WO2015010100A2 - Humanized antibodies with ultralong complementarity determining regions - Google Patents
Humanized antibodies with ultralong complementarity determining regions Download PDFInfo
- Publication number
- WO2015010100A2 WO2015010100A2 PCT/US2014/047315 US2014047315W WO2015010100A2 WO 2015010100 A2 WO2015010100 A2 WO 2015010100A2 US 2014047315 W US2014047315 W US 2014047315W WO 2015010100 A2 WO2015010100 A2 WO 2015010100A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- amino acid
- cxcx
- variable region
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/04—Libraries containing only organic compounds
- C40B40/10—Libraries containing peptides or polypeptides, or derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/005—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies constructed by phage libraries
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/116—Togaviridae (F); Matonaviridae (F); Flaviviridae (F)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/461—Igs containing Ig-regions, -domains or -residues form different species
- C07K16/464—Igs containing CDR-residues from one specie grafted between FR-residues from another
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
- C07K2318/10—Immunoglobulin or domain(s) thereof as scaffolds for inserted non-Ig peptide sequences, e.g. for vaccination purposes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present disclosure relates to humanized antibodies, including antibodies comprising an ultralong CDR3.
- Antibodies are natural proteins that the vertebrate immune system forms in response to foreign substances (antigens), primarily for defense against infection.
- antibodies have been induced in animals under artificial conditions and harvested for use in therapy or diagnosis of disease conditions, or for biological research.
- Each individual antibody producing cell produces a single type of antibody with a chemically defined composition, however, antibodies obtained directly from animal serum in response to antigen inoculation actually comprise an ensemble of non-identical molecules (e.g., polyclonal antibodies) made from an ensemble of individual antibody producing cells.
- Some bovine antibodies have unusually long VH CDR3 sequences compared to other vertebrates. For example, about 10% of IgM contains "ultralong" CDR3 sequences, which can be up to 61 amino acids long. These unusual CDR3s often have multiple cysteines. Functional VH genes form through a process called V(D)J recombination, wherein the D-region encodes a significant proportion of CDR3. A unique D-region encoding an ultralong sequence has been identified in cattle. Ultralong CDR3s are partially encoded in the cattle genome, and provide a unique characteristic of their antibody repertoire in comparison to humans. Kaushik et al. (U.S. Patent Nos. 6,740,747 and 7, 196,185) disclose several bovine germline D-gene sequences unique to cattle stated to be useful as probes and a bovine VDJ cassette stated to be useful as a vaccine vector.
- the present disclosure provides humanized antibodies, including antibodies comprising an ultralong CDR3, methods of making same, and uses thereof.
- the present disclosure provides a humanized antibody or binding fragment thereof comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3.
- the humanized antibody or binding fragment thereof comprises one or more human variable region framework sequences.
- the ultralong CDR3 is 35 amino acids in length or longer, 40 amino acids in length or longer, 45 amino acids in length or longer, 50 amino acids in length or longer, 55 amino acids in length or longer, or 60 amino acids in length or longer.
- the ultralong CDR3 is 35 amino acids in length or longer.
- the ultralong CDR3 comprises 3 or more cysteine residues, 4 or more cysteine residues, 5 or more cysteine residues, 6 or more cysteine residues, 7 or more cysteine residues, 8 or more cysteine residues, 9 or more cysteine residues, 10 or more cysteine residues, 1 1 or more cysteine residues, or 12 or more cysteine residues.
- the ultralong CDR3 comprises 3 or more cysteine residues.
- the antibodies or binding fragments thereof comprise a cysteine motif.
- the cysteine motif is selected from the group consisting of: CXioCX 5 CX 5 CXCX 7 C (SEQ ID NO: 41 ), CXi 0 CX 6 CX 5 CXCXi 5 C (SEQ ID NO: 42), CXiiCXCX 5 C (SEQ ID NO: 43), CXnCX 5 CX 5 CXCX 7 C (SEQ ID NO: 44), CX 10 CX 6 CX 5 CXCX 13 C (SEQ ID NO: 45), CX 10 CX 5 CXCX 4 CX 8 C (SEQ ID NO: 46), CX 10 CX 6 CX 6 CXCX 7 C (SEQ ID NO: 47), CX 10 CX 4 CX 7 CXCX 8 C (SEQ ID NO: 48), CX 10 CX 4 CX 7 CXCX 7 C (SEQ ID NO: 49), CX 13 CX 8 CX 8 C (SEQ ID NO: 41 ), CXi 0 CX 6 CX 5 CXC
- the cysteine motif is selected from the group consisting of: CCX 3 CXCX 3 CX 2 CCXCX 5 CX 9 CX 5 CXC (SEQ ID NO: 96), CX 6 CX2CX 5 CX 4 CCXCX4CX 6 CXC (SEQ ID NO: 97), CX 7 CXCX 5 CX4CCCX 4 CX 6 CXC (SEQ ID NO: 98), CX 9 CX 3 CXCX 2 CXCCCX 6 CX 4 C (SEQ ID NO: 99), CX 5 CX 3 CXCX4CX4CCXioCX 2 CC (SEQ ID NO: 100), CX 5 CXCXiCXCX 3 CCX 3 CX 4 CXioC (SEQ ID NO: 101 ), CX 9 CCCX 3 CX 4 CCCX 5 CX 6 C (SEQ ID NO: 102),
- the ultralong CDR3 comprises 2 to 6 disulfide bonds.
- the ultralong CDR3 comprises SEQ ID NO: 40 or a derivative thereof.
- the ultralong CDR3 comprises amino acid residues 3-6 of any of one SEQ ID NO: 1-4.
- the ultralong CDR3 comprises a non-human DH or a derivative thereof.
- the non-human DH is SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1 , or SEQ ID NO: 12.
- the ultralong CDR3 comprises a JH sequence or a derivative thereof.
- the JH sequence comprises amino acids at positions 5-15 of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, or SEQ ID NO: 17.
- the ultralong CDR3 comprises: a sequence derived from a non-human or human VH sequence (e.g., a germline VH) or a derivative thereof; a sequence derived from a non-human DH sequence or a derivative thereof; and/or a sequence derived from a JH sequence or derivative thereof.
- a non-human or human VH sequence e.g., a germline VH
- a sequence derived from a non-human DH sequence or a derivative thereof e.g., a germline VH
- the ultralong CDR3 comprises an additional amino acid sequence comprising two to six amino acid residues or more positioned between the VH sequence and the DH sequence.
- the additional amino acid sequence is selected from the group consisting of: IR, IF, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20 or SEQ ID NO: 21 .
- the ultralong CDR3 comprises a sequence derived from or based on SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, or SEQ ID NO: 28.
- the ultralong CDR3 comprises a bovine sequence, a non-bovine sequence, an antibody sequence, or a non-antibody sequence.
- the non-antibody sequence is a synthetic sequence.
- the non-antibody sequence is a cytokine sequence, a lymphokine sequence, a chemokine sequence, a growth factor sequence, a hormone sequence, or a toxin sequence.
- the non-antibody sequence is an IL-8 sequence, an IL-21 sequence, an IL-1 sequecne, an IL-2 sequecne, an IL-4 sequecne, an IL-10 sequecne, an IL-17 sequence, an GLP-1 sequecne, an SDF-1 (alpha) sequence, a somatostatin sequence, a chlorotoxin sequence, a Pro-Txll sequence, a ziconotide sequence, an ADWX-1 sequence, an HsTxl sequence, an OSK1 sequence, a Pi2 sequence, a Hongotoxin (HgTX) sequence, a Margatoxin sequence, an Agitoxin-2 sequence, a Pi3 sequence, a Kaliotoxin sequence, an Anuroctoxin sequence, a Charybdotoxin sequence, a Tityustoxin -K- alpha sequence, a Mau
- the non-antibody sequence is any one of SEQ ID NOS: 475-481 , 599-655, 666-698, 727-733, 808-810 and 831 -835.
- the humanized antibody or binding fragment thereof comprises an antibody heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 770-779, 784-791 , 903-922 and 925-955.
