" is a F(ab') 2 fragment.
  • a preferred combination of aa substitution is E124K, E123K, K147E and K213E (for example: E123K means that glutamic acid (E) at position 123 is replaced by lysine (K).
  • a F(ab) 2 fragment is linked at the C-terminus by disulphide bond(s) in the hinge region and usually such a "F(ab) 2 fragment" is a F(ab') 2 fragment.
  • Introduction of substitutions of charged amino acids with opposite charges in the constant domains CH1/CL of the antibodies according to the invention reduces light chain mispairing,
  • ROR1 Fab denotes a Fab fragment of the antibody specifically binding to ROR1. Due to the exchange of either the variable regions or the constant regions in the anti- RORl antibody Fab fragment (ROR1 Fab), such ROR1 Fab is referred to as “ ROR1 cross Fab” or “crossover ROR1 Fab fragment” According to the invention the ROR1 Fab is not a RORlcrossFab.
  • ROR1 cross Fab or "crossover ROR1 Fab fragment”
  • CD3 Fab as used within the invention denotes a Fab fragment of the antibody specifically binding to CD3.
  • CD3 Fab is linked at its N-terminus the C-terminus of the ROR1 Fab. Due to the exchange of either the variable regions or the constant regions in the CD3 Fab, such CD3 Fab is referred to as "CD3 crossFab” or "crossover CD3 Fab fragment". According to the invention the CD3 Fab is preferably a crossFab.
  • peptide linker denotes a peptide with amino acid sequences, which is preferably of synthetic origin. These peptide linkers according to invention are used to connect one of the Fab fragments to the C-or N-terminus of the other Fab fragment to form a multispecific antibody according to the invention.
  • peptide linkers are peptides with an amino acid sequence with a length of at least 5 amino acids, preferably with a length of 5 to 100, more preferably of 10 10 to 50 amino acids.
  • linkers may comprise (a portion of) an immunoglobulin hinge region.
  • said peptide linker is (G 4 S) 2 (SEQ ID: NO 19).
  • Heavy chains ⁇ , a and ⁇ have a constant region composed of three constant domains CHI, CH2, and CH3 (in a line) , and a hinge region for added flexibility (Woof J, Burton D Nat Rev Immunol 4 (2004) 89-99); heavy chains ⁇ and ⁇ have a constant region composed of
  • variable region of the heavy chain differs in antibodies produced by different B cells, but is the same for all antibodies produced by a single B cell or B cell clone.
  • the variable region of each heavy chain is approximately 110 amino acids long and is composed of a single antibody domain. In mammals there are only two types of light chain, which are called lambda ( ⁇ ) and kappa ( ⁇ ).
  • lambda
  • kappa
  • the approximate length of a light chain is 211 to 217 amino acids.
  • a bispecific antibody according to the invention which comprises a Fc part, can be of any class (e.g. IgA, IgD, IgE, IgG, and IgM, preferably IgG or IgE), or subclass (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2, preferably IgGl), whereby both antibodies, from which the bivalent bispecific antibody according 35 to the invention is derived, have an Fc part of the same subclass( e.g. IgGl, IgG4 and the like, preferably IgGl), preferably of the same allotype (e.g. Caucasian).
  • IgA, IgD, IgE, IgG, and IgM preferably IgG or IgE
  • subclass e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2, preferably IgGl
  • Fc part of an antibody is a term well known to the skilled artisan and defined on the basis of papain cleavage of antibodies.
  • the antibodies according to the invention, which comprise an Fc part contain as Fc part, preferably a Fc part derived from human origin and preferably all other parts of the human constant regions.
  • the Fc part of an antibody is directly involved in complement activation, Clq binding, C3 activation and Fc receptor binding. While the influence of an antibody on the complement system is dependent on certain conditions, binding to Clq is caused by defined binding sites in the Fc part. Such binding sites are known in the state of the art and described e.g. by Lukas, TJ., et al., J. Immunol.
  • binding sites are e.g. L234, L235, D270, N297, E318, K320, K322, P331 and P329 (numbering according to EU index of Kabat, see below).
  • Antibodies of subclass IgGl, IgG2 and IgG3 usually show complement activation, Clq binding and C3 activation, whereas IgG4 do not activate the complement system, do not bind Clq and do not activate C3.
  • the Fc part is a human Fc part.
  • the Fc part is a human IgGlFc part.
  • the antibody according to the invention comprises in the human IgGl Fc part amino acid substitution of Pro329 with glycine or arginine and/or substitutions L234A and L235A, preferably Pro329 with glycine and substitutions L234A and L235A.
  • the bispecific antibody according to the invention comprising constant heavy regions CH2/CH3 of IgGl subclass is characterized in comprising the mutations L234A, L235A and P239G (numbering according to Kabat) to avoid FcR and Clq binding and minimizing ADCC/CDC.
  • L234A, L235A and P239G numbering according to Kabat
  • the antibody according to the invention comprises as Fc part an Fc variant of a wild-type human IgG Fc region, said Fc variant comprising an amino acid substitution at position Pro329 and at least one further amino acid substitution, wherein the residues are numbered according to the EU index of Kabat, and wherein said antibody exhibits a reduced affinity to the human FcyRIIIA and/or FcyRiIA and /or FcyRI compared to an antibody comprising the wildtype IgG Fc region, and wherein the ADCC induced by said antibody is reduced to at least 20% of the ADCC induced by the antibody comprising a wild-type human IgG Fc region.
  • Pro329 of a wild-type human Fc region in the antibody according to the invention is substituted with glycine or arginine or an amino acid residue large enough to destroy the proline sandwich within the Fc/Fcy receptor interface, that is formed between the proline329 of the Fc and tryptophane residues Trp 87 and Tip 110 of FcyRIII (Sondermann et al.: Nature 406, 267-273 (20 July 2000)).
  • the at least one further amino acid substitution in the Fc variant is S228P, E233P, L234A, L235A, L235E, N297A, N297D, or P331 S and still in another embodiment said at least one further amino acid substitution is L234A (denotes that leucine 234 is substituted by alanine) and L235A of the human IgGl Fc region or S228P and L235E of the human IgG4 Fc region.
  • L234A denotes that leucine 234 is substituted by alanine
  • the constant heavy chain of an antibody according to the invention is preferably of human IgGltype and the constant light chain is preferably of human lambda ( ⁇ ) or kappa ( ⁇ ) type, preferably of human kappa (K) type.
  • monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of a single amino acid composition.
  • chimeric antibody refers to an antibody comprising a variable region, i.e., binding region, from one source or species and at least a portion of a constant region derived from a different source or species, usually prepared by recombinant DNA techniques. Chimeric antibodies comprising a murine variable region and a human constant region are preferred. Other preferred forms of “chimeric antibodies” encompassed by the present invention are those in which the constant region has been modified or changed from that of the original antibody to generate the properties according to the invention, especially in regard to Clq binding and/or Fc receptor (FcR) binding. Such chimeric antibodies are also referred to as "class-switched antibodies”.
  • Chimeric antibodies are the product of expressed immunoglobulin genes comprising DNA segments encoding immunoglobulin variable regions and DNA segments encoding immunoglobulin constant regions. Methods for producing chimeric antibodies involve conventional recombinant DNA and gene transfection techniques are well known in the art. See, e.g., Morrison, S.L., et al., Proc. Natl. Acad. Sci. USA 81 (1984) 6851-6855; US Patent Nos. 5,202,238 and 5,204,244.
  • humanized antibody refers to antibodies in which the framework or "complementarity determining regions” (CDR) have been modified to comprise the CDR of an immunoglobulin of different specificity as compared to that of the parent immunoglobulin.
  • CDR complementarity determining regions
  • a murine CDR is grafted into the framework region of a human antibody to prepare the "humanized antibody.” See, e.g., Riechmann, L., et al., Nature 332 (1988) 323-327; and Neuberger, M.S., et al., Nature 314 (1985) 268- 270.
  • Particularly preferred CDRs correspond to those representing sequences recognizing the targets noted above for chimeric antibodies.
  • Other forms of "humanized antibodies” encompassed by the present invention are those in which the constant region has been additionally modified or changed from that of the original antibody to generate the properties according to the invention, especially in regard to Clq binding and/or Fc receptor (FcR) binding.
  • human antibody is intended to include antibodies having variable and constant regions derived from human germ line immunoglobulin sequences.
  • Human antibodies are well-known in the state of the art (van Dijk, M.A., and van de Winkel, J.G., Curr. Opin. Chem. Biol. 5 (2001) 368-374).
  • Human antibodies can also be produced in transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire or a selection of human antibodies in the absence of endogenous immunoglobulin production.
  • Human antibodies can also be produced in phage display libraries (Hoogenboom, H.R., and Winter, G., J. Mol. Biol.
  • human antibody as used herein also comprises such antibodies which are modified in the constant region to generate the properties according to the invention, especially in regard to Clq binding and/or FcR binding, e.g. by "class switching” i.e. change or mutation of Fc parts (e.g. from IgGl to IgG4 and/or IgGl/IgG4 mutation).
  • recombinant human antibody is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from a host cell such as a NSO or CHO cell or from an animal (e.g. a mouse) that is transgenic for human immunoglobulin genes or antibodies expressed using a recombinant expression vector transfected into a host cell.
  • recombinant human antibodies have variable and constant regions in a rearranged form.
  • the recombinant human antibodies according to the invention have been subjected to in vivo somatic hypermutation.
  • the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germ line VH and VL sequences, may not naturally exist within the human antibody germ line repertoire in vivo.
  • variable domain denotes each of the pair of light and heavy chains which is involved directly in binding the antibody to the target.
  • the domains of variable human light and heavy chains have the same general structure and each domain comprises four framework (FR) regions whose sequences are widely conserved, connected by three "hypervariable regions” (or complementarity determining regions, CDRs).
  • the framework regions adopt a ⁇ -sheet conformation and the CDRs may form loops connecting the ⁇ - sheet structure.
  • the CDRs in each chain are held in their three-dimensional structure by the framework regions and form together with the CDRs from the other chain the target binding site.
  • the antibody heavy and light chain CDR3 regions play a particularly important role in the binding specificity/affinity of the antibodies according to the invention and therefore provide a further object of the invention.
  • hypervariable region or "target-binding portion of an antibody” when used herein refer to the amino acid residues of an antibody which are responsible for target-binding.
  • the hypervariable region comprises amino acid residues from the "complementarity determining regions” or "CDRs".
  • “Framework” or "FR” regions are those variable domain regions other than the hypervariable region residues as herein defined. Therefore, the light and heavy chains of an antibody comprise from N- to C- terminus the domains FR1 , CDR1, FR2, CDR2, FR3, CDR3, and FR4. CDRs on each chain are separated by such framework amino acids. Especially, CDR3 of the heavy chain is the region which contributes most to target binding.
  • CDR and FR regions are determined according to the standard definition of Kabat et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991).
  • target or “target molecule” as used herein are used interchangeable and refer to human ROR1 and human CD3s.
  • epitope determinant includes any polypeptide determinant capable of specific binding to an antibody.
  • epitope determinant include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and or specific charge characteristics.
  • An epitope is a region of a target that is bound by an antibody. In general there are two vectors encoding the light chain and heavy chain of said antibody specifically binding to the first target, and further two vectors encoding the light chain and heavy chain of said antibody specifically binding to the second target.
  • One of the two vectors is encoding the respective light chain and the other of the two vectors is encoding the respective heavy chain.
  • only one first vector encoding the light chain and heavy chain of the antibody specifically binding to the first target and only one second vector encoding the light chain and heavy chain of the antibody specifically binding to the second target can be used for transforming the host cell.
  • nucleic acid or nucleic acid molecule is intended to include DNA molecules and RNA molecules.
  • a nucleic acid molecule may be single-stranded or double-stranded, but preferably is double-stranded DNA.
  • the expressions "cell,” “cell line,” and “cell culture” are used interchangeably and all such designations include progeny.
  • the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Variant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
  • transfection refers to process of transfer of a vectors/nucleic acid into a host cell. If cells without daunting cell wall barriers are used as host cells, transfection is carried out e.g. by the calcium phosphate precipitation method as described by Graham and Van der Eh, Virology 52 (1978) 546ff. However, other methods for introducing DNA into cells such as by nuclear injection or by protoplast fusion may also be used. If prokaryotic cells or cells which contain substantial cell wall constructions are used, e.g. one method of transfection is calcium treatment using calcium chloride as described by Cohen SN, et al, PNAS 1972, 69 (8): 2110-2114.
  • expression refers to the process by which a nucleic acid is transcribed into mRNA and/or to the process by which the transcribed mRNA (also referred to as transcript) is subsequently being translated into peptides, polypeptides, or proteins.
  • the transcripts and the encoded polypeptides are collectively referred to as gene product. If the polynucleotide is derived from genomic DNA, expression in a eukaryotic cell may include splicing of the mRNA.
  • a "vector” is a nucleic acid molecule, in particular self-replicating, which transfers an inserted nucleic acid molecule into and/or between host cells.
  • the term includes vectors that function primarily for insertion of DNA or RNA into a cell (e.g., chromosomal integration), replication of vectors that function primarily for the replication of DNA or RNA, and expression vectors that function for transcription and/or translation of the DNA or RNA. Also included are vectors that provide more than one of the functions as described.
  • An “expression vector” is a polynucleotide which, when introduced into an appropriate host cell, can be transcribed and translated into a polypeptide.
  • An “expression system” usually refers to a suitable host cell comprised of an expression vector that can function to yield a desired expression product.
  • the bispecific antibodies according to the invention are preferably produced by recombinant means. Such methods are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the antibody polypeptide and usually purification to a pharmaceutically acceptable purity.
  • nucleic acids encoding light and heavy chains or fragments thereof are inserted into expression vectors by standard methods.
  • the bispecific antibodies may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form. Purification is performed in order to eliminate other cellular components or other contaminants, e.g. other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, column chromatography and others well known in the art. See Ausubel, F., et al., ed., Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).
  • NSO cells Expression in NSO cells is described by, e.g., Barnes, L.M., et al., Cytotechnology 32 (2000) 109-123; and Barnes, L.M., et al., Biotech. Bioeng. 73 (2001) 261-270.
  • Transient expression is described by, e.g., Durocher, Y., et al., Nucl. Acids. Res. 30 (2002) E9.
  • Cloning of variable domains is described by Orlandi, R., et al., Proc. Natl. Acad. Sci. USA 86 (1989) 3833-3837; Carter, P., et al., Proc. Natl. Acad. Sci.
  • control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
  • Eukaryotic cells are known to utilize promoters, enhancers and polyadenylation signals.
  • Nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or
  • a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • "operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
  • the bispecific antibodies are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • DNA or RNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures.
  • the hybridoma cells can serve as a source of such DNA and RNA.
  • the DNA may be inserted into expression vectors, which are then transfected into host cells such as HEK293 cells, CHO cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of recombinant monoclonal antibodies in the host cells.
  • T cell bispecific (TCB) binders have very high concentration/tumor-cell-receptor-occupancy dependent potency in cell killing (e.g. EC 50 in in vitro cell killing assays in the sub- or low picomolar range; Dreier et al.
  • T-cell bispecific binder are given at much lower doses than conventional monospecific antibodies.
  • blinatumomab CD19xCD3
  • a continuous intravenous dose of 5 to 15 ⁇ g/m 2 /day (i.e. only 0.035 to 0.105 mg/m 2 /week) for treatment of acute lymphocytic leukemia or 60 ⁇ g/m 2 /day for treatment of Non Hodgkin Lymphoma
  • serum concentrations at these doses are in the range of 0.5 to 4 ng/ml (Klinger et al., Blood 2012; Topp et al., J Clin Oncol 2011; Goebeler et al. Ann Oncol 2011).
  • blinatumomab clinical administration is via continuous infusion via pump carried at the patients body. Due to longer elimination half life of the antibodies of this invention it is envisaged that for an antibodyaccording to the invention subcutaneous administration is possible and preferred in the clinical settings (preferably in the dose range of 0.1 to 10 mg/m 2 once or twice a week, preferably even lower doses). Even at these low concentrations/doses/receptor occupancies, TCB can cause considerable adverse events (Klinger et al., Blood 2012). Improved pharmacokinetics properties of the antibodies of the invention are one measure to potentially reduce adverse events.
  • bispecific antibodies against CD3 and ROR1 in all formats known in the state of the art.