- the humanized antibody or binding fragment thereof comprises a light chain variable region comprising an amino acid sequence SEQ ID NO: 780 or 807.
- the humanized antibody or binding fragment thereof comprises an antibody heavy chain variable region comprsing an amino acid sequence selected from the group consisting of SEQ ID NO: 770-779, 784-791 , 903-922 and 925-955.
- the humanized antibody or binding fragment thereof comprises a light chain variable region comprising an amino acid sequence of SEQ ID NO: 956 or 959.
- the humanized antibody or binding fragment thereof comprises a heavy chain variable region and a light chain variable region, wherein the antibody heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 770-779, 784-791 , 903-922 and 925-955, and the light chain variable region comprising the amino acid sequence of SEQ ID NO: 959.
- the antibody heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 941 , and the light chain variable region comprising the amino acid sequence of SEQ ID NO: 959.
- the humanized antibody or binding fragment thereof comprises a heavy chain variable region and a light chain variable region, wherein the antibody heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 770-779, 784-791 , 903-922 and 925-955, and wherein the light chain variable region comprising the amino acid sequence of SEQ ID NO: 956.
- the non-antibody sequence replaces at least a portion of the ultralong CDR3.
- the non-antibody sequence e.g., a non-antibody human sequence
- the CDR3 is inserted into the CDR3, including optionally, wherein a portion of CDR3 (e.g., one or more amino acids of the CDR3) or the entire CDR3 sequence (e.g., all or substantially all of the amino acids of the CDR3) is removed.
- the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q).
- X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V)
- the X 1 X 2 X 3 X 4 X 5 motif is TTVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154), SSVTQ (SEQ ID NO: 155), STVHQ (SEQ ID NO: 156), ATVRQ (SEQ ID NO: 157), TTVYQ (SEQ ID NO: 158), SPVHQ (SEQ ID NO: 159), ATVYQ (SEQ ID NO: 160), TAVYQ (SEQ ID NO: 161 ), TNVHQ (SEQ ID NO: 162), ATVHQ (SEQ ID NO: 163), STVYQ (SEQ ID NO: 164), TIVHQ (SEQ ID NO: 165), AIVYQ (SEQ ID NO: 166), TTVFQ (SEQ ID NO: 167), AAVFQ (SEQ ID NO: 168), GTVHQ (SEQ ID NO: 169), ASVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154),
- the ultralong CDR3 comprises a CX 1 X 2 X 3 X 4 X 5 motif.
- the CX 1 X 2 X 3 X 4 X 5 motif is CTTVHQ (SEQ ID NO: 185), CTSVHQ (SEQ ID NO: 186), CSSVTQ (SEQ ID NO: 187), CSTVHQ (SEQ ID NO: 188), CATVRQ (SEQ ID NO: 189), CTTVYQ (SEQ ID NO: 190), CSPVHQ (SEQ ID NO: 191 ), CATVYQ (SEQ ID NO: 192), CTAVYQ (SEQ ID NO: 193), CTNVHQ (SEQ ID NO: 194), CATV HQ (SEQ ID NO: 195), CSTVYQ (SEQ ID NO: 196), CTIVHQ (SEQ ID NO: 197), CAIVYQ (SEQ ID NO: 198), CTTVFQ (SEQ ID NO: 199), C AAVFQ (SEQ ID NO: 200), CGTVHQ (SEQ ID NO: 185), CTSVHQ (SEQ ID NO: 186), CSSVTQ (SEQ
- the ultralong CDR3 comprises a (X a X b ) z motif, wherein X a is any amino acid residue, X b is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), and wherein z is 1 - 4.
- the (X a X b ) z motif is CYTYNYEF (SEQ ID NO: 217), HYTYTYDF (SEQ ID NO: 218), HYTYTYEW (SEQ ID NO: 219), KHRYTYEW (SEQ ID NO: 220), NYIYKYSF (SEQ ID NO: 221 ), PYIYTYQF (SEQ ID NO: 222), SFTYTYEW (SEQ ID NO: 223), SYIYIYQW (SEQ ID NO: 224), SYNYTYSW (SEQ ID NO: 225), SYSYSYEY (SEQ ID NO: 226), SYTYNYDF (SEQ ID NO: 227), SYTYNYEW (SEQ ID NO: 228), SYTYNYQF (SEQ ID NO: 229), SYVWTHNF (SEQ ID NO: 230), TYKYVYEW (SEQ ID NO: 230), TYKYVYEW (SEQ ID
- the (X a X b ) z motif is YXYXYX.
- the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 X n motif, wherein is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), wherein X 5 is glutamine (Q), and wherein n is 27 - 54.
- the ultralong CDR3 comprises X n (X a X b ) z motif, wherein X a is any amino acid residue, X b is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), wherein n is 27 - 54, and wherein z is 1 - 4.
- the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 X n (X a X b ) z motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q), wherein X 1 is threonine (T), glycine (G), alan
- the X 1 X 2 X 3 X 4 X 5 motif is TTVHQ (SEQ ID NO: 153) or TSVHQ (SEQ ID NO: 154), and wherein the (X a X b ) z motif is YXYXYX.
- the ultralong CDR3 comprises: a CX 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q); a cysteine motif selected from the group consisting of: CX1 threonine (T), glycine (G), alanine (A),
- the ultralong CDR3 comprises: a CX 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q); a cysteine motif selected from the group consisting of: wherein the cyste
- the ultralong CDR3 comprises an additional sequence that is a linker.
- the linker is linked to a C-terminus, a N-terminus, or both C-terminus and N- terminus of the non-antibody sequence.
- the ultralong CDR3 is a ruminant CDR3.
- the ruminant is a cow.
- the humanized antibody or binding fragment thereof comprises a human heavy chain variable region framework sequence.
- the humanized antibody or binding fragment thereof comprises a human heavy chain germline sequence or is a derived from a human heavy chain germline sequence.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 735.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 737.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 739.
- _the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 741.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 743.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 745.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 747.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 749.
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507); (ii) any one of EAGGPDYRNGYNY (SEQ ID NO: 508), EAGGPDYRNGYN (SEQ ID NO: 509), EAGGPDYRNGY (SEQ ID NO: 510), EAGGPDYRNG (SEQ ID NO: 51 1 ), EAGGPDYRN (SEQ ID NO: 512), EAGGPDYR (SEQ ID NO: 513), EAGGPDY
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of YGPNYEEWGDYLATLDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO: 537), PNYEEWGDYLATLDV (SEQ ID NO: 538), NYEEWGDYLATLDV (SEQ ID NO: 539), YEEWGDYLATLDV (SEQ ID NO: 540), or EEWGDYLATLDV (SEQ ID NO: 541 ); (ii) any one of YDFYDGYYNYHYMDV (SEQ ID NO: 542), DFYDGYYNYHYMDV (SEQ ID NO:
- FYDGYYNYHYMDV SEQ ID NO: 5434
- YDGYYNYHYMDV SEQ ID NO: 545
- DGYYNYHYMDV SEQ ID NO: 546
- GYYNYHYMDV SEQ ID NO: 547
- YYNYHYMDV FYDGYYNYHYMDV
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507), and any one of YGPNYEEWGDYLATLDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO: 537), PNYEEWGDYLATLDV (SEQ ID NO: 538), NYEEWGDYLATLDV (SEQ ID NO: 539), YEEWGDYLATLDV (SEQ ID NO: 540), or EEWGDYLATLDV (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502)
- YDGYYNYHYMDV (SEQ ID NO: 545), DGYYNYHYMDV (SEQ ID NO: 546), GYYNYHYMDV (SEQ ID NO: 547), or YYNYHYMDV (SEQ ID NO: 548); (iii) any one of EAGGPIWHDDVKY (SEQ ID NO: 516), EAGGPIWHDDVK (SEQ ID NO: 517), EAGGPIWHDDV (SEQ ID NO: 518), EAGGPIWHDD (SEQ ID NO: 519), EAGGPIWHD (SEQ ID NO: 520), EAGGPIWH (SEQ ID NO: 521 ), EAGGPIW (SEQ ID NO: 522), or EAGGPI (SEQ ID NO: 523), and any one of YDFNDGYYNYHYMDV (SEQ ID NO: 549), DFYDGYYNYHYMDV (SEQ ID NO: 550), FYDGYYNYHYMDV
- the humanized antibody or binding fragment thereof comprises a human light chain variable region framework sequence.