  • a wide variety of recombinant bispecific antibody formats have been developed in the recent past, e.g. by fusion of, e.g. an IgG antibody format and single chain domains (see e.g. Kontermann RE, mAbs 4:2, (2012) 1-16).
  • Bispecific antibodies wherein the variable domains VL and VH or the constant domains CL and CHI are replaced by each other are described in WO2009080251 and WO2009080252.
  • Antibody formats and formats of bispecific and multispecific antibodies are also pepbodies (WO200244215), Novel Antigen Receptor ("NAR") (WO2003014161), diabody-diabody dimers “TandAbs” (WO2003048209), polyalkylene oxide-modified scFv (US7150872), humanized rabbit antibodies (WO2005016950), synthetic immunoglobulin domains (WO2006072620), covalent diabodies (WO2006113665), flexibodies (WO2003025018), domain antibodies, dAb (WO2004058822), vaccibody (WO2004076489), antibodies with new world primate framework (WO2007019620), antibody-drug conjugate with cleavable linkers (WO2009117531), IgG4 antibodies with hinge region removed (WO2010063785), bispecific antibodies with IgG4 like CH3 domains (WO2008119353), camelid Antibodies (US6838254), nanobodies (US7655759), CAT diabo
  • An antibody according to the invention can be administered once or twice a week s.c. administration.
  • a bispecific trivalent antibody according to the invention has advantages on the potency, predictability for efficacy and safety.
  • An antibody according to the invention with bivalency to ROR1 and monovalency to CD3 favors binding to the tumor target ROR1 on malignant cells over CD3s on T cells in circulation and avoids CD3 sink, thus increasing drug exposure in the tumor.
  • CDRL1 (CH2527) GSSTGAVTTSNYAN
  • CDRL3 (CH2527) ALWYSNLWV
  • APIEKTISKAKGQPREPQVYTLPPCRDELTK QVSL WCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
  • variable domains VL and VH in a light chain and the respective heavy chain are replaced by each other, characterized in comprising a constant domain CL wherein the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and in the respective constant domain CHI the amino acid at position 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat).
  • the bispecific antibody specifically binding to the two targets which are human CD3s and the extracellular domain of human RORl characterized in comprising a) the first light chain and the first heavy chain of a first antibody which specifically binds to RORl; and b) the second light chain and the second heavy chain of a second antibody which specifically binds to CD3, and wherein the variable domains VL and VH in the second light chain and second heavy chain of the second antibody are replaced by each other; and wherein c) in the constant domain CL of the first light chain under a) the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and wherein in the constant domain CHI of the first heavy chain under a) the amino acid at position 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat).
  • the bispecific antibody specifically binding to the two targets which are human CD3s and the extracellular domain of human RORl characterized in comprising a) the first light chain and the first heavy chain of a first antibody which specifically binds to ROR1 ; and b) the second light chain and the second heavy chain of a second antibody which specifically binds to CD3, and wherein the variable domains VL and VH in the second light chain and second heavy chain of the second antibody are replaced by each other; and wherein c) in the constant domain CL of the second light chain under b) the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and wherein in the constant domain CHI of the second heavy chain under b) the amino acid at positions 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat).
  • bispecific antibody characterized in that said bispecific antibody comprises in addition a Fab fragment of said first antibody (further named also as "RORl-Fab") and in the constant domain CL said RORl -Fab the amino acid at position 124 is substituted independently by lysine (K), arginine (R) or histidine (H) (numbering according to Kabat), and wherein in the constant domain CHI of said RORl -Fab the amino acid at positions 147 and the amino acid at position 213 is substituted independently by glutamic acid (E), or aspartic acid (D) (numbering according to Kabat).
  • bispecific antibody according to embodiment 3, characterized in that said bispecific antibody comprises in addition a second Fab fragment of said first antibody ("RORl -Fab").
  • bispecific antibody according to embodiment 1, characterized in consisting of two RORl-Fabs and a Fc part, wherein the RORl-Fabs are linked via their C-termini to the hinge region of said Fc part and a CD3-Fab, which is linked with its C-terminus to the N-terminus of one RORl-Fab and the CD3-Fab comprises crossover and either the CD3-Fab or both RORl-Fabs comprise aa substitution ( Figures IF and 1G).
  • bispecific antibody according to any one of embodiments 1 to 6, characterized in consisting of one RORl-Fab, which is linked via its C-terminus to the hinge region of said Fc part and a CD3-Fab, which is linked with its C-terminus to the N-terminus of the RORl -Fab and either the CD3-Fab or the ROR1 -Fab comprise aa substitution ( Figures 1 J and 1 K).
  • bispecific antibody according to any one of embodiments 1 to 11 , characterized in comprising the CDR sequences of anti-RORl antibody MAB1.
  • SEQ ID NO: 15, 16 and 17 as respectively light chain CDRl, CDR2 and CDR3 of the anti CD3s antibody (CDR MAB CD3 H2C), or b) a variable domain VH comprising the heavy chain CDRs of SEQ ID NO: 23, 24 and 25 as respectively heavy chain CDRl, CDR2 and CDR3 and a variable domain VL comprising the light chain CDRs of SEQ ID NO: 26, 27 and 28 as respectively light chain CDRl, CDR2 and CDR3 of the anti CD3s antibody (CDR MAB CD3 CH2527) .
  • amino acid 124 is K
  • amino acid 147 is E
  • amino acid 213 is E
  • amino acid 123 is R or amino acid 124 is K
  • amino acid 147 is E
  • amino acid 213 is K
  • amino acid 123 is K
  • amino acid 123 is R for a kappa light chain and K for a lambda light chain.
  • a bispecific antibody specifically binding to the extracellular domain of human ROR1 and to human CD3s characterized in comprising a heavy and light chain set selected from the group consisting of polypeptides SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, and SEQ ID NO:40 or from the group consisting of polypeptides SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, and SEQ ID NO:41.
  • variable domain VH is replaced by a variable domain VH comprising the heavy chain CDRs of SEQ ID NO: 12, 13 and 14 as respectively heavy chain CDRl, CDR2 and CDR3 and the variable domain
  • VL is replaced by a variable domain VL comprising the light chain CDRs of SEQ ID NO: 15, 16 and 17 as respectively light chain CDRl, CDR2 and CDR3 of the anti CD3s antibody
  • the variable domain VH is replaced by a variable domain VH comprising the heavy chain CDRs of SEQ ID NO: 23, 24 and 25 as respectively heavy chain CDRl, CDR2 and CDR3
  • the variable domain VL is replaced by a variable domain VL comprising the light chain CDRs of SEQ ID NO: 26, 27 and 28 as respectively light chain CDRl, CDR2 and CDR3 of the anti CD3s antibody.
  • the antibody according to embodiments 1 to 27 characterized by an elimination half- life in mice, preferably cynomolgus monkeys of longer than 12 hours, preferably 3 days or longer.
  • ROR1 expressing tumor cells e.g. RPMI8226 cells, Rec-1 cells, Jeko cells, ovarian cancer cell lines like PA-1, COLO-704, OVCAR-5, SK-OV-3
  • human T cells with an EC50 lower than 10 nM, preferably 1 nM, preferably 0.05 nM, preferably 0.02 nM, preferably 0.002 nM and lower.
  • a method for the preparation of an a bispecific antibody according to any one of embodiments 1 to 31 comprising the steps of a) transforming a host cell with vectors comprising nucleic acid molecules encoding the light chain and heavy chain of an antibody according to any one of embodiments 1 to 31 ,
  • a host cell comprising vectors comprising nucleic acid molecules encoding the light chain and heavy chains of an antibody according to any one of embodiments 1 to 31.
  • a pharmaceutical composition comprising an antibody according to any one of embodiments 1 to 30 25 and a pharmaceutically acceptable excipient.
  • CLL chronic lymphocytic leukemia
  • HCL hairy cell leukemia
  • ALL acute lymphoblastic leukemia
  • AML acute myeloid leukemia
  • CML chronic myeloid leukemia
  • MCL mantle cell lymphoma
  • MZL marginal zone lymphoma
  • DLBCL diffuse large B cell lymphoma
  • MM multiple myeloma
  • FL follicular lymphoma
  • CLL chronic lymphocytic leukemia
  • B-CLL B-cell lineage
  • Desired gene segments were prepared from oligonucleotides made by chemical synthesis.
  • the plasmid DNA was purified from transformed bacteria using commercially available plasmid purification kits. Plasmid concentration was determined by UV spectroscopy. The DNA sequence of the subcloned gene fragments was confirmed by DNA sequencing. Gene segments were designed with suitable restriction sites to allow sub -cloning into the respective expression vectors. If required, protein coding genes were designed with a 5 '-end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells.
  • DNA sequence determination DNA sequences are determined by double strand sequencing.
  • the Clone Manager (Scientific & Educational Software) software package version 9.2 was used for sequence mapping, analysis, annotation and illustration.
  • Expression vectors a) The fusion genes comprising the described antibody chains as described below were generated by PCR and/or gene synthesis and assembled with known recombinant methods and techniques by connection of the according nucleic acid segments e.g. using unique restriction sites in the respective vectors. The subcloned nucleic acid sequences were verified by DNA sequencing. For transient transfections larger quantities of the plasmids are prepared by plasmid preparation from transformed E. coli cultures (Nucleobond AX, Macherey-Nagel).
  • variable regions of heavy and light chain DNA sequences were subcloned in frame with either the human IgGl constant heavy chain or the hum IgGl constant light chain pre-inserted into the respective generic recipient expression vector optimized for expression in mammalian cell lines.
  • the antibody expression is driven by a chimeric MPSV promoter comprising a CMV enhancer and a MPSV promoter followed by a 5 ' UTR, an intron and a Ig kappa MAR element.
  • the transcription is terminated by a synthetic polyA signal sequence at the 3 ' end of the CDS.
  • the IgGl derived bispecific molecules consist at least of two antigen binding moieties capable of binding specifically to two distinct antigenic determinants CD3 and ROR1.
  • the antigen binding moieties are Fab fragments composed of a heavy and a light chain, each comprising a variable and a constant region. At least one of the Fab fragments was a "Crossfab" fragment, wherein VH and VL were exchanged.
  • the exchange of VH and VL within the Fab fragment assures that Fab fragments of different specificity do not have identical domain arrangements.
  • the bispecific molecule design was monovalent for CD3 and bivalent for ROR1 where one Fab fragment was fused to the N-terminus of the inner CrossFab (2+1).
  • the bispecific molecule contained an Fc part in order for the molecule to have a long half-life.
  • a schematic representation of the constructs is given in Figure 1 ; the preferred sequences of the constructs are shown in SEQ ID NOs 39 to 52.
  • the molecules were produced by polymer-based co-transfecting HEK293 EBNA cells growing in suspension with the mammalian expression vectors.
  • HEK293-EBNA system Bispecific antibodies were expressed by transient co-transfection of the respective mammalian expression vectors in HEK293-EBNA cells, which were cultivated in suspension, usinga polymer.
  • HEK293-EBNA cells were seeded at 1.5 Mio viable cells/mL in Ex-Cell medium, supplemented with 6 mM of L-Glutamine.
  • HEK293-EBNA cells were seeded at 1.5 Mio viable cells/mL in Ex-Cell medium, supplemented with 6 mM of L-Glutamine.
  • 2.0 Mio viable cells were centrifuged (5 minutes at 210 x g). The supernatant was aspirated and the cells resuspended in 100 of CD CHO medium.
  • the recombinant anti-BCMA human antibody and bispecific antibodies were produced in suspension by polymer-based co-transfecting HEK293-EBNA cells with the mammalian expression vectors.
  • the cells were transfected with two or four vectors, depending in the format.
  • For the human IgGl one plasmid encoded the heavy chain and the other plasmid the light chain.
  • the bispecific antibodies four plasmids were co-transfected. Two of them encoded the two different heavy chains and the other two encoded the two different light chains.
  • the HEK293-EBNA cells were seeded at 1.5 Mio viable cells/mL in F17 Medium, supplemented with 6 mM of L-Glutamine.
  • Determination of the antibody concentration was done by measurement of the absorbance at 280 nm, using the theoretical value of the absorbance of a 0.1% solution of the antibody. This value was based on the amino acid sequence and calculated by GPMAW software (Lighthouse data).
  • the NuPAGE® Pre-Cast gel system (Invitrogen) is used according to the manufacturer's instruction. In particular, 10% or 4-12% NuPAGE® Novex® Bis-TRIS Pre-Cast gels (pH 6.4) and a NuPAGE® MES (reduced gels, with NuPAGE® Antioxidant running buffer additive) or MOPS (non-reduced gels) running buffer is used.
  • NuPAGE® MES reduced gels, with NuPAGE® Antioxidant running buffer additive
  • MOPS non-reduced gels
  • the supernatant was loaded on a protein A column (HiTrap Protein A FF , 5 mL, GE Healthcare) equilibrated with 6 CV 20 mM sodium phosphate, 20 mM sodium citrate, pH 7.5. After a washing step with the same buffer the antibody was eluted from the column by step elution with 20 mM sodium phosphate, 100 mM sodium chloride, 100 mM Glycine, pH 3.0. The fractions with the desired antibody were immediately neutralized by 0.5 M Sodium Phosphate, pH 8.0 (1 :10), pooled and concentrated by centrifugation. The concentrate was sterile filtered and processed further by cation exchange chromatography and/or size exclusion chromatography. By cation exchange chromatography
  • the concentrated protein was diluted 1 : 10 with the elution buffer used for the affinity step and loaded onto a cation exchange colume (Poros 50 HS, Applied Biosystems). After two washing steps with the equilibration buffer and a washing buffer resp. 20 mM sodium phosphate, 20 mM sodium citrate, 20 mM TRIS, pH 5.0 and 20 mM sodium phosphate, 20 mM sodium citrate, 20 mM TRIS, 100 mM sodium chloride pH 5.0 the protein was eluted with a gradient using 20 mM sodium phosphate, 20 mM sodium citrate, 20 mM TRIS, 100 mM sodium chloride pH 8.5. The fractions containing the desired antibody were pooled, concentrated by centrifugation, sterile filtered and processed further a size exclusion step. By analytical size exclusion chromatography
  • the concentrated protein was injected in a XK16/60 HiLoad Superdex 200 column (GE Healthcare), and 20 niM Histidine, 140 niM Sodium Chloride, pH 6.0 with or without Tween20 as formulation buffer.
  • the fractions containing the monomers were pooled, concentrated by centrifugation and sterile filtered into a sterile vial.
  • the LC-MS method was performed on an Agilent HPLC 1200 coupled to a TOF 6441 mass spectrometer (Agilent).
  • the chromatographic separation was performed on a Macherey Nagel Polysterene column; RP1000-8 (8 ⁇ particle size, 4.6 x 250 mm; cat. No. 719510).
  • Eluent A was 5 % acetonitrile and 0.05 % (v/v) formic acid in water
  • eluent B was 95 % acetonitrile, 5 % water and 0.05 % formic acid.
  • the flow rate was 1 ml/min
  • the separation was performed at 40°C and 6 ⁇ g (15 ⁇ ) of a protein sample obtained with a treatment as described before (table 7).
  • Table 7 Table 7
  • the ESI-source was running with a drying gas flow of 12 1/min, a temperature of 350 °C and a nebulizer pressure of 60psi.
  • the MS spectra were acquired using a fragmentor voltage of 5 380 V and a mass range 700 to 3200 m/z in positive ion mode using. MS data were acquired by the instrument software from 4 to 17 minutes.
  • PBMCs Peripheral blood mononuclear cells
  • enriched lymphocyte preparations obtained from local blood banks or from fresh blood from0 healthy human donors. Briefly, blood was diluted with sterile PBS and carefully layered over a Histopaqiie gradient (Sigma, H8889). After centrifugation for 30 minutes at 450 x g at room temperature (brake switched off), part of the plasma above the PBMC containing interphase was discarded. The PBMCs were transferred into new 50 ml Falcon tubes and tubes were filled up with PBS to a total volume of 50 ml.
  • the mixture was centrifuged at room temperature for 10 minutes at 400 x g (brake switched5 on). The supernatant was discarded and the PBMC pellet washed twice with sterile PBS (centrifugation steps at 4°C for 10 minutes at 350 x g). The resulting PBM.C population was counted automatically (ViCell) and stored in RPMI1640 medium, containing 10% PCS and 1% 1. -alan vl- L-glutamine (Biochrom, K0302) at 37°C, 5% C0 2 in the incubator until assay start.
  • T cell enrichment fr m PBMCs was performed using the Pan T Cell Isolation Kit II (Miltenyi Biotec0 #130-091-156), according to the manufacturer's instructions. Briefly, the cell pellets were diluted in 40 ⁇ cold buffer per 10 million cells (PBS with 0.5% BSA, 2 niM EDTA, sterile filtered) and incubated with 10 ⁇ Biotin- Antibody Cocktail per 10 million cells for 10 niin at 4°C. 30 ⁇ " ⁇ * cold buffer and 20 ⁇ Anti- Biotin magnetic beads per 10 million cells were added, and the mixture incubated for another 15 niin at 4°C.
  • PBMCs Peripheral blood mononuclar cells
  • enriched lymphocyte preparations obtained from local blood banks or from fresh blood from healthy human donors.
  • T-ceil enrichment from PBMCs was performed using the Naive CD8 T cell isolation Kit from Miltenyi Biotec (#130-093-244), according to the manufacturer's instructions, but skipping the last isolation step of CDS ' T cells (also see description for the isolation of primary human pan T cells).
  • VH and VL regions for an ROR1 antibody of SEQ ID NOs: 2-9 are described in WO2012/075158. Briefly, oliogonucleotides encoding the above sequences are joined together via PCR to synthesize cDNAs encoding the VH are VL sequences, respectively, of the anti- RORl antibody.
  • variable regions of heavy and light chain DNA sequences were subcloned in frame with either the human IgGl constant heavy chain or the hum IgGl constant light chain pre-inserted into the respective generic recipient expression vector optimized for expression in mammalian cell lines.
  • the antibody expression was driven by a chimeric MPSV promoter comprising a CMV enhancer and a MPSV promoter followed by a 5' UTR, an intron and a Ig kappa MAR element.
  • the transcription was terminated by a synthetic polyA signal sequence at the 3' end of the CDS. All vectors carry a 5 '-end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells.
  • each vector contained an EBV OriP sequence for episomal plasmid replication in EBV EBNA expressing cells.
  • ROR1 antibodies were expressed by transient polymer-based co-transfection of the respective mammalian expression vectors in HEK293-EBNA cells, which were cultivated in suspension.
  • HEK293-EBNA cells were seeded at 1.5 Mio viable cells/mL in Ex-Cell medium, supplemented with 6 niM of L-Glutamine.
  • niM of L-Glutamine 6 niM of L-Glutamine.
  • the recombinant anti-RORl human antibodies were produced in suspension by polymer-based co-transfecting HEK293- EBNA cells with the mammalian expression vectors. The cells were transfected with two vectors. For the human IgGl one plasmid encoded the heavy chain and the other plasmid the light chain. One day prior to transfection the HEK293-EBNA cells were seeded at 1.5 Mio viable cells/mL in F17 Medium, supplemented with 6 mM of L-Glutamine.
  • Example 2 Human B-CLL cell line or primary B-CLL cells, multiple myeloma cell line or Mantle cell lymphoma cell line expressing ROR1 on their surface a) Fresh human primary B-CLL cells (CD19 CD5 ) were isolated from blood of CLL patients. Blood is collected from CLL patients after informed consent is given, in accordance with local ethical committee guidelines and the Declaration of Helsinki. Cryopreserved human primary B-CLL cells (CD19 + CD5 ) was acquired from Allcells (Alameda, CA, USA).
  • the primary B-CLL cells from patients were lawfully obtained and comply with ethical requirements: (i) obtaining samples from patients diagnosed with CLL is approved by an Institute Reviewing Board (IRB) or Human Subject Committee; (ii) a signed and witnessed informed consent form is obtained from the patient before taking part in the Allcells Diseased Cells Program; (iii) all of the patients diagnosed with the above mentioned diseases are reasonably compensated for their commitment to the program and the compensation is approved by the IRB or Human Subject Committee; (iv) all of the patients are aware that the donated samples may be used for any research applications and waived any rights generated from the research applications.
  • Primary B-CLL cells were grown in RPMI supplemented with 10%> fetal bovine serum.
  • ROR1 expression on primary CD19 + CD5 + B-CLL cells was confirmed by flow cytometry using fluorochrome-conjugated anti-human ROR1 antibodies (see Example 3).
  • b) Human B lymphocyte multiple myeloma cell line RPMI8226 was acquired from ATCC (ATCC CCL- 155). RPMI8226 myeloma cells were cultured in DMEM, 10% FCS, 1 % Glutamine. ROR1 expression on RPMI8226 cell lines was confirmed by flow cytometry using fluorochrome-conjugated anti-human ROR1 antibodies (see Example 3).
  • Rec-lcell line was acquired from ATCC (ATCC CRL-3004). Rec-1 cells were cultured in DMEM, 10% FCS, 1 % Glutamine. ROR1 expression on Rec-1 cell lines was confirmed by flow cytometry using fluorochrome-conjugated anti- human ROR1 antibodies (see Example 3).
  • Example 2.1 - Human ovarian cancer cell lines with different levels of expression of ROR1 on the cell surface a) Human ovarian cancer cell line PA-1 derived from ovarian teratocarcinoma was acquired from American Type Culture Collection (ATCC; Cat. No. CRL-1572). PA-1 cell lines were cultured in Eagle's Minimum Essential Medium (MEM) (ATCC, Cat. No. 30-2003) supplemented with 10% fetal
  • COLO-704 cell lines were cultured in 90% RPMI 1640 and 10% heat inactivated fetal bovine serum. ROR1 expression was confirmed to be medium on COLO-704 cell lines as measured by flow cytometry (see Example 3.1).
  • ROR1 expression was confirmed to be medium on OVCAR-5 cell lines as measured by flow cytometry (see Example 3.1).
  • Example 3 Binding to ROR1 expressed on primary B-CLL cells, RPMI8226 myeloma cells or Rec-1 MCL cells (Flow cytometry) a) RORl expression was assessed on primary CD19 + CD5 + CLL cells by flow cytometry. Briefly, cells were harvested, washed, counted for viability, resuspended at 50 000 cells/well of a 96-well round bottom plate and incubated with Alexa488-labeled anti human RORl antibody at 10 ⁇ for 30 min at 4°C (to prevent internalization).
  • FIG. 2A shows an increase of median fluorescence intensity upon binding of the anti-RORl antibody to primary B-CLL cells, indicating that RORl is expressed on primary CLL cells.
  • b) RORl expression was then assessed on B lymphocyte myeloma RPMI8226 cell lines by flow cytometry, using the methods described above.
  • Figure 3 shows increase of median fluorescence intensity upon binding of increasing concentrations of the anti-RORl antibody to RPMI8226 cells (A), but not to RORl -negative MK 45 cells (human gastric adenocarcinoma cell line, DSMZ ACC 409) (B).
  • Table 1 shows the binding EC50 of anti-RORl antibody to RORl -positive RPMI8226 cell lines.
  • Table 1 EC50 values for binding of anti-RORl antibody to RPMI8226 cells
  • Example 3.1 Binding of RORl IgG antibodies to RORl-positive human ovarian cancer cell lines (as detected by flow cytometry) a) The level of expression of RORl was measured on human ovarian cancer cell lines by flow cytometry including PA-1 , COLO-704, ES-2, SK-OV-3, and OVCAR-5. Briefly, cells were harvested, washed, counted for viability, resuspended at 50,000 cells/well of a 96-well round bottom plate and incubated with Alexa488-labeled anti human RORl antibody for 30 min at 4°C.
  • Both Mabl and Mab2 anti-RORl antibodies bind with more potency to PA-1 cell lines (later found to express high level of RORl) than SK-OV-3 (later found to express low level of RORl).
  • the calculated EC50s for binding of RORl Mabl and RORl Mab2 to SK-OV-3 are extrapolated values and may be over- or underestimated.
  • Figure 3-3 shows an increase of MFI on SK-OV-3 cells (A, open squares) and PA-1 cells (B, open triangles) in function of the concentrations of RORl Mab2 IgG. Maximum intensity could be reached approximately 3 times more in PA-1 cells vs. SK-OV-3 cells with an antibody concentration of 10 ⁇ g/mL.
  • Table 2 EC50 values for binding of anti-RORl antibodies to ovarian cancer cell lines
  • mice anti-human RORl IgG antibody Biolegend # 357802
  • a mouse IgG2a isotype control antibody BioLegend # 401501
  • FACS buffer PBS, 0.1% BSA
  • 25 ⁇ g/ml or at saturation concentrations
  • 100 ⁇ of the Set-up or Calibration Beads were added in separate wells and the cells, as well as the beads were washed twice with FACS buffer.
  • RORl antigen copy number / binding sites were measured on five human ovarian cancer cell lines (ES-2, SK-OV-3, OVCAR-5, COLO-704 and PA-1) and expressed at different levels.
  • ES-2 cells did not express any antigen copy of human RORl while S-KOV-3 cells expressed low level of human ROR1 , OVCAR-5 and COLO-704 cells expressed medium level of human ROR1 and PA-1 cells expressed high level of human ROR1.
  • human ovarian cancer cell lines with high, medium and/or low expression level of ROR1 will be selected and used in the redirected T-cell cytotoxicity assay as tumor target cells in Example 10.
  • Table 2.1 ROR1 antigen copy number / binding sites on human ovarian cancer cell lines as measured by quantitative flow cytometry
  • Anti-RORl antibodies were further tested in the internalization assay. Briefly, human ROR1 -expressing primary B-CLL target cells were harvested with Cell Dissociation Buffer, washed and resuspended in RPMI supplemented with 10% FCS at a concentration of 1 x 10 6 (1 x 10 6 /mL) of PBMC from untreated CLL patients or 1 xlO 6 cells/mL RPMI8226 cells after determination of cell viability using ViCell. The cell suspension was transferred in a 15 ml Falcon tube for each tested IgG/TCB and each concentration.
  • diluted anti-RORl IgG or anti-RORl/anti-CD3 TCBs conjugated with Alexa488 were added to the tubes and incubated for 30 min in the cold room on a shaker. After incubation and washing the cells three times with cold PBS to remove unbound antibody, the cells were either left on ice or transferred (0.1 x 10 6 cells) in 96-well FACS plate in pre- warmed medium and incubated at 37°C for 15 min, 30 min, 1 h, 2 h, and 24 h to facilitate internalization.
  • sample of cells were also incubated at 37°C for 2 h and/or 24 h in the presence of 3 ⁇ phenylarsine oxide (Sigma-Aldrich) to inhibit internalization. Subsequently, the cells were washed once with cold PBS and incubated with Alexa647-labeled anti-human Fc secondary antibody (F(ab) 2 ) for 30 min at 4 °C. After three final washes with PBS, the cells were centrifuged 4 min at 400 x g and resuspended in FACS buffer with or without propidium iodide (1 :4000) (Sigma).
  • Alexa647-labeled anti-human Fc secondary antibody F(ab) 2
  • MFI mean fluorescence intensity
  • MFI reduction can represent antibody internalization, antibody dissociation or a combination of both.
  • An MFI reduction which is blocked by endocytosis inhibitor phenylarsine oxide indicates antibody internalization while an MFI reduction which is not blocked by phenylarsine oxide reflects antibody dissociation.
  • Internalizing anti- RORl antibodies are known in the state of the art (Baskar et al., Clin. Cancer Res., 14(2): 396-404 (2008)).
  • anti-RORl antibodies which does not internalize or slowly internalize or slightly internalize are selected for the next step (Example 5) below, namely the production of anti- RORl/anti-CD3 T cell bispecific antibodies.
  • Example 5 Generation of anti-RORl/anti-CD3 T cell bispecific antibodies
  • Example 5.1 Generation of anti-CD3 antibodies
  • oligonucleotides encoding the above sequences were joined together via PCR to synthesize cDNAs encoding the VH and VL sequences, respectively, of the anti-CD3 antibody.
  • Anti-CD3 antibody CH2527 (SEQ ID NO:21 -28) was used to generate the T cell bispecific antibodies which were used in the following examples.
  • Anti-RORl/anti-CD3 T cell bispecific of the 1+1 one-arm format i.e. bispecific (Fab)x(Fab) antibody monovalent for RORl and monovalent for CD3 are produced with the anti-RORl antibodies generated from Example 1.
  • cDNAs encoding the full Fabs (heavy chain VH and CHI domains plus light chain VL and CL domains) of the corresponding anti-RORl IgGl antibodies, as described in Example 1, as well as the anti-CD3 VH and VL cDNAs described in Example 5.1 are used as the starting materials.
  • four protein chains are involved comprising the heavy and light chains of the corresponding anti-RORl antibody and the heavy and light chains of the anti-CD3 antibody described above.
  • the IgGl derived bispecific molecules consist at least of two antigen binding moieties capable of binding specifically to two distinct antigenic determinants CD3 and RORl .
  • the antigen binding moieties are Fab fragments composed of a heavy and a light chain, each comprising a variable and a constant region. At least one of the Fab fragments is a "Crossfab" fragment, wherein the constant domains of the Fab heavy and light chain are exchanged. The exchange of heavy and light chain constant domains within the Fab fragment assures that Fab fragments of different specificity do not have identical domain arrangements and consequently do not interchange light chains.
  • the bispecific molecule design can be monovalent for both antigenic determinants (1+1) or monovalent for CD3 and bivalent for RORl where one Fab fragment is fused to the N-terminus of the inner CrossFab (2+1).
  • a schematic representation of the constructs is given in Figure 1. Sequences of the constructs are shown in SEQ ID NOs 2 to 36. The molecules are produced by polymer-based co- transfecting HEK293 EBNA cells growing in suspension with the mammalian expression.
  • Example 5.3. Generation of anti-RORl/anti-CD3 T cell bispecific 2+1 format i.e. bispecific (Fab) 2 x (Fab) antibody bivalent for RORl and monovalent for CD3
  • An anti-RORl /anti-CD3 T cell bispecific antibody with a 2+1 format i.e. bispecific (Fab) 2 x (Fab) antibody that is bivalent for RORl and monovalent for CD3 would have advantages on potency, predictability for efficacy and safety because it would preferentially bind to the tumor target RORl and avoid CD3 antibody sink, thus higher probability for drug exposure focused to the tumor.
  • Anti -RORl/anti-CD3 T cell bispecific of the 2+1 format i.e. bispecific (Fab) 2 x (Fab) antibody bivalent for RORl and monovalent for CD3 are produced with the anti-RORl antibodies generated in Example 1.
  • cDNAs encoding the full Fabs (heavy chain VH and CHI domains plus light chain VL and CL domains) of the corresponding anti-RORl IgGl antibodies, as described in Example 1, as well as the anti-CD3 VH and VL cDNAs described in Example 5.1, are used as the starting materials.
  • four protein chains are involved comprising the heavy and light chains of the corresponding anti-RORl antibody and the heavy and light chains of the anti-CD3 antibody described above.
  • the IgGl derived bispecific molecules consist at least of two antigen binding moieties capable of binding specifically to two distinct antigenic determinants CD3 and ROR1.
  • the antigen binding moieties are Fab fragments composed of a heavy and a light chain, each comprising a variable and a constant region. At least one of the Fab fragments is a "Crossfab" fragment, wherein the constant domains of the Fab heavy and light chain are exchanged. The exchange of heavy and light chain constant domains within the Fab fragment assures that Fab fragments of different specificity do not have identical domain arrangements and consequently do not interchange light chains.
  • the bispecific molecule design can be monovalent for both antigenic determinants (1+1) or monovalent for CD3 and bivalent for ROR1 where one Fab fragment is fused to the N-terminus of the inner CrossFab (2+1 ).
  • a schematic representation of the constructs is given in Figure 1; Sequences of the constructs are shown in SEQ ID NOs 1 to 62 .
  • the molecules are produced by polymer-based co- transfecting HEK293 EBNA cells growing in suspension with the mammalian expression.
  • bispecific antibodies are expressed by transient polymer- based co-transfection of the respective mammalian expression vectors in HEK293-EBNA cells, which are cultivated in suspension.
  • HEK293-EBNA cells are seeded at 1.5 Mio viable cells/mL in Ex-Cell medium, supplemented with 6 niM of L-Glutamine.
  • HEK293-EBNA cells are seeded at 1.5 Mio viable cells/mL in Ex-Cell medium, supplemented with 6 niM of L-Glutamine.
  • 2.0 Mio viable cells are centrifuged (5 minutes at 210 x g). The supernatant is aspirated and the cells resuspended in 100 of CD CHO medium.
  • the supernatant is loaded on a protein A column (HiTrap Protein A FF , 5 niL, GE Healthcare) equilibrated with 6 CV 20 mM sodium phosphate, 20 mM sodium citrate, pH 7.5.
  • the antibody is eluted from the column by step elution with 20 mM sodium phosphate, 100 mM sodium chloride, 100 mM Glycine, pH 3.0.
  • the fractions with the desired antibody are immediately neutralized by 0.5 M Sodium Phosphate, pH 8.0 (1 :10), pooled and concentrated by centrifugation.
  • the concentrate is sterile filtered and processed further by cation exchange chromatography and/or size exclusion chromatography.
  • the concentrated protein is diluted 1 :10 with the elution buffer used for the affinity step and loaded onto a cation exchange colume (Poros 50 HS, Applied Biosystems).
  • a cation exchange colume Poros 50 HS, Applied Biosystems
  • the equilibration buffer and a washing buffer resp. 20 mM sodium phosphate, 20 mM sodium citrate, 20 mM TRIS, pH 5.0 and 20 mM sodium phosphate, 20 mM sodium citrate, 20 mM TRIS, 100 mM sodium chloride pH 5.0
  • the protein is eluted with a gradient using 20 mM sodium phosphate, 20 mM sodium citrate, 20 mM TRIS, 100 mM sodium chloride pH 8.5.
  • the fractions containing the desired antibody are pooled, concentrated by centrifugation, sterile filtered and processed further a size exclusion step.
  • the concentrated protein is injected in a XK16/60 HiLoad Superdex 200 column (GE Healthcare), and 20 mM Histidine, 140 mM Sodium Chloride, pH 6.0 with or without Tween20 as formulation buffer.
  • the fractions containing the monomers are pooled, concentrated by centrifugation and sterile filtered into a sterile vial.
  • Determination of the antibody concentration is done by measurement of the absorbance at 280 nm, using the theoretical value of the absorbance of a 0.1% solution of the antibody. This value is based on the amino acid sequence and calculated by GPMAW software (Lighthouse data).
  • Purity and monomer content of the final protein preparation is determined by CE-SDS (Caliper LabChip GXII system (Caliper Life Sciences)) resp. HPLC (TSKgel G3000 SW XL analytical size exclusion column (Tosoh)) in a 25 mM potassium phosphate, 125 mM Sodium chloride, 200 mM L-arginine monohydrochloride, 0.02 % (w/v) Sodium azide, pH 6.7 buffer.
  • LC-MS liquid chromatography-mass spectometry
  • the constructs are treated with PNGaseF (ProZyme). Therefore, the pH of the protein solution is adjusted to pH7.0 by adding 2 ⁇ 2 M Tris to 20 ⁇ g protein with a concentration of 0.5 mg/ml. 0.8 ⁇ g PNGaseF is added and incubated for 12 h at 37 °C.
  • the LC-MS online detection is then performed.
  • LC-MS method is performed on an Agilent HPLC 1200 coupled to a TOF 6441 mass spectrometer (Agilent). The chromatographic separation is performed on a Macherey Nagel Polysterene column; RP 1000-8 (8 ⁇ particle size, 4.6 x 250 mm; cat. No. 719510).
  • Eluent A is 5 % acetonitrile and 0.05 % (v/v) formic acid in water
  • eluent B was 95 % acetonitrile, 5 % water and 0.05 % formic acid.
  • the flow rate was 1 ml/min
  • the separation is performed at 40°C and 6 ⁇ g (15 ⁇ ) of a protein sample obtained with a treatment as described before (table 8).
  • the eluate is directed into the waste to protect the mass spectrometer from salt contamination.
  • the ESI-source was running with a drying gas flow of 12 1/min, a temperature of 350°C and a nebulizer pressure of 60psi.
  • the MS spectra are acquired using a fragmentor voltage of 380 V and a mass range 700 to 3200 m/z in positive ion mode using.
  • MS data are acquired by the instrument software from 4 to 17 minutes.
  • RORlxCD3-TCBcv (with charge variants) antibodies is then conducted to further evaluate the advantages of the CL-CH1 charge modifications applied to the T cell bispecific antibodies.
  • Table 8-1 shows the favorable production/purification profile of three molecules of RORlxCD3-TCB with charge variants following standard, non-optimized purification methods including Protein A (PA) affinity chromatography and size exclusion chromatographic (SEC) purification.
  • PA Protein A
  • SEC size exclusion chromatographic
  • Table 8-1 Production/purification profile of anti-RORl/anti-CD3 T cell bispecific antibodies with charge variants following standard, non-optimized purification methods Titer (mg/L) Monomer content (%) Purity (%)
  • Figure 3-1 depicts the CE-SDS (non-reduced) graphs of the final protein preparations after different methods of purification for another TCB molecule without or with charge variants namely 83A10-TCB and 83A10-TCBcv antibodies.
  • Protein A (PA) affinity chromatography and size exclusion 5 chromatographic (SEC) purification steps applied to 83A10-TCB antibody resulted in a purity of ⁇ 30% and 82.8% of monomer content (A).