- the humanized antibody or binding fragment thereof comprises a light chain variable region comprising a sequence selected from the group of: (i) SEQ ID NO: 750, (ii) SEQ ID NO: 751 , (iii) SEQ ID NO: 752, and (iv) SEQ ID NO: 753.
- the light chain variable comprises a lambda light chain variable region sequence or derived from a lambda light chain variable region sequence.
- the light chain variable region sequence comprises a human lambda light chain variable region sequence or derived from a human lambda light chain variable region sequence.
- the light chain variable region comprises a VL1 -51 germline sequence.
- the light chain variable region is derived from a VL1 -51 germline sequence.
- the VL1 -51 germline sequence comprises a CDR1 comprising Ne29Val and Asn32Gly substitution based on Kabat numbering.
- the VL1-51 germline sequence comprises a CDR2 comprising a substitution of DNN to GDT.
- the VL1-51 germline sequence comprises a CDR2 comprising a substitution of DNNKRP (SEQ ID NO: 471 ) to GDTSRA (SEQ ID NO: 472).
- the VL1 -51 germline sequence comprises a S2A, T5N, P8S, A12G, A13S, and P14L substitution based on Kabat numbering.
- the VL1 -51 germline sequence comprises a S2A, T5N, P8S, A12G, A13S, and P14L substitution based on Kabat numbering, and a CDR2 comprising a substitution of
- the humanized antibody or binding fragment thereof comprising: (a) a heavy chain variable region comprising a sequence selected from the group consisting of SEQ ID NO: 740, SEQ ID NO: 741 , SEQ ID NO:742, and SEQ ID NO: 743; and (b) a light chain variable region comprising SEQ ID NO: 750.
- the present disclosure also provides polynucleotides encoding the heavy chain variable region of the humanized antibody or binding fragment thereof disclosed herein.
- the present disclosure also provides polynucleotides encoding the light chain variable region of the humanized antibody or binding fragment thereof disclosed herein.
- the present disclosure also provides polynucleotides encoding a heavy chain variable region that comprises an ultralong CDR3, wherein the polynucleotide comprises a sequence selected from the group consisting of SEQ ID NO: 490, SEQ ID NO: 491 , SEQ ID NO: 492, SEQ ID NO: 493, SEQ ID NO: 494, SEQ ID NO: 495, SEQ ID NO: 496, and SEQ ID NO: 497.
- the present disclosure also provides vectors that comprise the polynucleotides disclosed herein.
- the present disclosure also provides host cells comprising the vectors disclosed herein.
- the present disclosure also provides a nucleic acid library comprising a plurality of polynucleotides comprising sequences coding for humanized antibodies or binding fragments thereof, wherein the antibodies or binding fragments thereof comprise a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:
- the present disclosure also provides a library of humanized antibodies or binding fragments thereof, wherein the antibodies or binding fragments thereof comprise (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3.
- the antibodies or binding fragments thereof comprise (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO
- the ultralong CDR3 is 35 amino acids in length or longer, 40 amino acids in length or longer, 45 amino acids in length or longer, 50 amino acids in length or longer, 55 amino acids in length or longer, or 60 amino acids in length or longer.
- the ultralong CDR3 is 35 amino acids in length or longer.
- the ultralong CDR3 comprises 3 or more cysteine residues, 4 or more cysteine residues, 5 or more cysteine residues, 6 or more cysteine residues, 7 or more cysteine residues, 8 or more cysteine residues, 9 or more cysteine residues, 10 or more cysteine residues, 1 1 or more cysteine residues, or 12 or more cysteine residues.
- the ultralong CDR3 comprises 3 or more cysteine residues.
- the antibodies or binding fragments thereof comprise a cysteine motif.
- the cysteine motif is selected from the group consisting of: CXioCX 5 CX 5 CXCX 7 C (SEQ ID NO: 41 ), CXi 0 CX 6 CX 5 CXCXi 5 C (SEQ ID NO: 42), CXiiCXCX 5 C (SEQ ID NO: 43), CXnCX 5 CX 5 CXCX 7 C (SEQ ID NO: 44), CX 10 CX 6 CX 5 CXCX 13 C (SEQ ID NO: 45), CX 10 CX 5 CXCX 4 CX 8 C (SEQ ID NO: 46), CX 10 CX 6 CX 6 CXCX 7 C (SEQ ID NO: 47), CX 10 CX 4 CX 7 CXCX 8 C (SEQ ID NO: 48), CX 10 CX 4 CX 7 CXCX 7 C (SEQ ID NO: 49), CX 13 CX 8 CX 8 C (SEQ ID NO: 41 ), CXi 0 CX 6 CX 5 CXC
- the cysteine motif is selected from the group consisting of: CCX 3 CXCX 3 CX 2 CCXCX 5 CX 9 CX 5 CXC (SEQ ID NO: 96), CX 6 CX2CX 5 CX 4 CCXCX4CX 6 CXC (SEQ ID NO: 97), CX 7 CXCX 5 CX4CCCX 4 CX 6 CXC (SEQ ID NO: 98), CX 9 CX 3 CXCX 2 CXCCCX 6 CX 4 C (SEQ ID NO: 99), CX 5 CX 3 CXCX4CX4CCXioCX 2 CC (SEQ ID NO: 100), CX 5 CXCXiCXCX 3 CCX 3 CX 4 CXioC (SEQ ID NO: 101 ), CX 9 CCCX 3 CX 4 CCCX 5 CX 6 C (SEQ ID NO: 102),
- the ultralong CDR3 comprises 2 to 6 disulfide bonds.
- the ultralong CDR3 comprises SEQ ID NO: 40 or a derivative thereof.
- the ultralong CDR3 comprises amino acid residues 3-6 of any of one SEQ ID NO: 1-4.
- the ultralong CDR3 comprises a non-human DH or a derivative thereof.
- the non-human DH is SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1 , or SEQ ID NO: 12.
- the ultralong CDR3 comprises a JH sequence or a derivative thereof.
- the JH sequence comprises amino acids as positions 5-15 of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, or SEQ ID NO: 17.
- the ultralong CDR3 comprises: a sequence derived from a non- human VH sequence or a derivative thereof; a sequence derived from a non-human DH sequence or a derivative thereof; and/or a sequence derived from JH sequence or derivative thereof.
- the ultralong CDR3 comprises an additional amino acid sequence comprising two to six amino acid residues or more positioned between the VH sequence and the DH sequence.
- the additional amino acid sequence is selected from the group consisting of: IR, IF, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20 or SEQ ID NO: 21.
- the ultralong CDR3 comprises a sequence derived from or based on SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, or SEQ ID NO: 28.
- the ultralong CDR3 comprises a non-bovine sequence or a non- antibody sequence.
- the non-antibody sequence e.g., a non-antibody human sequence
- the CDR3 is inserted into the CDR3, including optionally, wherein a portion of CDR3 (e.g., one or more amino acids of the CDR3) or the entire CDR3 sequence (e.g., all or substantially all of the amino acids of the CDR3) is removed.
- the non-antibody sequence is a synthetic sequence.
- the non-antibody sequence is a cytokine sequence, a lymphokine sequence, a chemokine sequence, a growth factor sequence, a hormone sequence, or a toxin sequence.
- the non-antibody sequence is an IL-8 sequence, an IL-21 sequence, an SDF-1 (alpha) sequence, a somatostatin sequence, a chlorotoxin sequence, a Pro-Txll sequence, a ziconotide sequence, an ADWX-1 sequence, an HsTxl sequence, an OSK1 sequence, a Pi2 sequence, a Hongotoxin (HgTX) sequence, a Margatoxin sequence, an Agitoxin-2 sequence, a Pi3 sequence, a Kaliotoxin sequence, an Anuroctoxin sequence, a Charybdotoxin sequence, a Tityustoxin -K- alpha sequence, a Maurotoxin sequence, a Ceratotoxin 1 (CcoTxl ) sequence, a CcoTx2 sequence, a CcoTx3 sequence, a Phrixotoxin 3 (Paur
- the non-antibody sequence is any one of SEQ ID NOS: 475-481 , 599-655, 666-698, 727-733, 808-810 and 831 -835.