  • 83A10-TCB and 83A10-TCBcv molecules are both of molecular format as described in Figure 2a of PCT/EP2015/067841. As depicted in Figure 3-2, properties of
  • 83A10-TCB and 83A10-TCBcv final protein preparations from Figures 3-2C and 3-2D were pooled with approximately 1 L (equivolume) of respective final protein preparations from another purification batch (same production) following PA affinity chromatography purification step only. The pooled protein preparations were then being further purified by clEX and SEC purification methods.
  • Table 8-2 summarizes the properties of 83A10-TCB as compared to 83A10-TCBcv following PA purification step.
  • Table 8-3 summarizes the properties of 83A10-TCB as compared to 83A10-TCBcv following PA and SEC purification steps.
  • Table 8-4 summarizes the properties of 83A10-TCB as compared to 83A10-TCBcv following PA and SEC plus PA alone then clEX and re-SEC purification steps.
  • the values in bold highlight the superior property as compared between 83A10-TCB vs. 83A10-TCBcv. With one exception (i.e.
  • Table 8-2 Production/purification profile of anti-BCMA/anti-CD3 T cell bispecific antibodies following protein A affinity chromatography purification step 83A10-TCB 83A10-TCBcv
  • Table 8-3 Production/purification profile of anti-BCMA/anti-CD3 T cell bispecific antibodies following protein A affinity chromatography and size exclusion chromatography purification steps
  • Table 8-4 Production/purification profile of anti-BCMA/anti-CD3 T cell bispecific antibodies following l .a) protein A affinity chromatography and size exclusion chromatography and l.b) protein A affinity chromatography only pooled together then 2) cation exchange chromatography and 3) final size exclusion chromatography purification steps
  • Example 6 Binding of anti-RORl/anti-CD3 T cell bispecific antibodies to ROR1 -positive B-CLL cells or myeloma cells or CD3 on T cells (Flow cytometry) a) Anti-RORl/anti-CD3 T cell bispecific antibodies generated in Example 5 were also analyzed by flow cytometry for their binding properties to human ROR1 expressed on primary B-CLL cells or human CD3 expressed on human leukemic T cells Jurkat (ATCC ⁇ -152). Jurkat T cells were cultured in RPMI supplemented with 10% fetal calf serum. Briefly, cultured cells were harvested, counted and cell viability was evaluated using ViCell.
  • Viable cells were then adjusted to 2 x 10 6 cells per ml in FACS Stain Buffer (BD Biosciences) containing 0.1% BSA. 100 ⁇ of this cell suspension were further ahquoted per well into a round-bottom 96-well plate. 30 ⁇ of the Alexa488-labelled anti-RORl/anti-CD3 T cell bispecific antibodies or corresponding IgG control were added to the cell-containing wells to obtain final concentrations of 3 nM to 500 nM or 0.1 pM to 200 nM. Anti-RORl/anti-CD3 T cell bispecific antibodies and control IgG were used at the same molarity.
  • Binding of the anti-RORl/anti-CD3 T cell bispecific antibodies to B-CLL cells and T cells were evaluated and the mean fluorescence intensity was determined gated on either ROR1 -expressing B-CLL cells or CD3- expressing Jurkat T cells and plotted in histograms or dot plots.
  • Figure 7 shows the mean fluorescence intensity for anti-RORl/anti-CD3 T cell bispecific antibodies binding to Jurkat T cells and plotted in function of antibody concentration. EC50 values and maximal binding of anti-RORl/anti-CD3 TCBl+1 and anti-RORl/anti-CD3 TCB2+1 antibodies to Jurkat cells were not reached.
  • RORl/anti- CD3 TCBl+1 antibody binds more efficiently to Jurkat T cells than RORl/anti-CD3 TCB2+1 antibody does.
  • DP47 isotype control antibody or anti-RORl IgG antibody did not bind to Jurkat T cells.
  • Anti-RORl/anti-CD3 T cell bispecific antibodies were analyzed by flow cytometry for binding to human ROR1 on ROR1 -expressing myeloma RPMI8226 cells. Briefly, cultured cells were harvested, counted and cell viability was evaluated using ViCell. Viable cells were then adjusted to 2 x 10 6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences).
  • Figure 8 shows the mean fluorescence intensity for anti- RORl/anti-CD3 T cell bispecific antibodies plotted in function of antibody concentratiomanti- RORl/anti-CD3 TCB l+1 and anti-RORl/anti-CD3 TCB2+1 antibodies on RPMI8226 cells EC50 values (denoting the antibody concentration required to reach 50% of the maximal binding) for the binding of anti-RORl/anti-CD3 TCB l+1 and anti-RORl/anti-CD3 TCB2+1 antibodies to RPMI8226 cells are summarized in Table 3.
  • Anti-RORl/anti-CD3 TCB2+1 antibody bivalent for ROR1 seems to bind to RORl -positive RPMI8226 myeloma cells slightly better than anti-RORl/anti-CD3 TCBl +1 antibody which is monovalent to ROR1, as detected by FACS ( Figure 8).
  • Anti-RORl/anti-CD3 TCB antibodies were also shown to bind to primary B-CLL cells as detected by flow cytometry using a fluorochrome- conjugated secondary anti-human Fc antibody ( Figure 2A).
  • Table 3 EC50 values for binding of anti-RORl/anti-CD3 T cell bispecific antibodies to RPMI8226 cells
  • Anti-RORl/anti-CD3 T cell bispecific antibodies generated in Example 5 were analyzed by flow cytometry for their binding to human ovarian cancer cell lines PA-1 and SK-OV-3 and human CD3 expressed on human leukemic T cells Jurkat (ATCC TIB-152).
  • Jurkat T cells were cultured in RPMI1640 medium supplemented with 10% fetal calf serum. Briefly, cultured cells were harvested, counted and cell viability is evaluated using ViCell. Viable cells were then adjusted to 2 x 10 6 cells per ml in FACS Stain Buffer (BD Biosciences) containing 0.1% BSA. 100 ⁇ of this cell suspension were further aliquoted per well into a round-bottom 96-well plate.
  • Example 7 Internalization of anti-RORl/anti-CD3 T cell bispecific antibodies on EHEB B-CLL cell line or primary PBMC from CLL patients or RPMI8226 MM cells (Flow cytometry).
  • Anti-RORl/anti-CD3 T cell bispecific antibodies selected in step (Example 5) above were further tested in the internalization assay. Briefly, cryopreserved human ROR1 -expressing primary B-CLL target cells were thawed, harvested with Cell Dissociation Buffer, washed and resuspended in RPMl supplemented with 10% FCS at a concentration of 1 x 10 6 (1 x 10 6 /mL) of cryopreserved PBMC from untreated CLL patients or 2 xl0 6 cells/mL of EHEB B-CLL cell line or 1 xlO 6 cells/mL RPMI8226 cells after determination of cell viability using ViCell.
  • the cell suspension was transferred in a 15 ml Falcon tube for each tested IgG/TCB and each concentration.
  • 0.5 ml of diluted anti-RORl IgG or anti-RORl/anti- CD3 TCBs conjugated with Alexa488 (diluted to 1 nM in RPMl + 10% FCS) were added to the tubes and incubated for 30 min in the cold room on a shaker. After incubation and washing the cells three times with cold PBS to remove unbound antibody, the cells were either left on ice or transferred (0.1 x 10 6 cells) in 96-well FACS plate in pre- warmed medium and incubated at 37°C for 15 min, 30 min, 1 h, 2 h, and 24 h to facilitate internalization.
  • cell samples were incubated at 37°C for 2 h and/or 24 h in the presence of 3 ⁇ phenylarsine oxide (Sigma- Aldrich) to inhibit internalization. Subsequently, the cells were washed once with cold PBS and incubated with Alexa647 -labeled anti-human Fc secondary antibody (F(ab) 2 ) for 30 min at 4 °C. After three final washes with PBS, the cells were centrifuged 4 min at 400 x g and resuspended in FACS buffer with or without propidium iodide (1 :4000) (Sigma).
  • Alexa647 -labeled anti-human Fc secondary antibody F(ab) 2
  • the mean fluorescence intensity (MFl) of the cells for anti-RORl IgG and anti-RORl/anti-CD3 TCBs was measured using a FACS CantoII flow cytometer (BD Biosciences) and FlowJo analytical software.
  • AMFI mean fluorescence intensity reflecting the internalization of the said anti-RORl antibody into ROR1 -positive cells
  • MFI experimental is the MFl measured with said ROR1 antibody after 2h incubation at 37°C.
  • MFl reduction can represent antibody internalization, antibody dissociation or a combination of both.
  • the antibody or antibody fragment specific to the tumor target does not internalize, or slowly internalizes, or slightly internalizes for facilitating a stable immune synapse between the tumor cell and the T cell and effective T cell- mediated redirected cytotoxicity and T cell activation.
  • anti-RORl IgG antibody (InM) internalized about 12.5% in primary B-CLL cells after an incubation of 2 hrs at 37°C while anti-RORl/anti-CD3 TCB2+1 antibody (1 nM) showed an internalization rate of 27.1 %> in primary B-CLL cells at the same experimental conditions ( Figures 4A and 4C) as measured by FACS (indirect detection of secondary fluorochrome-conjugated antibody). Internalization was calculated based on the MFl value at time 0, baseline, and calculated using the previously described formula. The results show that anti-RORl /anti- CD3 TCB2+1 has an internalization rate of less than 30% in B-CLL cells.
  • Figure 5 shows the internalization rate of anti-RORl/anti-CD3 TCB l+1 antibody (1 nM) in primary B- CLL cells after an incubation of 2 hrs at 37°C in the presence or absence of phenylarsine oxide (PAO).
  • PAO phenylarsine oxide
  • Figure 6 and Table 6 summarize the internalization rates of TCB2+1 antibodies and anti-RORl IgG antibody (1 nM) in RPMI8226 MM cells after an incubation of 2 hrs at 37°C, as measured in two independent experiments. The results demonstrate that anti-RORl/anti-CD3 TCB2+1 has an internalization rate of less than 15% in RPMI cells.
  • Table 4 Internalization values for anti-RORl /anti-CD3 2+1 T cell bispecific antibody and RORl IgG in primary B -CLL cells
  • Example 8 Activation of T cells upon engagement of anti-RORl/anti-CD3 T cell bispecific antibodies (Flow cytometry)
  • Anti-RORl/anti-CD3 T cell bispecific antibodies generated in Example 5 were also analyzed by flow cytometry for their potential to induce T cell activation by evaluating the surface expression of the early activation marker CD69, or the late activation marker CD25 on CD4 + and CD8 + T cells in the presence or absence of human RORl -positive cells. Briefly, RORl -positive cells were harvested with Cell Dissociation buffer, counted and cell viability is verified using ViCell.
  • Viable B-CLL cells were adjusted to 0.2 x 10 6 cells/mL in RPMI supplemented with 10% FCS, 100 ⁇ of this cell suspension per well was pipetted into a round-bottom 96-well plate. 50 ⁇ of the T cell bispecific constructs were added to the RORl -positive cells-containing wells to obtain a final concentration of 0.01 fJVl to 100 pM or 0.01 pM to 100 nM. The 96-well plate was set aside and kept at 37°C, 5% C0 2 until further manipulations.
  • PBMC peripheral blood mononuclear cells
  • PBMC peripheral blood mononuclear cells
  • CD8 T cell clones were used as effectors.
  • CD8 T cells specific to NLV a CMV specific peptide recognized by HLA-A2 were purified from HLA-A2+ healthy donor PBMCs using aCD8 antibodies and tetramers specific to HLA-A2 complexed with NLV peptide and sorted with a cell sorter.
  • the purified cells were expanded on irradiated feeder preparations obtained from healthy donor PBMC and HLA-A2+LCLs (lymphoblastoid cells) pulsed with NLV peptide in media (RPMI1640+10%FBS+l%L-glutamine) with 400IU IL2.
  • the NLV specific CD8 T cell clones were maintained in the same media with 400IU IL2 and regularly reactivated on feeder preparations. Human total T cells or CD8 T cell clones (effectors) were then adjusted to 2 x 10 6 cells per ml in RPMI supplemented with 10% FCS.
  • CD69 or CD25 activation markers were determined by measuring the mean fluorescence intensity gated on CD4 + and CD8 + T cell populations as represented in histograms or dot plots.
  • Figure 9A shows the concentration dependent increase in the mean fluorescence intensity of the late activation marker CD25 gated on CD8 T cells.
  • the results indicates that anti-RORl/anti-CD3 TCBl+1 antibody induced a significant concentration dependent activation of CD8 T cells in the presence of ROR1 -positive Rec-1 cells and the maximum signal was reached with 100 pM of antibody.
  • Unspecific activation of CD8 T cells was minimal upon binding of CD3 on T cells but without binding on ROR1- positive target cells obtained by non-binder TCB constructs.
  • the activation of CD8 T cells was not as pronounced with anti-RORl/anti-CD3 TCB2+1 antibody, there was a faint but noticeable increase in CD25 mean fluorescence intensity. However, unspecific actvation could not be ruled out.
  • Figure 9B shows the concentration dependent upregulation of CD25 on CD8 T cells mediated by anti- RORl/anti-CD3 TCB 1+1 and anti-RORl/anti-CD3 TCB2+1 antibodies in the presence of ROR1 -positive RPMI8226 MM cells. At the highest concentration (100 pM) of TCB antibodies tested there was no unspecific activation of CD8 T cells as shown in comparison to the non-binder TCB constructs.
  • Anti-RORl/anti-CD3 T cell bispecific antibodies generated in Example 5 were also analyzed by flow cytometry for their potential to induce T-cell activation by evaluating the surface expression of the early activation marker CD69 and/or the late activation marker CD25 on CD4 + and CD8 + T cells in the presence of ROR1 -positive human ovarian cancer cell lines PA-1 and/or SK-OV-3. Briefly, human ovarian cancer target cells were harvested with Trypsin/EDTA, washed, and plated at density of 25,000 cells/well using flat-bottom 96-well plates. Cells were left to adhere overnight.
  • PBMCs Peripheral blood mononuclear cells
  • enriched lymphocyte preparations obtained from healthy human donors.
  • Fresh blood was diluted with sterile PBS and layered over Histopaque gradient (Sigma, #H8889). After centrifugation (450xg, 30 minutes, room temperature), the plasma above the PBMC-containing interphase was discarded and PBMCs transferred in a new falcon tube subsequently filled with 50 ml of PBS. The mixture was centrifuged (400xg, 10 minutes, room temperature), the supernatant discarded and the PBMC pellet washed twice with sterile PBS (centrifugation steps 350xg, 10 minutes).
  • the resulting PBMC population was counted automatically (ViCell) and stored in respective culture medium according to the cell line supplier (see Example 2.1) at 37° C, 5% C0 2 in a cell incubator until further use (no longer than 24 h).
  • human ovarian cancer cells were exposed to the bispecific antibody at the indicated concentrations (range of 0.1 pM to 200 nM in triplicates).
  • PBMCs were then added to the human ovarian cancer target cells at final effector to target (E:T) ratio of 10: 1.
  • E:T effector to target
  • CD69 or CD25 activation markers were determined by measuring the median fluorescence intensity gated on CD4 + and CD8 + T cell populations as represented in histograms or dot plots.
  • RORl Mab2-TCBcv (squares) induced a concentration-dependent increase of CD69 early activation marker which was observed on CD4+ T cells (A) and CD8+ T cells (B) in presence of RORl-low expressing SK-OV-3 target cells while control-TCB (triangles) did not induce any T-cell activation.
  • A CD4+ T cells
  • B CD8+ T cells
  • control-TCB triangles
  • Example 9 Redirected T cell cytotoxicity of multiple myeloma cells upon cross-linking of anti- RORl/anti-CD3 T cell bispecific antibodies to CD3 on T cells and RORl on multiple myeloma cells (LDH release assay)
  • Anti-RORl/anti-CD3 T cell bispecific antibodies generated in Example 5 were also analyzed for their potential to induce T cell-mediated apoptosis in RORl -expressing multiple myeloma cells upon crosslinking of the construct via binding of the antigen binding moieties to RORl on cells.
  • human RORl -expressing RPMI-8226 multiple myeloma target cells available from American Type Culture Collection; ATCC CCL-155) were harvested with Cell Dissociation Buffer, washed and resuspended in RPMI supplemented with 10%> FCS.
  • Figure 10 shows the redirected T cell killing of RORl -positive RPMI8226 MM target cells by CD8 T cells activated by anti-RORl/anti-CD3 TCB antibodies.
  • Specific cytotoxicity of target cells (tumor lysis) induced by anti-RORl/anti-CD3 TCB antibodies was measured by LDH release.
  • A Experiment 1 (14h time point): A very slight concentration dependent increase of tumor lysis response was observed with anti-RORl/anti-CD3 TCBl+1 antibody. 30% of tumor lysis was already observed with the lowest
  • FIG. 35 shows the redirected T cell killing of RORl -positive RPMI8226 MM target cells by T cells from PBMCs activated by anti-RORl/anti-CD3 TCB antibodies at different effector cells to tumor cells (E:T) ratios.
  • E:T effector cells to tumor cells
  • Specific cytotoxicity of target cells (tumor lysis) induced by anti-RORl/anti-CD3 TCB antibodies was measured by LDH release.
  • E:T ratio 10 PBMCs : 1 RPMI8226 MM cell (24h time point): there was a concentration dependent response with increasing concentrations for up to 100 nM.
  • a maximum mean of 25% of tumor lysis was observed with 100 nM concentration anti-RORl/anti-CD3 TCBl+1 and anti-RORl/anti-CD3 TCB2+1 antibodies in experimental conditions with E:T ratio of 10: 1 i.e. 10 PBMCs for 1 RPMI8226 target cell.
  • the 25% tumor lysis observed at 100 nM as detected by LDH release could not have been attributed only to unspecific killing of target cells as there was only 9%> unspecific target cell lysis with 100 nM of non-binder TCB2+1 (i.e. binds to effector cells but not to target cells).
  • Example 10 Cell lysis of human ovarian cancer cells (LDH release assay)
  • Anti-RORl/anti-CD3 T cell bispecific antibodies generated in Example 5 were analyzed for induction of T cell-mediated cytotoxicity in human ovarian cancer cells.
  • Peripheral blood mononuclear cells (PBMCs) were prepared by Histopaque density centrifugation of enriched lymphocyte preparations (buffy coats) obtained from healthy human donors.
  • PBMCs Peripheral blood mononuclear cells
  • Fresh blood was diluted with sterile PBS and layered over Histopaque gradient (Sigma, #H8889). After centrifugation (450xg, 30 minutes, room temperature), the plasma above the PBMC- containing interphase was discarded and PBMCs transferred in a new falcon tube subsequently filled with 50 ml of PBS. The mixture was centrifuged (400xg, 10 minutes, room temperature), the supernatant discarded and the PBMC pellet washed twice with sterile PBS (centrifugation steps 350xg, 10 minutes).
  • the resulting PBMC population was counted automatically (ViCell) and stored in respective culture medium as suggested by the cell line supplier (see Example 2.1) at 37° C, 5%> C0 2 in a cell incubator until further use (no longer than 24 h).
  • the TCB antibody was added at the indicated concentrations (range of 0.1 pM to 200 nM in triplicates).
  • PBMCs were added to the human ovarian cancer target cells at final effector to target (E:T) ratio of 10: 1.
  • the EC 50 values were measured using Prism software (GraphPad) and determined as the T cell bispecific antibody concentration that results in 50% of maximum LDH release.
  • RORl Mab2-TCBcv squares
  • control-TCB A, B, C; circles
  • which only binds to CD3 did not induce tumor cell lysis at clinically relevant concentrations (i.e. up to 10 nM). Representative experiments shown.
  • Table 9 EC50 values for cell lysis of ovarian cancer cell lines by anti-RORl/anti-CD3 T cell bispecific antibodies

Landscapes

  • Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/EP2015/073308 2014-10-09 2015-10-08 Bispecific antibodies against cd3epsilon and ror1 Ceased WO2016055592A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
ES15778294T ES2850325T3 (es) 2014-10-09 2015-10-08 Anticuerpos biespecíficos contra CD3epsilon y ROR1
US15/517,296 US11952421B2 (en) 2014-10-09 2015-10-08 Bispecific antibodies against CD3EPSILON and ROR1
EP15778294.7A EP3204415B1 (en) 2014-10-09 2015-10-08 Bispecific antibodies against cd3epsilon and ror1
JP2017518525A JP6708635B2 (ja) 2014-10-09 2015-10-08 CD3εおよびROR1に対する二特異性抗体
CA2963692A CA2963692A1 (en) 2014-10-09 2015-10-08 Bispecific antibodies against cd3epsilon and ror1
AU2015329965A AU2015329965A1 (en) 2014-10-09 2015-10-08 Bispecific antibodies against CD3epsilon and ROR1

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP14188378.5 2014-10-09
EP14188378 2014-10-09
EP14188727 2014-10-14
EP14188727.3 2014-10-14

Publications (1)

Publication Number Publication Date
WO2016055592A1 true WO2016055592A1 (en) 2016-04-14

Family

ID=54291292

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2015/073308 Ceased WO2016055592A1 (en) 2014-10-09 2015-10-08 Bispecific antibodies against cd3epsilon and ror1

Country Status (7)

Country Link
US (1) US11952421B2 (https=)
EP (1) EP3204415B1 (https=)
JP (1) JP6708635B2 (https=)
AU (1) AU2015329965A1 (https=)
CA (1) CA2963692A1 (https=)
ES (1) ES2850325T3 (https=)
WO (1) WO2016055592A1 (https=)

Cited By (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160297881A1 (en) * 2013-04-09 2016-10-13 Engmab Ag BISPECIFIC ANTIBODIES AGAINST CD3EPSILON and ROR1
WO2017127664A1 (en) 2016-01-20 2017-07-27 The Scripps Research Institute Ror1 antibody compositions and related methods
US20170306018A1 (en) * 2014-10-09 2017-10-26 Engmab Ag Bispecific antibodies against cd3epsilon and ror1
US10087250B2 (en) 2012-10-08 2018-10-02 Roche Glycart Ag Fc-free antibodies comprising two fab-fragments and methods of use
US10155815B2 (en) 2013-02-26 2018-12-18 Roche Glycart Ag Bispecific T cell activating antigen binding molecules
WO2019008379A1 (en) * 2017-07-05 2019-01-10 Ucl Business Plc BISPECIFIC ANTIBODIES DIRECTED AGAINST ROR1 AND CD3
WO2019016381A1 (en) * 2017-07-20 2019-01-24 Nbe-Therapeutics Ag MULTISPECIFIC ANTIBODY PRODUCT BINDING TO DIFFERENT ROR1 EPITOPES
WO2019057099A1 (en) * 2017-09-21 2019-03-28 Wuxi Biologics (Shanghai) Co., Ltd. NOVEL ANTI-CD3EPSILON ANTIBODIES
CN109580504A (zh) * 2018-10-19 2019-04-05 东软威特曼生物科技(南京)有限公司 一种脂蛋白胆固醇测定试剂及试剂盒
US10335496B2 (en) 2017-06-23 2019-07-02 VelosBio Inc. ROR1 antibody immunoconjugates
US10596257B2 (en) 2016-01-08 2020-03-24 Hoffmann-La Roche Inc. Methods of treating CEA-positive cancers using PD-1 axis binding antagonists and anti-CEA/anti-CD3 bispecific antibodies
US10611840B2 (en) 2014-08-04 2020-04-07 Hoffman-La Roche Inc. Bispecific T cell activating antigen binding molecules
CN111148761A (zh) * 2017-06-25 2020-05-12 西雅图免疫公司 多特异性抗体及其制备和使用方法
US10758556B2 (en) 2017-08-07 2020-09-01 Nbe-Therapeutics Ag Anthracycline-based antibody drug conjugates having high in vivo tolerability
US10766967B2 (en) 2015-10-02 2020-09-08 Hoffmann-La Roche Inc. Bispecific T cell activating antigen binding molecules
US10781262B2 (en) 2014-11-20 2020-09-22 Hoffmann-La Roche Inc. Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists
WO2020237173A1 (en) * 2019-05-23 2020-11-26 VelosBio Inc. Anti-ror1/anti-cd3 bispecific binding molecules
JP2020533970A (ja) * 2017-08-28 2020-11-26 システィミューン, インク.Systimmune, Inc. 抗cd3抗体とその作製及び使用方法
US10882918B2 (en) 2016-09-30 2021-01-05 Hoffmann-La Roche Inc. Bispecific T cell activating antigen binding molecules
US11013801B2 (en) 2015-12-09 2021-05-25 Hoffmann-La Roche Inc. Treatment method
US11242390B2 (en) 2016-03-22 2022-02-08 Hoffmann-La Roche Inc. Protease-activated T cell bispecific molecules
WO2022167460A1 (en) 2021-02-02 2022-08-11 Numab Therapeutics AG Multispecific antibodies having specificity for ror1 and cd3
US11466083B2 (en) 2017-07-05 2022-10-11 Ucl Business Ltd ROR1 antibodies
US11639397B2 (en) 2011-08-23 2023-05-02 Roche Glycart Ag Bispecific antibodies specific for T-cell activating antigens and a tumor antigen and methods of use
US11723925B2 (en) 2017-07-05 2023-08-15 Ucl Business Ltd ROR1 CAR T-cells
US11866498B2 (en) 2018-02-08 2024-01-09 Genentech, Inc. Bispecific antigen-binding molecules and methods of use
US11952424B2 (en) 2018-03-30 2024-04-09 Merus N.V. Multivalent antibody
US12084496B2 (en) 2018-04-18 2024-09-10 Exelixis, Inc. Anti-ROR antibody constructs
US12103982B2 (en) 2014-11-20 2024-10-01 Hoffmann-La Roche Inc. T cell activating bispecific antigen binding molecules
US12139553B2 (en) 2014-11-20 2024-11-12 Hoffmann-La Roche Inc. T cell activating bispecific antigen binding molecules
RU2831608C2 (ru) * 2019-05-23 2024-12-11 Велосбайо Инк. Анти-ror1/анти-cd3 биспецифические связывающие молекулы
US12195547B2 (en) 2021-04-30 2025-01-14 Hoffmann-La Roche Inc. Dosing for combination treatment with anti-CD20/anti-CD3 bispecific antibody and anti-CD79B antibody drug conjugate
US12486325B2 (en) 2017-09-21 2025-12-02 WuXi Biologics Ireland Limited Anti-CD3epsilon antibodies
US12497454B2 (en) 2020-02-07 2025-12-16 VelosBio Inc. Anti-ROR1 antibodies and compositions