- the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q).
- X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V)
- the X 1 X 2 X 3 X 4 X 5 motif is TTVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154), SSVTQ (SEQ ID NO: 155), STVHQ (SEQ ID NO: 156), ATVRQ (SEQ ID NO: 157), TTVYQ (SEQ ID NO: 158), SPVHQ (SEQ ID NO: 159), ATVYQ (SEQ ID NO: 160), TAVYQ (SEQ ID NO: 161 ), TNVHQ (SEQ ID NO: 162), ATVHQ (SEQ ID NO: 163), STVYQ (SEQ ID NO: 164), TIVHQ (SEQ ID NO: 165), AIVYQ (SEQ ID NO: 166), TTVFQ (SEQ ID NO: 167), AAVFQ (SEQ ID NO: 168), GTVHQ (SEQ ID NO: 169), ASVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154),
- the ultralong CDR3 comprises a CX 1 X 2 X 3 X 4 X 5 motif.
- the CX 1 X 2 X 3 X 4 X 5 motif is CTTVHQ (SEQ ID NO: 185), CTSVHQ (SEQ ID NO: 186), CSSVTQ (SEQ ID NO: 187), CSTVHQ (SEQ ID NO: 188), CATVRQ (SEQ ID NO: 189), CTTVYQ (SEQ ID NO: 190), CSPVHQ (SEQ ID NO: 191 ), CATVYQ (SEQ ID NO: 192), CTAVYQ (SEQ ID NO: 193), CTNVHQ (SEQ ID NO: 194), CATVHQ (SEQ ID NO: 195), CSTVYQ (SEQ ID NO: 196), CTIVHQ (SEQ ID NO: 197), CAIVYQ (SEQ ID NO: 198), CTTVFQ (SEQ ID NO: 199), C AAVFQ (SEQ ID NO: 200), CGTVHQ (SEQ ID NO: 201
- the ultralong CDR3 comprises a (X a X b ) z motif, wherein X a is any amino acid residue, X b is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), and wherein z is 1 - 4.
- the (X a X b ) z motif is CYTYNYEF (SEQ ID NO: 217), HYTYTYDF (SEQ ID NO: 218), HYTYTYEW (SEQ ID NO: 219), KHRYTYEW (SEQ ID NO: 220), NYIYKYSF (SEQ ID NO: 221 ), PYIYTYQF (SEQ ID NO: 222), SFTYTYEW (SEQ ID NO: 223), SYIYIYQW (SEQ ID NO: 224), SYNYTYSW (SEQ ID NO: 225), SYSYSYEY (SEQ ID NO: 226), SYTYNYDF (SEQ ID NO: 227), SYTYNYEW (SEQ ID NO: 228), SYTYNYQF (SEQ ID NO: 229), SYVWTHNF (SEQ ID NO: 230), TYKYVYEW (SEQ ID NO: 230), TYKYVYEW (SEQ ID
- the (X a X b ) z motif is YXYXYX.
- the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 X n motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q), and wherein n is 27 - 54.
- X 1 is threonine (T), glycine (G), alanine
- the ultralong CDR3 comprises X n (X a X b ) z motif, wherein X a is any amino acid residue, X b is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), wherein n is 27 - 54, and wherein z is 1 - 4.
- the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 X n (X a X b ) z motif, wherein X-i is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), wherein X 5 is glutamine (Q), X a
- the X 1 X 2 X 3 X 4 X 5 motif is TTVHQ (SEQ ID NO: 153) or TSVHQ (SEQ ID NO: 154), and wherein the (X a X b ) z motif is YXYXYX.
- the ultralong CDR3 comprises: a CX 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q), a cysteine motif selected from the group consisting of: CX1 0
- the ultralong CDR3 comprises: a CX 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q); a cysteine motif selected from the group consisting of: wherein the cyste
- the ultralong CDR3 comprises an additional sequence that is a linker.
- the linker is linked to a C-terminus, a N-terminus, or both C- terminus and N-terminus of the non-antibody sequence.
- the ultralong CDR3 is a ruminant CDR3.
- the ruminant is a cow.
- the humanized antibody or binding fragment thereof comprises a human heavy chain variable region framework sequence.
- the humanized antibody or binding fragment thereof comprises a human heavy chain germline sequence or is a derived from a human heavy chain germline sequence.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 735.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 737. [00133] In some embodiments of each or any of the above or below mentioned embodiments, the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 739.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 741.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 743.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 745.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 747.
- the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 749.
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507); (ii) any one of EAGGPDYRNGYNY (SEQ ID NO: 508), EAGGPDYRNGYN (SEQ ID NO: 509), EAGGPDYRNGY (SEQ ID NO: 510), EAGGPDYRNG (SEQ ID NO: 51 1 ), EAGGPDYRN (SEQ ID NO: 512), EAGGPDYR (SEQ ID NO: 513), EAGGPDY
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of YGPNYEEWGDYLATLDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO: 537), PNYEEWGDYLATLDV (SEQ ID NO: 538), NYEEWGDYLATLDV (SEQ ID NO: 539), YEEWGDYLATLDV (SEQ ID NO: 540), or EEWGDYLATLDV (SEQ ID NO: 541 ); (ii) any one of YDFYDGYYNYHYMDV (SEQ ID NO: 542), DFYDGYYNYHYMDV (SEQ ID NO: 543), FYD GYYNYHYMDV (SEQ ID NO: 544), YDGYYNYHYMDV (SEQ ID NO: 545), DGYYNYHYMDV (SEQ ID NO: 546), GYYNYHYMDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO:
- the humanized antibody or binding fragment thereof comprises a light chain variable region sequence.
- the humanized antibody or binding fragment thereof comprises a light chain variable region comprising a sequence selected from the group of: (i) SEQ ID NO: 750, (ii) SEQ ID NO: 751 , (iii) SEQ ID NO: 752, and (iv) SEQ ID NO: 753.
- the light chain variable region sequence is a lambda light chain variable region sequence.
- the light chain variable region sequence is a human lambda light chain variable region sequence.
- the light chain variable region sequence comprises a VL1-51 germline sequence.
- the light chain variable region is derived from a VL1 -51 germline sequence.
- the VL1 -51 germline sequence comprises a CDR1 comprising Ne29Val and Asn32Gly substitution based on Kabat numbering.
- the VL1-51 germline sequence comprises a CDR2 comprising a substitution of DNN to GDT.
- the VL1-51 germline sequence comprises a CDR2 comprising a substitution of DNNKRP (SEQ ID NO: 471 ) to GDTSRA (SEQ ID NO: 472).
- the VL1-51 germline sequence comprises a S2A, T5N, P8S, A12G, A13S, and P14L substitution based on Kabat numbering.
- the VL1-51 germline sequence comprises a S2A, T5N, P8S, A12G, A13S, and P14L substitution based on Kabat numbering, and a CDR2 comprising a substitution of DNN to GDT.
- the humanized antibody or binding fragment thereof comprising (a) a heavy chain variable region comprising a sequence selected from the group consisting of SEQ ID NO: 740, SEQ ID NO: 741 , SEQ ID NO:742, and SEQ ID NO: 743; and (b) a light chain variable region comprising SEQ ID NO: 750.
- the humanized antibodies or binding fragments thereof are present in a spatially addressed format.
- the present disclosure also provides a method of humanizing an antibody variable region comprising the step of genetically combining a nucleic acid sequence encoding an ultralong CDR3 with a nucleic acid sequence encoding a variable region sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO: 747, and (viii) SEQ ID NO: 748 or SEQ ID NO: 749.