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090162359A1 (en) 2007-12-21 2009-06-25 Christian Klein Bivalent, bispecific antibodies
SG175077A1 (en) 2009-04-07 2011-11-28 Roche Glycart Ag Trivalent, bispecific antibodies
US9676845B2 (en) 2009-06-16 2017-06-13 Hoffmann-La Roche, Inc. Bispecific antigen binding proteins
AR085404A1 (es) 2011-02-28 2013-09-25 Hoffmann La Roche Proteinas de union a antigeno
MX342034B (es) 2011-02-28 2016-09-12 Hoffmann La Roche Proteinas monovalentes que se unen a antigenos.
BR112016006929A2 (pt) 2013-10-11 2017-09-19 Hoffmann La Roche Anticorpo, ácido nucleico, vetor de expressão, célula hospedeira, métodos de preparação de anticorpo, de tratamento de pacientes e de geração de um anticorpo, composição farmacêutica e uso do anticorpo
EP3227332B1 (en) 2014-12-03 2019-11-06 F.Hoffmann-La Roche Ag Multispecific antibodies
AR106188A1 (es) 2015-10-01 2017-12-20 Hoffmann La Roche Anticuerpos anti-cd19 humano humanizados y métodos de utilización
EP3150636A1 (en) * 2015-10-02 2017-04-05 F. Hoffmann-La Roche AG Tetravalent multispecific antibodies
SG11201803098VA (en) 2015-10-30 2018-05-30 Nbe Therapeutics Ag Anti-ror1 antibodies
IL292594A (en) * 2019-11-07 2022-07-01 Amgen Inc Training with a high salt load in cation exchange chromatography to remove impurities associated with the product
BR112022008782A2 (pt) * 2019-11-07 2022-07-26 Amgen Inc Lavagens com alto teor de sal durante cromatografia de troca catiônica para remover impurezas relacionadas ao produto
WO2021255155A1 (en) 2020-06-19 2021-12-23 F. Hoffmann-La Roche Ag Antibodies binding to cd3 and cd19
EP4200336A4 (en) * 2020-08-24 2024-09-25 Epimab Biotherapeutics (HK) Limited Anti-ror1 antibodies and related bispecific binding proteins
US12144827B2 (en) 2021-02-25 2024-11-19 Lyell Immunopharma, Inc. ROR1 targeting chimeric antigen receptor
IL312204A (en) 2021-10-28 2024-06-01 Lyell Immunopharma Inc Methods for culturing cells expressing ror1-binding protein
WO2024064952A1 (en) 2022-09-23 2024-03-28 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells overexpressing c-jun
WO2024064958A1 (en) 2022-09-23 2024-03-28 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells
WO2024077174A1 (en) 2022-10-05 2024-04-11 Lyell Immunopharma, Inc. Methods for culturing nr4a-deficient cells
CN116462768B (zh) * 2023-06-13 2023-09-22 浙江时迈药业有限公司 针对folr1的双特异性抗体及其用途
WO2025217398A1 (en) 2024-04-10 2025-10-16 Lyell Immunopharma, Inc. Methods for culturing cells with improved culture medium

Citations (84)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0307434A1 (en) 1987-03-18 1989-03-22 Medical Res Council CHANGED ANTIBODIES.
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
WO1992018149A1 (en) 1991-04-23 1992-10-29 Regeneron Pharmaceuticals, Inc. Assay systems for neurotrophin activity
US5202238A (en) 1987-10-27 1993-04-13 Oncogen Production of chimeric antibodies by homologous recombination
US5204244A (en) 1987-10-27 1993-04-20 Oncogen Production of chimeric antibodies by homologous recombination
US5273743A (en) 1990-03-09 1993-12-28 Hybritech Incorporated Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent
WO1995027060A2 (en) 1994-04-04 1995-10-12 Regeneron Pharma Biologically active eph family ligands
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
US5837821A (en) 1992-11-04 1998-11-17 City Of Hope Antibody construct
US5837242A (en) 1992-12-04 1998-11-17 Medical Research Council Multivalent and multispecific binding proteins, their manufacture and use
WO1999037791A1 (en) 1998-01-23 1999-07-29 Vlaams Interuniversitair Instituut Voor Biotechnologie Multipurpose antibody derivatives
WO2000041474A2 (en) 1999-01-15 2000-07-20 Novartis Ag Anti-cd3 immunotoxins and therapeutic uses therefor
US6294654B1 (en) 1995-01-19 2001-09-25 Inger Sandlie Modified immunoglobulin molecule incorporating an antigen in a non-CDR loop region
US6303341B1 (en) 1994-12-30 2001-10-16 Planet Biotechnology, Inc. Method for producing immunoglobulins containing protection proteins in plants and their use
WO2002044215A2 (en) 2000-12-01 2002-06-06 Cockbain, Julian Hybrid antibodies
WO2002087618A1 (en) 2001-04-27 2002-11-07 Takeda Chemical Industries, Ltd. Preventive/therapeutic method for cancer
WO2003014161A2 (en) 2001-08-10 2003-02-20 Aberdeen University Antigen binding domains from fish
WO2003025018A2 (en) 2001-09-14 2003-03-27 Affimed Therapeutics Ag Dimeric and multimeric antigen binding structure
US6551592B2 (en) 1996-09-03 2003-04-22 Gsf Forschungszentrum Fur Umwelt Und Gesundheit Gmbh Bi-and trispecific antibodies for the induction of anti-tumor immunity
WO2003048209A1 (en) 2001-11-14 2003-06-12 Affimed Therapeutics Ag Bispecific anti-cd19 x anti-cd16 antibodies and uses thereof
WO2004058822A2 (en) 2002-12-27 2004-07-15 Domantis Limited Generation of immunoglobulin molecules with predetermined specificity
WO2004076489A1 (en) 2003-02-25 2004-09-10 Medinnova As Modified antibody
US6838254B1 (en) 1993-04-29 2005-01-04 Conopco, Inc. Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae
WO2005016950A1 (en) 2003-08-07 2005-02-24 Epitomics, Inc. Methods for humanizing rabbit monoclonal antibodies
WO2005040413A1 (en) 2003-10-24 2005-05-06 Esbatech Ag Method for the identification and/or validation of receptor tyrosine kinase inhibitors
WO2005100605A1 (en) 2004-04-06 2005-10-27 The Regents Of The University Of California Orphan receptor tyrosine kinase as a target in breast cancer
WO2006072620A1 (en) 2005-01-05 2006-07-13 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions
WO2006093794A1 (en) 2005-02-28 2006-09-08 Centocor, Inc. Heterodimeric protein binding compositions
WO2006113665A2 (en) 2005-04-15 2006-10-26 Macrogenics, Inc. Covalent diabodies and uses thereof
US7150872B2 (en) 1997-04-30 2006-12-19 Enzon, Inc. Polyalkylene oxide-modified single chain polypeptides
WO2007019620A1 (en) 2005-08-15 2007-02-22 Arana Therapeutics Limited Engineered antibodies with new world primate framework regions
WO2007051077A2 (en) 2005-10-28 2007-05-03 The Regents Of The University Of California Methods and compounds for lymphoma cell detection and isolation
US7235641B2 (en) 2003-12-22 2007-06-26 Micromet Ag Bispecific antibodies
WO2007110205A2 (en) 2006-03-24 2007-10-04 Merck Patent Gmbh Engineered heterodimeric protein domains
WO2007146968A2 (en) 2006-06-12 2007-12-21 Trubion Pharmaceuticals, Inc. Single-chain multivalent binding proteins with effector function
WO2007146957A2 (en) 2006-06-13 2007-12-21 Irm Llc Ror1 as a therapeutic target for lung cancer
EP1870459A1 (en) 2005-03-31 2007-12-26 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
WO2007147901A1 (en) 2006-06-22 2007-12-27 Novo Nordisk A/S Production of bispecific antibodies
WO2008036449A2 (en) 2006-06-29 2008-03-27 The Regents Of The University Of California Chemical antibodies for immunotherapy and imaging
WO2008076868A2 (en) 2006-12-18 2008-06-26 Abbott Laboratories Methods and compositions related to modulation of receptor tyrosine kinase orphan receptor-1 (ror-1)
US20080181890A1 (en) 2002-03-01 2008-07-31 Xencor, Inc. Optimized Fc Variants and Methods for Their Generation
WO2008103849A2 (en) 2007-02-21 2008-08-28 The Regents Of The University Of California Methods and compounds for lymphoma cell detection and isolation
US20080227958A1 (en) 2006-04-14 2008-09-18 Trubion Pharmaceuticals Inc. Binding proteins comprising immunoglobulin hinge and fc regions having altered fc effector functions
WO2008119567A2 (en) 2007-04-03 2008-10-09 Micromet Ag Cross-species-specific cd3-epsilon binding domain
WO2008119353A1 (en) 2007-03-29 2008-10-09 Genmab A/S Bispecific antibodies and methods for production thereof
US20090148438A1 (en) 2004-06-02 2009-06-11 Stewart Nuttal Binding Moieties Based on Shark Ignar Domains
WO2009080253A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080252A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080251A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080254A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2009117531A1 (en) 2008-03-18 2009-09-24 Seattle Genetics, Inc. Auristatin drug linker conjugates
WO2010008069A1 (ja) 2008-07-18 2010-01-21 国立大学法人名古屋大学 細胞増殖阻害剤
US7655759B2 (en) 1995-04-25 2010-02-02 Vrije Universiteit Brussel Recombinant bivalent monospecific immunoglobulin having at least two variable fragments of heavy chains of an immunoglobulin devoid of light chains
WO2010063785A2 (en) 2008-12-03 2010-06-10 Genmab A/S Antibody variants having modifications in the constant region
WO2010124188A1 (en) 2009-04-23 2010-10-28 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-human ror1 antibodies
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
WO2010145792A1 (en) 2009-06-16 2010-12-23 F. Hoffmann-La Roche Ag Bispecific antigen binding proteins
WO2011014659A2 (en) 2009-07-29 2011-02-03 Abbott Laboratories Dual variable domain immunoglobulins and uses thereof
WO2011050262A2 (en) 2009-10-23 2011-04-28 Abbott Laboratories Dual variable domain immunoglobulins and uses thereof
WO2011054007A1 (en) 2009-11-02 2011-05-05 Oxford Biotherapeutics Ltd. Ror1 as therapeutic and diagnostic target
WO2011079902A2 (en) 2009-12-18 2011-07-07 Biolnvent International Ab Biological materials and uses thereof
WO2011090754A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Polypeptide heterodimers and uses thereof
WO2011143545A1 (en) 2010-05-14 2011-11-17 Rinat Neuroscience Corporation Heterodimeric proteins and methods for producing and purifying them
WO2011159847A2 (en) 2010-06-15 2011-12-22 The Regents Of The University Of California Receptor tyrosine kinase-like orphan receptor 1 (ror1) single chain fv antibody fragment conjugates and methods of use thereof
WO2012009731A1 (en) 2010-07-13 2012-01-19 Marc Timothy Turk Pipe fitting
WO2012045085A1 (en) 2010-10-01 2012-04-05 Oxford Biotherapeutics Ltd. Anti-rori antibodies
WO2012058768A1 (en) 2010-11-05 2012-05-10 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the fc domain
WO2012075158A1 (en) 2010-12-01 2012-06-07 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric rabbit/human ror1 antibodies
WO2012076066A1 (en) 2010-12-10 2012-06-14 Bioinvent International Ab Anti-ror1 antibodies and uses thereof
WO2012097313A2 (en) 2011-01-14 2012-07-19 The Regents Of The University Of California Therapeutic antibodies against ror-1 protein and methods for use of same
WO2012116927A1 (en) 2011-02-28 2012-09-07 F. Hoffmann-La Roche Ag Monovalent antigen binding proteins
WO2012130831A1 (en) 2011-03-29 2012-10-04 Roche Glycart Ag Antibody fc variants
WO2012131555A2 (en) 2011-03-25 2012-10-04 Glenmark Pharmaceuticals S.A. Hetero-dimeric immunoglobulins
WO2013002362A1 (ja) 2011-06-30 2013-01-03 中外製薬株式会社 ヘテロ二量化ポリペプチド
WO2013012733A1 (en) 2011-07-15 2013-01-24 Biogen Idec Ma Inc. Heterodimeric fc regions, binding molecules comprising same, and methods relating thereto
WO2013026839A1 (en) 2011-08-23 2013-02-28 Roche Glycart Ag Bispecific antibodies specific for t-cell activating antigens and a tumor antigen and methods of use
WO2013096291A2 (en) 2011-12-20 2013-06-27 Medimmune, Llc Modified polypeptides for bispecific antibody scaffolds
EP2647707A1 (en) 2010-11-30 2013-10-09 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
WO2013157954A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
WO2014031174A1 (en) 2012-08-24 2014-02-27 The Regents Of The University Of California Antibodies and vaccines for use in treating ror1 cancers and inhibiting metastasis
US20140242079A1 (en) 2013-02-26 2014-08-28 Roche Glycart Ag Bispecific t cell activating antigen binding molecules
WO2014167022A1 (en) * 2013-04-09 2014-10-16 Engmab Ag BISPECIFIC ANTIBODIES AGAINST CD3EPSILON and ROR1