- the present disclosure also provides a method of generating a library of humanized antibodies that comprises an ultralong CDR3, the method comprising: combining a nucleic acid sequence encoding an ultralong CDR3 with a nucleic acid sequence encoding a variable region sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO: 747, and (viii) SEQ ID NO: 748 or SEQ ID NO: 749, to produce nucleic acids encoding for humanized antibodies that comprises an ultralong C
- the present disclosure also provides a method of generating a library of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 and which comprises a non-antibody sequence, the method comprising: combining a nucleic acid sequence encoding an ultralong CDR3, a nucleic acid sequence encoding a variable region sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO: 747, and (viii) SEQ ID NO: 748 or SEQ ID NO: 749, and a nucleic acid
- the present disclosure also provides a library of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 which comprises a non-bovine or a non-antibody sequence.
- the non-antibody sequence e.g., a non-antibody human sequence
- the CDR3 is inserted into the CDR3, including optionally, wherein a portion of CDR3 (e.g., one or more amino acids of the CDR3) or the entire CDR3 sequence (e.g., all or substantially all of the amino acids of the CDR3) is removed.
- the present disclosure also provides a method of generating a library of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 which comprises a cysteine motif, the method comprising: combining a human variable region framework (FR) sequence, and a nucleic acid sequence encoding an ultralong CDR3 and a cysteine motif; introducing one or more nucleotide changes to the nucleic acid sequence encoding one or more amino acid residues that are positioned between one or more cysteine residues in the cysteine motif for nucleotides encoding different amino acid residues to produce nucleic acids encoding humanized antibodies or binding fragments thereof comprising an ultralong CDR3 and a cysteine motif with one or more nucleotide changes introduced between one or more cysteine residues in the cysteine domain; and expressing the nucleic acids encoding humanized antibodies or binding fragments thereof comprising an ultralong CDR3 and a cysteine motif with one or more nucleotide changes introduced between one or
- the present disclosure also provides a library of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 which comprises a cysteine motif, wherein the antibodies or binding fragments comprise one or more substitutions of amino acid residues that are positioned between cysteine residues in the cysteine motif.
- the present disclosure also provides a method of generating a library of humanized antibodies or binding fragments thereof comprising a bovine ultralong CDR3, the method comprising: combining a nucleic acid sequence encoding a human variable region framework (FR) sequence and a nucleic acid encoding a bovine ultralong CDR3, and expressing the nucleic acids encoding a human variable region framework (FR) sequence and a nucleic acid encoding a bovine ultralong CDR3 to generate a library of humanized antibodies or binding fragments thereof comprising a bovine ultralong CDR3.
- FR human variable region framework
- FR human variable region framework
- the present disclosure also provides a library of humanized antibodies or binding fragments thereof comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO: 747, and (viii) SEQ ID NO: 748 or SEQ ID NO: 749; and (b) a bovine ultralong CDR3.
- the present disclosure also provides an antibody heavy chain variable region comprising a sequence of the formula V1 -X-V2, wherein V1 comprises an amino acid sequence selected from the group consisting of: (i) QVQLREWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGEINHSGSTNY NPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYC (SEQ ID NO: 735), (ii)
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507); (ii) any one of EAGGPDYRNGYNY (SEQ ID NO: 508), EAGGPDYRNGYN (SEQ ID NO: 509), EAGGPDYRNGY (SEQ ID NO: 510), EAGGPDYRNG (SEQ ID NO: 51 1 ), EAGGPDYRN (SEQ ID NO: 512), EAGGPDYR (SEQ ID NO: 513), EAGGPDY
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of YGPNYEEWGDYLATLDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO: 537), PNYEEWGDYLATLDV (SEQ ID NO: 538), NYEEWGDYLATLDV (SEQ ID NO: 539), YEEWGDYLATLDV (SEQ ID NO: 540), or EEWGDYLATLDV (SEQ ID NO: 541 ); (ii) any one of YDFYDGYYNYHYMDV (SEQ ID NO: 542), DFYDGYYNYHYMDV (SEQ ID NO: 543), FYD GYYNYHYMDV (SEQ ID NO: 544), YDGYYNYHYMDV (SEQ ID NO: 545), DGYYNYHYMDV (SEQ ID NO: 546), GYYNYHYMDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO:
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507), and any one of YGPNYEEWGDYLATLDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO: 537), PNYEEWGDYLATLDV (SEQ ID NO: 538), NYEEWGDYLATLDV (SEQ ID NO: 539), YEEWGDYLATLDV (SEQ ID NO: 540), or EEWGDYLATLDV (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502)
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507), and an amino acid sequence of any one of YGPNYEEWGDYLATLDV
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of EAGGPDYRNGYNY (SEQ ID NO: 508), EAGGPDYRNGYN (SEQ ID NO: 509), EAGGPDYRNGY (SEQ ID NO: 510), EAGGPDYRNG (SEQ ID NO: 51 1 ), EAGGPDYRN (SEQ ID NO: 512), EAGGPDYR (SEQ ID NO: 513), EAGGPDY (SEQ ID NO: 514), or EAGGPD (SEQ ID NO: 515), and an amino acid sequence of any one of EAGGPDYRNGYNY (SEQ ID NO: 508), EAG
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of EAGGPIWHDDVKY (SEQ ID NO: 516), EAGGPIWHDDVK (SEQ ID NO: 517), EAGGPIWHDDV (SEQ ID NO: 518), EAGGPIWHDD (SEQ ID NO: 519), EAGGPIWHD (SEQ ID NO: 520), EAGGPIWH (SEQ ID NO: 521 ), EAGGPIW (SEQ ID NO: 522), or EAGGPI (SEQ ID NO: 523), and an amino acid sequence
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of GTDYTIDDQGI (SEQ ID NO: 524), GTDYTIDDQG (SEQ ID NO: 525), GTDYTIDDQ (SEQ ID NO: 526), GTDYTIDD (SEQ ID NO: 527), GTDYTID (SEQ ID NO: 528), or GTDYTI (SEQ ID NO: 529), and an amino acid sequence of any one of QGI RYQGSGTFWYFDV (SEQ ID NO: 555), GIRYQGSGTFWYFDV (SEQ ID NO: 55
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of YNLGYSYFYYMDG(SEQ ID NO: 564), NLG YSYFYYMDG (SEQ ID NO: 565), LGYSYFYYMDG (SEQ ID NO: 566), GYSYFYYYMDG (SEQ ID NO: 567), YSYFYYMDG (SEQ ID NO: 568), or SYFYYMDG (SEQ ID NO: 569), and any one of YNLGYSYFYMDG(SEQ ID NO: 564), NLG YSYFYYMDG (
- the antibody heavy chain variable region includes wherein the ultralong CDR3 is 35 amino acids in length or longer, 40 amino acids in length or longer, 45 amino acids in length or longer, 50 amino acids in length or longer, 55 amino acids in length or longer, or 60 amino acids in length or longer.
- the antibody heavy chain variable region includes wherein the ultralong CDR3 is 35 amino acids in length or longer.
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a cysteine motif.
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507), a cysteine motif, and an amino acid sequence of any one of YGP
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of EAGGPDYRNGYNY (SEQ ID NO: 508), EAGGPDYRNGYN (SEQ ID NO: 509), EAGGPDYRNGY (SEQ ID NO: 510), EAGGPDYRNG (SEQ ID NO: 51 1 ), EAGGPDYRN (SEQ ID NO: 512), EAGGPDYR (SEQ ID NO: 513), EAGGPDY (SEQ ID NO: 514), or EAGGPD (SEQ ID NO: 515), a cysteine motif, and
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of EAGGPIWHDDVKY (SEQ ID NO: 516), EAGGPIWHDDVK (SEQ ID NO: 517), EAGGPIWHDDV (SEQ ID NO: 518), EAGGPIWHDD (SEQ ID NO: 519), EAGGPIWHD (SEQ ID NO: 520), EAGGPIWH (SEQ ID NO: 521 ), EAGGPIW (SEQ ID NO: 522), or EAGGPI (SEQ ID NO: 523), a cysteine
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of GTDYTIDDQGI (SEQ ID NO: 524), GTDYTIDDQG (SEQ ID NO: 525), GTDYTIDDQ (SEQ ID NO: 526), GTDYTIDD (SEQ ID NO: 527), GTDYTID (SEQ ID NO: 528), or GTDYTI (SEQ ID NO: 529), a cysteine motif, and an amino acid sequence of any one of QGIRYQGSGTFWYFDV (SEQ ID NO: 555), GIRYQGSGTFWYFDV (SEQ ID NO: 555), GIRYQGSGTFWYFDV (S
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of YNLGYSYFYYMDG(SEQ ID NO: 564), NLGYSYFYYMDG (SEQ ID NO: 565), LGYSYFYYMDG (SEQ ID NO: 566), GYSYFYYYMDG (SEQ ID NO: 567), YSYFYYMDG (SEQ ID NO: 568), or SYFYYMDG (SEQ ID NO: 569), a cysteine motif, and an amino acid sequence of any one of YNLGYSYFYYMDG(SEQ ID NO: 564),
- the antibody heavy chain variable region includes wherein VI comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence that is SEQ ID NO: 498 and an amino acid sequence that is SEQ ID NO: 499, and wherein V2 comprises an amino acid sequence that is SEQ ID NO: 500.