Family Cites Families (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1940881B1 (en) * 2005-10-11 2016-11-30 Amgen Research (Munich) GmbH Compositions comprising cross-species-specific antibodies and uses thereof
EP2370467B1 (en) 2008-10-01 2016-09-07 Amgen Research (Munich) GmbH Cross-species-specific pscaxcd3, cd19xcd3, c-metxcd3, endosialinxcd3, epcamxc d3, igf-1rxcd3 or fapalpha xcd3 bispecific single chain antibody
WO2012158818A2 (en) * 2011-05-16 2012-11-22 Fabion Pharmaceuticals, Inc. Multi-specific fab fusion proteins and methods of use
WO2013026837A1 (en) 2011-08-23 2013-02-28 Roche Glycart Ag Bispecific t cell activating antigen binding molecules
NO2748201T3 (https=) * 2011-08-23 2018-05-12
CN109134658B (zh) * 2011-10-31 2022-10-14 中外制药株式会社 控制了重链与轻链的缔合的抗原结合分子
MX2014014162A (es) * 2012-05-24 2015-02-04 Hoffmann La Roche Anticuerpos multiespecificos.
RU2015117393A (ru) * 2012-10-08 2016-12-10 Роше Гликарт Аг Лишенные fc антитела, содержащие два Fab-фрагмента, и способы их применения
UY35148A (es) * 2012-11-21 2014-05-30 Amgen Inc Immunoglobulinas heterodiméricas
US10968276B2 (en) 2013-03-12 2021-04-06 Xencor, Inc. Optimized anti-CD3 variable regions
KR102211837B1 (ko) 2013-01-14 2021-02-03 젠코어 인코포레이티드 신규한 이형이량체 단백질
WO2014122143A1 (en) 2013-02-05 2014-08-14 Engmab Ag Method for the selection of antibodies against bcma
CN105283201B (zh) 2013-03-14 2019-08-02 斯克利普斯研究所 靶向剂抗体偶联物及其用途
UA117289C2 (uk) * 2014-04-02 2018-07-10 Ф. Хоффманн-Ля Рош Аг Мультиспецифічне антитіло
CA3244731A1 (en) * 2014-05-28 2025-11-29 Zymeworks Bc Inc. Modified antigen binding polypeptide constructs and uses thereof
EP2982692A1 (en) * 2014-08-04 2016-02-10 EngMab AG Bispecific antibodies against CD3epsilon and BCMA
EP3177643B1 (en) 2014-08-04 2019-05-08 F.Hoffmann-La Roche Ag Bispecific t cell activating antigen binding molecules
WO2016044224A1 (en) * 2014-09-15 2016-03-24 Amgen Inc. Bi-specific anti-cgrp receptor/pac1 receptor antigen binding proteins and uses thereof
EP3204415B1 (en) 2014-10-09 2020-06-17 EngMab Sàrl Bispecific antibodies against cd3epsilon and ror1
EP3029068A1 (en) 2014-12-03 2016-06-08 EngMab AG Bispecific antibodies against CD3epsilon and BCMA for use in the treatment of diseases
SI3331910T1 (sl) 2015-08-03 2020-07-31 Engmab Sarl Monoklonska protitelesa proti humani antigen dozorevanja limfocitov B (BCMA)
JP7267914B2 (ja) 2016-11-02 2023-05-02 エンクマフ エスアーエールエル Bcma及びcd3に対する二重特異性抗体、及び多発性骨髄腫を治療するために併用して使用される免疫療法薬
WO2020219978A1 (en) 2019-04-25 2020-10-29 Celgene Corporation Bcma/cd3 bispecific trivalent t-cell engaging (tce) antibodies and their use to treat hematological malignancies
WO2021092060A1 (en) 2019-11-05 2021-05-14 Engmab Sarl Methods of treatment
CN115279459A (zh) 2019-11-05 2022-11-01 百时美施贵宝公司 使用针对bcma和cd3的抗体的治疗方法
IL295471A (en) 2020-02-12 2022-10-01 Bristol Myers Squibb Co Anti-bcma therapy in autoimmune disorders
CN115803027A (zh) 2020-04-30 2023-03-14 百时美施贵宝公司 治疗细胞因子相关的不良事件的方法

Patent Citations (88)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US6331415B1 (en) 1983-04-08 2001-12-18 Genentech, Inc. Methods of producing immunoglobulins, vectors and transformed host cells for use therein
EP0307434A1 (en) 1987-03-18 1989-03-22 Medical Res Council CHANGED ANTIBODIES.
US5202238A (en) 1987-10-27 1993-04-13 Oncogen Production of chimeric antibodies by homologous recombination
US5204244A (en) 1987-10-27 1993-04-20 Oncogen Production of chimeric antibodies by homologous recombination
US5273743A (en) 1990-03-09 1993-12-28 Hybritech Incorporated Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent
WO1992018149A1 (en) 1991-04-23 1992-10-29 Regeneron Pharmaceuticals, Inc. Assay systems for neurotrophin activity
US5837821A (en) 1992-11-04 1998-11-17 City Of Hope Antibody construct
US5837242A (en) 1992-12-04 1998-11-17 Medical Research Council Multivalent and multispecific binding proteins, their manufacture and use
US6838254B1 (en) 1993-04-29 2005-01-04 Conopco, Inc. Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae
WO1995027060A2 (en) 1994-04-04 1995-10-12 Regeneron Pharma Biologically active eph family ligands
US6303341B1 (en) 1994-12-30 2001-10-16 Planet Biotechnology, Inc. Method for producing immunoglobulins containing protection proteins in plants and their use
US6294654B1 (en) 1995-01-19 2001-09-25 Inger Sandlie Modified immunoglobulin molecule incorporating an antigen in a non-CDR loop region
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
US7655759B2 (en) 1995-04-25 2010-02-02 Vrije Universiteit Brussel Recombinant bivalent monospecific immunoglobulin having at least two variable fragments of heavy chains of an immunoglobulin devoid of light chains
US6551592B2 (en) 1996-09-03 2003-04-22 Gsf Forschungszentrum Fur Umwelt Und Gesundheit Gmbh Bi-and trispecific antibodies for the induction of anti-tumor immunity
US7150872B2 (en) 1997-04-30 2006-12-19 Enzon, Inc. Polyalkylene oxide-modified single chain polypeptides
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
WO1999037791A1 (en) 1998-01-23 1999-07-29 Vlaams Interuniversitair Instituut Voor Biotechnologie Multipurpose antibody derivatives
WO2000041474A2 (en) 1999-01-15 2000-07-20 Novartis Ag Anti-cd3 immunotoxins and therapeutic uses therefor
WO2002044215A2 (en) 2000-12-01 2002-06-06 Cockbain, Julian Hybrid antibodies
WO2002087618A1 (en) 2001-04-27 2002-11-07 Takeda Chemical Industries, Ltd. Preventive/therapeutic method for cancer
WO2003014161A2 (en) 2001-08-10 2003-02-20 Aberdeen University Antigen binding domains from fish
WO2003025018A2 (en) 2001-09-14 2003-03-27 Affimed Therapeutics Ag Dimeric and multimeric antigen binding structure
WO2003048209A1 (en) 2001-11-14 2003-06-12 Affimed Therapeutics Ag Bispecific anti-cd19 x anti-cd16 antibodies and uses thereof
US20080181890A1 (en) 2002-03-01 2008-07-31 Xencor, Inc. Optimized Fc Variants and Methods for Their Generation
WO2004058822A2 (en) 2002-12-27 2004-07-15 Domantis Limited Generation of immunoglobulin molecules with predetermined specificity
WO2004076489A1 (en) 2003-02-25 2004-09-10 Medinnova As Modified antibody
WO2005016950A1 (en) 2003-08-07 2005-02-24 Epitomics, Inc. Methods for humanizing rabbit monoclonal antibodies
WO2005040413A1 (en) 2003-10-24 2005-05-06 Esbatech Ag Method for the identification and/or validation of receptor tyrosine kinase inhibitors
US7235641B2 (en) 2003-12-22 2007-06-26 Micromet Ag Bispecific antibodies
WO2005100605A1 (en) 2004-04-06 2005-10-27 The Regents Of The University Of California Orphan receptor tyrosine kinase as a target in breast cancer
US20090148438A1 (en) 2004-06-02 2009-06-11 Stewart Nuttal Binding Moieties Based on Shark Ignar Domains
WO2006072620A1 (en) 2005-01-05 2006-07-13 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions
WO2006093794A1 (en) 2005-02-28 2006-09-08 Centocor, Inc. Heterodimeric protein binding compositions
EP1870459A1 (en) 2005-03-31 2007-12-26 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
WO2006113665A2 (en) 2005-04-15 2006-10-26 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2007019620A1 (en) 2005-08-15 2007-02-22 Arana Therapeutics Limited Engineered antibodies with new world primate framework regions
US8212009B2 (en) 2005-10-28 2012-07-03 The Regents Of The University Of California Methods and compounds for lymphoma cell detection and isolation
WO2007051077A2 (en) 2005-10-28 2007-05-03 The Regents Of The University Of California Methods and compounds for lymphoma cell detection and isolation
WO2007110205A2 (en) 2006-03-24 2007-10-04 Merck Patent Gmbh Engineered heterodimeric protein domains
US20080227958A1 (en) 2006-04-14 2008-09-18 Trubion Pharmaceuticals Inc. Binding proteins comprising immunoglobulin hinge and fc regions having altered fc effector functions
WO2007146968A2 (en) 2006-06-12 2007-12-21 Trubion Pharmaceuticals, Inc. Single-chain multivalent binding proteins with effector function
WO2007146957A2 (en) 2006-06-13 2007-12-21 Irm Llc Ror1 as a therapeutic target for lung cancer
WO2007147901A1 (en) 2006-06-22 2007-12-27 Novo Nordisk A/S Production of bispecific antibodies
WO2008036449A2 (en) 2006-06-29 2008-03-27 The Regents Of The University Of California Chemical antibodies for immunotherapy and imaging
WO2008076868A2 (en) 2006-12-18 2008-06-26 Abbott Laboratories Methods and compositions related to modulation of receptor tyrosine kinase orphan receptor-1 (ror-1)
WO2008103849A2 (en) 2007-02-21 2008-08-28 The Regents Of The University Of California Methods and compounds for lymphoma cell detection and isolation
WO2008119353A1 (en) 2007-03-29 2008-10-09 Genmab A/S Bispecific antibodies and methods for production thereof
WO2008119567A2 (en) 2007-04-03 2008-10-09 Micromet Ag Cross-species-specific cd3-epsilon binding domain
WO2009080253A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080252A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080251A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080254A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2009117531A1 (en) 2008-03-18 2009-09-24 Seattle Genetics, Inc. Auristatin drug linker conjugates
WO2010008069A1 (ja) 2008-07-18 2010-01-21 国立大学法人名古屋大学 細胞増殖阻害剤
WO2010063785A2 (en) 2008-12-03 2010-06-10 Genmab A/S Antibody variants having modifications in the constant region
WO2010124188A1 (en) 2009-04-23 2010-10-28 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-human ror1 antibodies
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
WO2010145792A1 (en) 2009-06-16 2010-12-23 F. Hoffmann-La Roche Ag Bispecific antigen binding proteins
WO2011014659A2 (en) 2009-07-29 2011-02-03 Abbott Laboratories Dual variable domain immunoglobulins and uses thereof
WO2011050262A2 (en) 2009-10-23 2011-04-28 Abbott Laboratories Dual variable domain immunoglobulins and uses thereof
WO2011054007A1 (en) 2009-11-02 2011-05-05 Oxford Biotherapeutics Ltd. Ror1 as therapeutic and diagnostic target
WO2011079902A2 (en) 2009-12-18 2011-07-07 Biolnvent International Ab Biological materials and uses thereof
WO2011090754A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Polypeptide heterodimers and uses thereof
WO2011143545A1 (en) 2010-05-14 2011-11-17 Rinat Neuroscience Corporation Heterodimeric proteins and methods for producing and purifying them
WO2011159847A2 (en) 2010-06-15 2011-12-22 The Regents Of The University Of California Receptor tyrosine kinase-like orphan receptor 1 (ror1) single chain fv antibody fragment conjugates and methods of use thereof
WO2012009731A1 (en) 2010-07-13 2012-01-19 Marc Timothy Turk Pipe fitting
WO2012045085A1 (en) 2010-10-01 2012-04-05 Oxford Biotherapeutics Ltd. Anti-rori antibodies
WO2012058768A1 (en) 2010-11-05 2012-05-10 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the fc domain
EP2647707A1 (en) 2010-11-30 2013-10-09 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
WO2012075158A1 (en) 2010-12-01 2012-06-07 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric rabbit/human ror1 antibodies
WO2012076066A1 (en) 2010-12-10 2012-06-14 Bioinvent International Ab Anti-ror1 antibodies and uses thereof
WO2012076727A1 (en) 2010-12-10 2012-06-14 Bioinvent International Ab Antibodies against ror1 and uses thereof
WO2012097313A2 (en) 2011-01-14 2012-07-19 The Regents Of The University Of California Therapeutic antibodies against ror-1 protein and methods for use of same
WO2012116927A1 (en) 2011-02-28 2012-09-07 F. Hoffmann-La Roche Ag Monovalent antigen binding proteins
WO2012131555A2 (en) 2011-03-25 2012-10-04 Glenmark Pharmaceuticals S.A. Hetero-dimeric immunoglobulins
WO2012130831A1 (en) 2011-03-29 2012-10-04 Roche Glycart Ag Antibody fc variants
WO2013002362A1 (ja) 2011-06-30 2013-01-03 中外製薬株式会社 ヘテロ二量化ポリペプチド
WO2013012733A1 (en) 2011-07-15 2013-01-24 Biogen Idec Ma Inc. Heterodimeric fc regions, binding molecules comprising same, and methods relating thereto
WO2013026839A1 (en) 2011-08-23 2013-02-28 Roche Glycart Ag Bispecific antibodies specific for t-cell activating antigens and a tumor antigen and methods of use
WO2013096291A2 (en) 2011-12-20 2013-06-27 Medimmune, Llc Modified polypeptides for bispecific antibody scaffolds
WO2013157954A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
WO2013157953A1 (en) 2012-04-20 2013-10-24 Merus B.V. Methods and means for the production of ig-like molecules
WO2014031174A1 (en) 2012-08-24 2014-02-27 The Regents Of The University Of California Antibodies and vaccines for use in treating ror1 cancers and inhibiting metastasis
US20140242079A1 (en) 2013-02-26 2014-08-28 Roche Glycart Ag Bispecific t cell activating antigen binding molecules
WO2014167022A1 (en) * 2013-04-09 2014-10-16 Engmab Ag BISPECIFIC ANTIBODIES AGAINST CD3EPSILON and ROR1