- the antibody heavy chain variable region includes wherein the cysteine motif is selected from the group consisting of: CX 10 CX5CX 5 CXCX7C (SEQ ID NO: 41), CX 10 CX 6 CX 5 CXCX 15 C (SEQ ID NO: 42), CXnCXCX 5 C (SEQ ID NO: 43), CX11CX5CX5CXCX7C (SEQ ID NO: 44), CX 10 CX 6 CX 5 CXCX 13 C (SEQ ID NO: 45), CXioCX 5 CXCX4CX 8 C (SEQ ID NO: 46), CXi 0 CX 6 CX 6 CXCX 7 C (SEQ ID NO: 47), CX1 0 CX4CX7CXCX 8 C (SEQ ID NO: 48), CX1 0 CX4CX7CXCX7C (SEQ ID NO: 49), CXi
- the antibody heavy chain variable region includes wherein the cysteine motif is selected from the group consisting of: CCX 3 CXCX 3 CX 2 CCXCX 5 CX 9 CX 5 CXC (SEQ ID NO: 96), CX 6 CX 2 CX 5 CX 4 CCXCX4CX 6 CXC (SEQ ID NO: 97), CX 7 CXCX 5 CX4CCCX 4 CX 6 CXC (SEQ ID NO: 98), CX 9 CX 3 CXCX 2 CXCCCX 6 CX 4 C (SEQ ID NO: 99), CX 5 CX 3 CXCX 4 CX4CCXi 0 CX 2 CC (SEQ ID NO: 100), CX5CXCX1CXCX 3 CCX 3 CX4CX1 0 C (SEQ ID NO: 101), CX 9 CCCX 3 CX 4 CCCX 5 CX 6
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises 2 to 6 disulfide bonds.
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a non-antibody sequence.
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507), a non-antibody sequence, and an amino acid sequence of any one of Y
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of EAGGPDYRNGYNY (SEQ ID NO: 508), EAGGPDYRNGYN (SEQ ID NO: 509), EAGGPDYRNGY (SEQ ID NO: 510), EAGGPDYRNG (SEQ ID NO: 51 1 ), EAGGPDYRN (SEQ ID NO: 512), EAGGPDYR (SEQ ID NO: 513), EAGGPDY (SEQ ID NO: 514), or EAGGPD (SEQ ID NO: 515), a non-antibody sequence,
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of EAGGPIWHDDVKY (SEQ ID NO: 516), EAGGPIWHDDVK (SEQ ID NO: 517), EAGGPIWHDDV (SEQ ID NO: 518), EAGGPIWHDD (SEQ ID NO: 519), EAGGPIWHD (SEQ ID NO: 520), EAGGPIWH (SEQ ID NO: 521 ), EAGGPIW (SEQ ID NO: 522), or EAGGPI (SEQ ID NO: 523), a non-anti
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of GTDYTIDDQGI (SEQ ID NO: 524), GTDYTIDDQG (SEQ ID NO: 525), GTDYTIDDQ (SEQ ID NO: 526), GTDYTIDD (SEQ ID NO: 527), GTDYTID (SEQ ID NO: 528), or GTDYTI (SEQ ID NO: 529), a non-antibody sequence, and an amino acid sequence of any one of QGIRYQGSGTFWYFDV (SEQ ID NO: 555), GIRYQGSGTFWYFDV
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence of any one of YNLGYSYFYYMDG(SEQ ID NO: 564), NLG YSYFYYMDG (SEQ ID NO: 565), LGYSYFYYMDG (SEQ ID NO: 566), GYSYFYYYMDG (SEQ ID NO: 567), YSYFYYMDG (SEQ ID NO: 568), or SYFYYMDG (SEQ ID NO: 569), a non-antibody sequence, and an amino acid sequence of any one of V1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO:
- the antibody heavy chain variable region includes wherein VI comprises an amino acid sequence selected from the group consisting of SEQ ID NO:735, SEQ ID NO: 737, SEQ ID NO: 739, SEQ ID NO: 741 , SEQ ID NO: 743, SEQ ID NO: 745, SEQ ID NO: 747, and SEQ ID NO: 749, wherein the ultralong CDR3 comprises an amino acid sequence that is SEQ ID NO: 498 and an amino acid sequence that is SEQ ID NO: 499, and wherein V2 comprises an amino acid sequence that is SEQ ID NO: 500.
- the antibody heavy chain variable region includes wherein the non-antibody sequence is a synthetic sequence.
- the antibody heavy chain variable region includes wherein the non-antibody sequence is a cytokine sequence, a lymphokine sequence, a chemokine sequence, a growth factor sequence, a hormone sequence, or a toxin sequence.
- the antibody heavy chain variable region includes wherein the non-antibody sequence is an IL-8 sequence, an IL-21 sequence, an SDF-1 (alpha) sequence, a somatostatin sequence, a chlorotoxin sequence, a Pro-Txll sequence, a ziconotide sequence, an ADWX-1 sequence, an HsTxl sequence, an OSK1 sequence, a Pi2 sequence, a Hongotoxin (HgTX) sequence, a Margatoxin sequence, an Agitoxin-2 sequence, a Pi3 sequence, a Kaliotoxin sequence, an Anuroctoxin sequence, a Charybdotoxin sequence, a Tityustoxin -K- alpha sequence, a Maurotoxin sequence, a Ceratotoxin 1 (CcoTxl ) sequence, a CcoTx2 sequence, a CcoTx3 sequence, a Phrix
- the antibody heavy chain variable region includes wherein the non-antibody sequence is any one of SEQ ID NOS: 475-481 , 599-655, 666-698, 727-733, 808-810, and 831-835.
- the antibody heavy chain variable region includes wherein the antibody heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 770-779, 784-791 , 903-922 and 925-955. Accordingly, in some aspects, the antibody heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 941.
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a linker sequence.
- the antibody heavy chain variable region includes wherein the linker is linked to a N-terminus, a C-terminus, or both N-terminus and C-terminus of the non-antibody sequence.
- the antibody heavy chain variable region includes wherein the linker comprises one or more amino acid sequence selected from the group consisting of SEQ ID NO: 575 to 598, 699 to 726 and 813 to 830, or any combination thereof.
- the antibody heavy chain variable region includes wherein the linkers linked to both N-terminus and C-terminus have the same or different amino acid sequence.
- the present disclosure also provides antibody or binding fragment thereof comprising the antibody heavy chain variable region disclosed herein.
- the heavy chain variable region further comprises a constant heavy chain 1 (CH1 ) region.
- the heavy chain variable region further comprises an amino acid sequence of SEQ ID NO: 390.
- the antibody or binding fragment further comprises a light chain variable region.
- the light chain variable region further comprising a constant light chain (CL) region.
- the present disclosure also provides an isolated polynucleotide encoding the antibody heavy chain variable region described herein.
- the present disclosure also provides a vector comprising the polynucleotide described herein.
- the present disclosure also provides a host cell comprising the vector described herein.