Non-Patent Citations (75)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Cell Biology", 2000, JOHN WILEY & SONS, INC.
AIWELL S; RIDGWAY JB; WELLS JA; CARTER P., J MOL BIOL, vol. 270, 1997, pages 26 - 35
ANASETTI C ET AL., TRANSPLANTATION, vol. 54, 1992, pages 844
BARNES, L.M. ET AL., BIOTECH. BIOENG., vol. 73, 2001, pages 261 - 270
BARNES, L.M. ET AL., CYTOTECHNOLOGY, vol. 32, 2000, pages 109 - 123
BASKAR ET AL., CLIN. CANCER RES., vol. 14, no. 2, 2008, pages 396 - 404
BASKAR S. ET AL., MABS, vol. 4, no. 3, 2012, pages 349 - 361
BOERNER, P. ET AL., J. IMMUNOL., vol. 147, 1991, pages 86 - 95
BRUGGEMANN, M. ET AL., YEAR IMMUNOL., vol. 7, 1993, pages 33 - 40
BRUNHOUSE, R.; CEBRA, J.J., MOL. IMMUNOL., vol. 16, 1979, pages 907 - 917
BURTON, D.R. ET AL., NATURE, vol. 288, 1980, pages 338 - 344
CANCER FACTS & FIGURES, 2014, Retrieved from the Internet <URL:http://www.cancer.org>
CARTER, P. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 - 4289
COHEN SN ET AL., PNAS, vol. 69, no. 8, 1972, pages 2110 - 2114
COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77
DANESHMANESH AH ET AL., INT. J. CANCER, vol. 123, 2008, pages 1190 - 1195
DESPLANCQ DK ET AL., PROTEIN ENG., vol. 7, no. 8, August 1994 (1994-08-01), pages 1027 - 33
DREIER ET AL., INT J CANCER, 2002
DUROCHER, Y. ET AL., NUCL. ACIDS. RES., vol. 30, 2002, pages E9
EDELMAN, G.M. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 63, 1969, pages 78 - 85
GEISSE, S. ET AL., PROTEIN EXPR. PURIF., vol. 8, 1996, pages 271 - 282
GOEBELER ET AL., ANN ONCOL, 2011
GRAHAM; VAN DER EH, VIROLOGY, vol. 52, 1978, pages 546FF
HEZAREH, M. ET AL., J. VIROL., vol. 75, 2001, pages 12161 - 12168
HOOGENBOOM, H.R.; WINTER, G., J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HUDECEK M ET AL., BLOOD, vol. 116, 2010, pages 4532 - 4541
IDUSOGIE, E.E. ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184
JAKOBOVITS, A. ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS, A. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 2555
JANEWAY CA, JR ET AL.: "Immunobiology", 2001, GARLAND PUBLISHING
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KAUFMAN, RJ., MOL. BIOTECHNOL., vol. 16, 2000, pages 151 - 161
KLINGER ET AL., BLOOD, 2012
KONTERMANN RE, MABS, vol. 4, 2012, pages 2
KONTERMANN RE, MABS, vol. 4, no. 2, 2012, pages 1 - 16
LUKAS, TJ. ET AL., J. IMMUNOL., vol. 127, 1981, pages 2555 - 2560
MACK M. ET AL., PNAS, vol. 92, no. 15, 18 July 1995 (1995-07-18), pages 7021 - 7025
MAKRIDES, S. C, PROTEIN EXPR. PURIF., vol. 17, 1999, pages 183 - 202
MARKS, J.D. ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MASIAKOWSKI P.; CARROLL R.D.: "A novel family of cell surface receptors with tyrosine kinase-like domain", J. BIOL. CHEM., vol. 267, 1992, pages 26181 - 26190
MERCHANT AM ET AL., NATURE BIOTECH, vol. 16, 1998, pages 677 - 681
MERCHANT, A.M. ET AL., NAT. BIOTECHNOL., vol. 16, 1998, pages 677 - 681
MEZZANZANICA D ET AL: "HUMAN OVARIAN CARCINOMA LYSIS BY CYTOTOXIC T CELLS TARGETED BY BISPECIFIC MONOCLONAL ANTIBODIES: ANALYSIS OF THE ANTIBODY COMPONENTS", INTERNATIONAL JOURNAL OF CANCER, JOHN WILEY & SONS, INC, US, vol. 41, no. 4, 1 January 1988 (1988-01-01), pages 609 - 615, XP009056626, ISSN: 0020-7136, DOI: 10.1002/IJC.2910410422 *
MORGAN, A. ET AL., IMMUNOLOGY, vol. 86, 1995, pages 319 - 324
MORRISON, S.L. ET AL., J. IMMUNOL., vol. 160, 1998, pages 2802 - 2808
MORRISON, S.L. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
NEUBERGER, M.S. ET AL., NATURE, vol. 314, 1985, pages 268 - 270
NORDERHAUG, L. ET AL., J. IMMUNOL. METHODS, vol. 204, 1997, pages 77 - 87
ORLANDI, R. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 3833 - 3837
RABBANI H. ET AL., BLOOD (ASH ANNUAL MEETING ABSTRACTS, 2010, pages 116
REBAGAY R. ET AL., FRONTIERS IN ONCOLOGY, vol. 7, 2012, pages 1 - 8
REBAGAY. D.; MEZZANZANICA D ET AL., INT. JOURNAL OF CANCER, vol. 41, 1988, pages 609 - 615
RHOADES RA; PFLANZER RG: "Human Physiology", 2002
RIDGWAY, J.B. ET AL., PROTEIN ENG., vol. 9, 1996, pages 617 - 621
RIECHMANN, L. ET AL., NATURE, vol. 332, 1988, pages 323 - 327
SAMBROOK, J. ET AL.: "Molecular cloning: A laboratory manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SCHAEFER, W. ET AL., PNAS, vol. 108, 2011, pages 11187 - 1191
SCHLAEGER, E.- J.; CHRISTENSEN, K., CYTOTECHNOLOGY, vol. 30, 1999, pages 71 - 83
SCHLAEGER, E.-J., J. IMMUNOL. METHODS, vol. 194, 1996, pages 191 - 199
SONDERMANN ET AL., NATURE, vol. 406, 20 July 2000 (2000-07-20), pages 267 - 273
THOMMESEN, J.E. ET AL., MOL. IMMUNOL., vol. 37, 2000, pages 995 - 1004
TOPP ET AL., J CLIN ONCOL, 2011
TOPP ET AL., J CLIN ONCOL, vol. 29, no. 18, 2011, pages 2493 - 8
VAN DIJK, M.A.; VAN DE WINKEL, J.G., CURR. OPIN. CHEM. BIOL., vol. 5, 2001, pages 368 - 374
WERNER, R.G. ET AL., ARZNEIMITTELFORSCHUNG, vol. 48, 1998, pages 870 - 880
WOOF J; BURTON D, NAT REV IMMUNOL, vol. 4, 2004, pages 89 - 99
WORN; PLUCKTHUN, J MOL BIOL, vol. 305, 2001, pages 989 - 1010
XIE, Z. ET AL., J IMMUNOL METHODS, vol. 286, 2005, pages 95 - 101
YAMAGUCHI T, CANCER CELL, vol. 21, no. 3, 2012, pages 348
YANG SJ, THE JOURNAL OF IMMUNOLOGY, vol. 137, 1986, pages 1097 - 1100
YANG; BASKAR, PLOS ONE, vol. 6, 2011, pages E21018
ZHANG S, PLOS ONE, vol. 7, no. 3, 2012, pages E31127

Cited By (56)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11639397B2 (en) 2011-08-23 2023-05-02 Roche Glycart Ag Bispecific antibodies specific for T-cell activating antigens and a tumor antigen and methods of use
US10087250B2 (en) 2012-10-08 2018-10-02 Roche Glycart Ag Fc-free antibodies comprising two fab-fragments and methods of use
US10781257B2 (en) 2013-02-26 2020-09-22 Roche GlyeArt AG Bispecific T cell activating antigen binding molecules
US10155815B2 (en) 2013-02-26 2018-12-18 Roche Glycart Ag Bispecific T cell activating antigen binding molecules
US10781258B2 (en) 2013-02-26 2020-09-22 Roche Glycart Ag Bispecific T cell activating antigen binding molecules
US20160297881A1 (en) * 2013-04-09 2016-10-13 Engmab Ag BISPECIFIC ANTIBODIES AGAINST CD3EPSILON and ROR1
US10611840B2 (en) 2014-08-04 2020-04-07 Hoffman-La Roche Inc. Bispecific T cell activating antigen binding molecules
US11117965B2 (en) 2014-08-04 2021-09-14 Hoffmann-La Roche Inc. Bispecific T cell activating antigen binding molecules
US10611841B2 (en) 2014-08-04 2020-04-07 Hoffmann-La Roche Inc. Bispecific T cell activating antigen binding molecules
US11952421B2 (en) 2014-10-09 2024-04-09 Bristol-Myers Squibb Company Bispecific antibodies against CD3EPSILON and ROR1
US20170306018A1 (en) * 2014-10-09 2017-10-26 Engmab Ag Bispecific antibodies against cd3epsilon and ror1
US12103982B2 (en) 2014-11-20 2024-10-01 Hoffmann-La Roche Inc. T cell activating bispecific antigen binding molecules
US12139553B2 (en) 2014-11-20 2024-11-12 Hoffmann-La Roche Inc. T cell activating bispecific antigen binding molecules
US10781262B2 (en) 2014-11-20 2020-09-22 Hoffmann-La Roche Inc. Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists
US11613587B2 (en) 2014-11-20 2023-03-28 Hoffmann-La Roche Inc. Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists
US10766967B2 (en) 2015-10-02 2020-09-08 Hoffmann-La Roche Inc. Bispecific T cell activating antigen binding molecules
US11013801B2 (en) 2015-12-09 2021-05-25 Hoffmann-La Roche Inc. Treatment method
US10596257B2 (en) 2016-01-08 2020-03-24 Hoffmann-La Roche Inc. Methods of treating CEA-positive cancers using PD-1 axis binding antagonists and anti-CEA/anti-CD3 bispecific antibodies
WO2017127664A1 (en) 2016-01-20 2017-07-27 The Scripps Research Institute Ror1 antibody compositions and related methods
US11242390B2 (en) 2016-03-22 2022-02-08 Hoffmann-La Roche Inc. Protease-activated T cell bispecific molecules
US10882918B2 (en) 2016-09-30 2021-01-05 Hoffmann-La Roche Inc. Bispecific T cell activating antigen binding molecules
USRE50631E1 (en) 2017-06-23 2025-10-14 VelosBio Inc. ROR1 antibody immunoconjugates
US10335496B2 (en) 2017-06-23 2019-07-02 VelosBio Inc. ROR1 antibody immunoconjugates
CN111148761A (zh) * 2017-06-25 2020-05-12 西雅图免疫公司 多特异性抗体及其制备和使用方法
CN111148761B (zh) * 2017-06-25 2024-02-13 西雅图免疫公司 多特异性抗体及其制备和使用方法
US11306142B2 (en) 2017-07-05 2022-04-19 Ucl Business Ltd Bispecific antibodies to ROR1 and CD3
CN110891972A (zh) * 2017-07-05 2020-03-17 Ucl商业有限责任公司 对ror1和cd3的双特异性抗体
WO2019008379A1 (en) * 2017-07-05 2019-01-10 Ucl Business Plc BISPECIFIC ANTIBODIES DIRECTED AGAINST ROR1 AND CD3
US11723925B2 (en) 2017-07-05 2023-08-15 Ucl Business Ltd ROR1 CAR T-cells
EP3985026A1 (en) * 2017-07-05 2022-04-20 UCL Business Ltd Bispecific antibodies to ror1 and cd3
CN110891972B (zh) * 2017-07-05 2023-05-30 Ucl商业有限责任公司 对ror1和cd3的双特异性抗体
US11466083B2 (en) 2017-07-05 2022-10-11 Ucl Business Ltd ROR1 antibodies
WO2019016381A1 (en) * 2017-07-20 2019-01-24 Nbe-Therapeutics Ag MULTISPECIFIC ANTIBODY PRODUCT BINDING TO DIFFERENT ROR1 EPITOPES
US10758556B2 (en) 2017-08-07 2020-09-01 Nbe-Therapeutics Ag Anthracycline-based antibody drug conjugates having high in vivo tolerability
US12121527B2 (en) 2017-08-07 2024-10-22 Nbe-Therapeutics Ag Anthracycline-based antibody drug conjugates having high in vivo tolerability
JP2020533970A (ja) * 2017-08-28 2020-11-26 システィミューン, インク.Systimmune, Inc. 抗cd3抗体とその作製及び使用方法
JP7164596B2 (ja) 2017-08-28 2022-11-01 システィミューン, インク. 抗cd3抗体とその作製及び使用方法
US11440962B2 (en) 2017-09-21 2022-09-13 WuXi Biologics Ireland Limited Anti-CD3epsilon antibodies
US12486325B2 (en) 2017-09-21 2025-12-02 WuXi Biologics Ireland Limited Anti-CD3epsilon antibodies
WO2019057099A1 (en) * 2017-09-21 2019-03-28 Wuxi Biologics (Shanghai) Co., Ltd. NOVEL ANTI-CD3EPSILON ANTIBODIES
CN111108119A (zh) * 2017-09-21 2020-05-05 上海药明生物技术有限公司 新型抗CD3ε抗体
US12485298B2 (en) 2017-09-21 2025-12-02 WuXi Biologics Ireland Limited Anti-CD3epsilon antibodies
US12297270B2 (en) 2018-02-08 2025-05-13 Genentech, Inc. Bispecific antigen-binding molecules and methods of use
US11866498B2 (en) 2018-02-08 2024-01-09 Genentech, Inc. Bispecific antigen-binding molecules and methods of use
US11952424B2 (en) 2018-03-30 2024-04-09 Merus N.V. Multivalent antibody
US12084496B2 (en) 2018-04-18 2024-09-10 Exelixis, Inc. Anti-ROR antibody constructs
CN109580504A (zh) * 2018-10-19 2019-04-05 东软威特曼生物科技(南京)有限公司 一种脂蛋白胆固醇测定试剂及试剂盒
WO2020237173A1 (en) * 2019-05-23 2020-11-26 VelosBio Inc. Anti-ror1/anti-cd3 bispecific binding molecules
RU2831608C2 (ru) * 2019-05-23 2024-12-11 Велосбайо Инк. Анти-ror1/анти-cd3 биспецифические связывающие молекулы
CN113874399B (zh) * 2019-05-23 2025-07-11 维洛斯生物股份有限公司 抗ror1/抗cd3双特异性结合分子
TWI899079B (zh) * 2019-05-23 2025-10-01 美商維洛斯生物公司 抗ror1/抗cd3雙特異性結合分子
CN113874399A (zh) * 2019-05-23 2021-12-31 维洛斯生物股份有限公司 抗ror1/抗cd3双特异性结合分子
US20220227866A1 (en) * 2019-05-23 2022-07-21 VelosBio Inc. Anti-ror1 / anti-cd3 bispecific binding molecules
US12497454B2 (en) 2020-02-07 2025-12-16 VelosBio Inc. Anti-ROR1 antibodies and compositions
WO2022167460A1 (en) 2021-02-02 2022-08-11 Numab Therapeutics AG Multispecific antibodies having specificity for ror1 and cd3
US12195547B2 (en) 2021-04-30 2025-01-14 Hoffmann-La Roche Inc. Dosing for combination treatment with anti-CD20/anti-CD3 bispecific antibody and anti-CD79B antibody drug conjugate

Also Published As

Publication number Publication date
AU2015329965A1 (en) 2017-04-27
JP6708635B2 (ja) 2020-06-10
US20170306018A1 (en) 2017-10-26
CA2963692A1 (en) 2016-04-14
EP3204415A1 (en) 2017-08-16
ES2850325T3 (es) 2021-08-27
JP2018502050A (ja) 2018-01-25
US11952421B2 (en) 2024-04-09
EP3204415B1 (en) 2020-06-17

Similar Documents

Publication Publication Date Title
EP3204415B1 (en) Bispecific antibodies against cd3epsilon and ror1
US20170306044A1 (en) Bispecific antibodies against cd3epsilon and ror1 for use in the treatment of ovarian cancer
CA2955685C (en) Bispecific antibodies against cd3epsilon and bcma
US20200255521A1 (en) Bispecific antibodies against cd3epsilon and ror1
US20170327579A1 (en) Bispecific antibodies against cd3epsilon and bcma
JP2021020910A (ja) 多重特異的NKp46結合タンパク質
EP3747905A1 (en) Common light chains and methods of use
EP2953974A1 (en) Bispecific antibodies against cd3epsilon and bcma
WO2022224997A1 (ja) 抗cldn4-抗cd137二重特異性抗体
WO2024251154A9 (zh) 抗gprc5d/bcma/cd3三特异性抗体的制备及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15778294

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2963692

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017518525

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 15517296

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2015329965

Country of ref document: AU

Date of ref document: 20151008

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015778294

Country of ref document: EP