- the present disclosure also provides a nucleic acid library comprising a plurality of polynucleotides comprising nucleic acid sequences encoding for an antibody heavy chain variable region comprising a sequence of the formula V1-X-V2, wherein V1 comprises an amino acid sequence selected from the group consisting of:
- the present disclosure also provides a library of antibodies comprising antibody heavy chain variable regions comprising a sequence of the formula V1-X-V2, wherein V1 comprises an amino acid sequence selected from the group consisting of: (i) QVQLREWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWI GEINHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYC (SEQ ID NO: 735), (ii) QVQLREWGAGLLKPSETLSLTCAVYGGSFSDKYWSWIRQPPGKGLEWIGEINHSGST NYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYC (SEQ ID NO: 737), (iii) QVQLREWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKGLEWIGSINHSGSTNY NPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYC
- the antibody heavy chain variable region of claim 142 wherein the ultralong CDR3 comprises a X1X2X 3 X4X5 motif, wherein X-i is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q).
- X-i is threonine (T), glycine (G), alanine (A), se
- the antibody heavy chain variable region includes wherein the X1X2X 3 X4X5 motif is TTVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154), SSVTQ (SEQ ID NO: 155), STVHQ (SEQ ID NO: 156), ATVRQ (SEQ ID NO: 157), TTVYQ (SEQ ID NO: 158), SPVHQ (SEQ ID NO: 159), ATVYQ (SEQ ID NO: 160), TAVYQ (SEQ ID NO: 161 ), TNVHQ (SEQ ID NO: 162), ATVHQ (SEQ ID NO: 163), STVYQ (SEQ ID NO: 164), TIVHQ (SEQ ID NO: 165), AIVYQ (SEQ ID NO: 166), TTVFQ (SEQ ID NO: 167), AAVFQ (SEQ ID NO: 168), GTVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154), SSVTQ (S
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a (X a X b ) z motif, wherein X a is any amino acid residue, X b is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), and wherein z is 1 - 4.
- the antibody heavy chain variable region includes wherein the (X a X b ) z motif is CYTYNYEF (SEQ ID NO: 217), HYTYTYDF (SEQ ID NO: 218), HYTYTYEW (SEQ ID NO: 219), KHRYTYEW (SEQ ID NO: 220), NYIYKYSF (SEQ ID NO: 221 ), PYIYTYQF (SEQ ID NO: 222), SFTYTYEW (SEQ ID NO: 223), SYIYIYQW (SEQ ID NO: 224), SYNYTYSW (SEQ ID NO: 225), SYSYSYEY (SEQ ID NO: 226), SYTYNYDF (SEQ ID NO: 227), SYTYNYEW (SEQ ID NO: 228), SYTYNYQF (SEQ ID NO: 229), SYVWTHNF (SEQ ID NO: 230
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 X n motif, wherein X-i is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), wherein X 5 is glutamine (Q), and wherein n is 27
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises X n (X a X b ) z motif, wherein X a is any amino acid residue, X b is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), wherein n is 27 - 54, and wherein z is 1 - 4.
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 X n (X a X b ) z motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is histidine (H), threonine (T), arginine (R
- the present disclosure also provides an antibody heavy chain variable region comprising a sequence of the formula V1-X, wherein V1 comprises an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and wherein X comprises an ultralong CDR3, wherein X comprises an ultralong CDR3, which can include a non-human sequence or a non-antibody sequence (e.g., a non-antibody sequence (e
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 motif, wherein X1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X5 is glutamine (Q).
- X1 is threonine (T), glycine (G), alanine (A), serine (
- the antibody heavy chain variable region includes wherein the X1 X2X3X4X5 motif is TTVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154), SSVTQ (SEQ ID NO: 155), STVHQ (SEQ ID NO: 156), ATVRQ (SEQ ID NO: 157), TTVYQ (SEQ ID NO: 158), SPVHQ (SEQ ID NO: 159), ATVYQ (SEQ ID NO: 160), TAVYQ (SEQ ID NO: 161 ), TNVHQ (SEQ ID NO: 162), ATVHQ (SEQ ID NO: 163), STVYQ (SEQ ID NO: 164), TIVHQ (SEQ ID NO: 165), AIVYQ (SEQ ID NO: 166), TTVFQ (SEQ ID NO: 167), AAVFQ (SEQ ID NO: 168), GTVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154), SSVTQ (S
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a CX1 X2X3X4X5 motif.
- the antibody heavy chain variable region includes wherein the CX1 X2X3X4X5 motif is CTTVHQ (SEQ ID NO: 185), CTSVHQ (SEQ ID NO: 186), CSSVTQ (SEQ ID NO: 187), CSTVHQ (SEQ ID NO: 188), CATVRQ (SEQ ID NO: 189), CTTVYQ (SEQ ID NO: 190), CSPVHQ (SEQ ID NO: 191 ), CATVYQ (SEQ ID NO: 192), CTAVYQ (SEQ ID NO: 193), CTNVHQ (SEQ ID NO: 194), CATV HQ (SEQ ID NO: 195), CSTVYQ (SEQ ID NO: 196), CTIVHQ (SEQ ID NO: 197), CAIVYQ (SEQ ID NO: 198), CTTVFQ (SEQ ID NO: 199), C AAVFQ (SEQ ID NO: 200), CGTVHQ (SEQ ID NO: 185), CTSVHQ (SEQ ID NO: 186),
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a (XaXb)z motif, wherein Xa is any amino acid residue, Xb is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), and wherein z is 1 - 4.
- the antibody heavy chain variable region includes wherein the (XaXb)z motif is CYTYNYEF (SEQ ID NO: 217), HYTYTYDF (SEQ ID NO: 218), HYTYTYEW (SEQ ID NO: 219), KHRYTYEW (SEQ ID NO: 220), NYIYKYSF (SEQ ID NO: 221 ), PYIYTYQF (SEQ ID NO: 222), SFTYTYEW (SEQ ID NO: 223), SYIYIYQW (SEQ ID NO: 224), SYNYTYSW (SEQ ID NO: 225), SYSYSYEY (SEQ ID NO: 226), SYTYNYDF (SEQ ID NO: 227), SYTYNYEW (SEQ ID NO: 228), SYTYNYQF (SEQ ID NO: 229), SYVWTHNF (SEQ ID NO: 230), TYKY
- the antibody heavy chain variable region includes wherein the (XaXb)z motif is YXYXYX.
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a X1 X2X3X4X5Xn motif, wherein X1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), wherein X5 is glutamine (Q), and wherein n is 27 - 54.
- X1 is threonine (T), glycine (G),
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises Xn(XaXb)z motif, wherein Xa is any amino acid residue, Xb is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), wherein n is 27 - 54, and wherein z is 1 - 4.
- the antibody heavy chain variable region includes wherein the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 X n (X a X b ) z motif, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5
- V1 comprises an amino acid sequence of SEQ ID NO: 737
- the ultralong CDR3 comprises an amino acid sequence of SEQ ID NO: 498 and SEQ ID NO: 499
- V2 comprises an amino acid sequence of SEQ ID NO: 500.
- the antibody heavy chain variable region includes wherein V1 comprises an amino acid sequence of SEQ ID NO: 739, wherein the ultralong CDR3 comprises an amino acid sequence of SEQ ID NO: 498 and SEQ ID NO: 499, and wherein
- V2 comprises an amino acid sequence of SEQ ID NO: 500.
- the humanized antibody or binding fragment thereof includes wherein the light chain variable region comprises an amino acid sequence of SEQ ID NO:
- the humanized antibody or binding fragment thereof includes an amino acid sequence of SEQ ID NO: 756. [00231] In some embodiments of each or any of the above or below mentioned embodiments, the humanized antibody or binding fragment thereof includes wherein the light chain variable region comprises an amino acid sequence of SEQ ID NO:
- the humanized antibody or binding fragment thereof includes further comprising an amino acid sequence of SEQ ID NO: 756.
- the humanized antibody or binding fragment thereof includes wherein the light chain variable region comprises an amino acid sequence of SEQ ID NO:
- the humanized antibody or binding fragment thereof includes further comprising an amino acid sequence of SEQ ID NO: 756.
- the humanized antibody or binding fragment thereof includes wherein the light chain variable region comprises an amino acid sequence of SEQ ID NO: 753, an amino acid sequence of SEQ ID NO: 754, and an amino acid sequence of SEQ ID NO: 755.
- the humanized antibody or binding fragment thereof includes further comprising an amino acid sequence of SEQ ID NO: 756.
- the humanized antibody or binding fragment thereof includes wherein the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 737 and SEQ ID NO: 500, wherein the ultralong CDR3 comprises an amino acid sequence of SEQ ID NO: 498 and SEQ ID NO: 499.
- the humanized antibody or binding fragment thereof includes further comprising a light chain variable region comprising an amino acid sequence of SEQ ID NO: 750, an amino acid sequence of SEQ ID NO: 754, and an amino acid sequence of SEQ ID NO: 755.
- the humanized antibody or binding fragment thereof includes wherein the heavy chain variable region comprises an amino acid sequence of SEQ ID NO: 739 and SEQ ID NO: 500, wherein the ultralong CDR3 comprises an amino acid sequence of SEQ ID NO: 498 and SEQ ID NO: 499.
- the humanized antibody or binding fragment thereof includes further comprising a light chain variable region comprising an amino acid sequence of SEQ ID NO: 750, an amino acid sequence of SEQ ID NO: 754, and an amino acid sequence of SEQ ID NO: 755.
- Figure 1 shows a sequence alignment of exemplary bovine-derived antibody variable region sequences designated BLV1 H12, BLV5B8, BLV5D3, BLV8C1 1 , BF4E9, BF1 H1 , or F18 that comprise an ultralong CDR3 sequence.
- FIG. 2A-C depicts ultralong CDR3 sequences.
- the 5 full length ultralong CDR H3s reported in the literature contain between four and eight cysteines and are not highly homologous to one another; however, some conservation of cysteine residues with D H 2 could be found when the first cysteine of these CDR H3s was "fixed" prior to alignment.
- Four of the seven sequences (BLV1 H12, BLV5D3, BLV8C1 1 , and BF4E9) contain four cysteines in the same positions as D H 2, but also have additional cysteines.
- BLV5B8 has two cysteines in common with the germline D H 2.
- B-L1 and B-L2 are from initial sequences from bovine spleen, and the remaining are selected ultralong CDR H3 sequences from deep sequencing data.
- the first group contains the longest CDR H3s identified, and appear clonally related.
- the * indicates a sequence represented 167 times, suggesting it was strongly selected for function.
- Several of the eight-cysteine sequences appear selected for function as they were represented multiple times, indicated in parentheses. Other representative sequences of various lengths are indicated in the last group.
- the framework cysteine and tryptophan residues that define the CDR H3 boundaries are double-underlined.
- sequences BLV1 H12 through UL-77 (left-most column) presented in Tables 2A-C are depicted broken apart into four segments to identify the segments of amino acid residues that are derived from certain germline sequences and V/D/J joining sequences.
- the first segment is derived from the V H germline and is represented in the disclosure as a X 1 X 2 X 3 X 4 X 5 motif.
- the second segment represents sequences from V-D joining and is represented in the disclosure as X n .
- the third segment is a string of amino acid residues derived from D H 2 germline
- the fourth segment is a string of amino acid residues derived from J H 1 germline region.
- Figure 3 depicts a sequence alignment of exemplary bovine-derived ultralong CDR3 sequences designated BLV1 H12, BLV5B8, BLV5D3, BLV8C1 1 , BF4E9, BF1 H1 , or F18.
- Figure 4 shows an exemplary bovine germline heavy chain variable region (V H ) sequence designated VH-UL suitable for modification or use with an ultralong CDR3 sequence.
- Figure 5A-B shows exemplary human germline heavy chain variable region sequences designated 4-39, 4-59 * 03, 4-34 * 09, and 4-34 * 02 that are suitable for modification or use with an ultralong CDR3 sequence (A) and an alignment of these sequences (B).
- Figure 6 shows an exemplary bovine light chain variable region sequence designated BLV1 H12 suitable for modification or use with an ultralong CDR 3 sequence (e.g., a heavy chain variable region sequence comprising an ultralong CDR3 sequence).
- Figure 7A-B shows exemplary light chain variable region sequences designated VI1 -47, VI1 -40 * 1 , VI1-51 * 01 , and VI2-18 * 02 that are suitable for modification or use with an ultralong CDR 3 sequence (A) and an alignment of these sequences (B).
- Figure 8 shows exemplary heavy chain variable region sequences.
- Figure 9 shows exemplary light chain variable region sequences.
- Figure 10 shows exemplary heavy chain variable region sequences having IL-8 non-antibody sequences.
- Figure 1 1 shows exemplary light chain variable and constant region sequences.
- Figure 12 shows exemplary amino acids sequences.
- Figure 13 shows exemplary nucleic acid Linker-Bsal-Linker sequences introduced into BLV1 H12 sequences.
- Figure 14 shows exemplary BLV1 H12 heavy chain amino acid sequences with toxin sequences inserted at CDR3 with a variety of linkers.
- Figure 15 shows exemplary amino acids sequences of heavy variable regions and light chains (VL-CL).
- Figure 16 shows exemplary linker amino acid sequences.
- Figure 17 shows exemplary amino acid sequences for toxins.
- Figure 18 shows exemplary nucleic acid sequences for toxins.
- Figure 19 shows exemplary A regions, D regions and V2 regions of variable heavy chains from HIV-1 neutralizing antibodies.
- Figure 20 shows exemplary sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) of antibody samples (VH4-34 MutE 1 xG4S ShK (BI D# 56) and VH4-34 MutE NoLinker ShK (BI D# 59)) purified from CHO (e.g., CHO-S) and HEK (e.g., 293F) cells.
- SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
- Figure 21 shows exemplary amino acid and nucleic acid sequences for heavy chain variable regions described and referenced herein by BI D number, IgG Name and/or Heavy Chain Name.
- Figure 22 shows_shows exemplary amino acid and nucleic acid sequences for light chain variable regions described and referenced herein by BID number, IgG Name and/or Light Chain Name.
- the present disclosure provides humanized antibodies comprising heavy chain variable regions comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ I D NO: 735, (ii) SEQ ID NO: 736 or SEQ I D NO: 737, (iii) SEQ ID NO: 738 or SEQ I D NO: 739, (iv) SEQ I D NO: 740 or SEQ I D NO: 741 , (v) SEQ I D NO: 742 or SEQ ID NO: 743, (vi) SEQ I D NO: 744 or SEQ ID NO: 745, (vii) SEQ I D NO: 746 or SEQ I D NO 747, and (viii) SEQ ID NO: 748 or SEQ I D NO:749; and (b) an ultralong CDR3 sequence, along with materials for (e.g., protein sequences, genetic sequences, cells, libraries) and methods of making the antibodies (e.g., humanizing methods, library methods
- the present disclosure also provides humanized antibodies comprising heavy chain variable regions comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ I D NO: 734 or SEQ I D NO: 735, (ii) SEQ I D NO: 736 or SEQ I D NO: 737, (iii) SEQ I D NO: 738 or SEQ I D NO: 739, (iv) SEQ I D NO: 740 or SEQ I D NO: 741 , (v) SEQ I D NO: 742 or SEQ I D NO: 743, (vi) SEQ I D NO: 744 or SEQ ID NO: 745, (vii) SEQ I D NO: 746 or SEQ ID NO 747, and (viii) SEQ I D NO: 748 or SEQ I D NO:749; and (b) an ultralong CDR3 sequence, wherein the CDR3 sequences are 35 amino acids in length or longer (e.g., 40 or longer, 45 or longer, 50 or longer,
- Such antibodies bind (e.g., specifically or selectively bind) a variety of targets, including, for example protein targets such as transmembrane proteins (e.g., GPCRs, ion channels, transporter, cell surface receptors).
- protein targets such as transmembrane proteins (e.g., GPCRs, ion channels, transporter, cell surface receptors).
- the present disclosure also provides methods and materials for the preparation or making of humanized antibodies comprising heavy chain variable regions comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ I D NO: 734 or SEQ I D NO: 735, (ii) SEQ ID NO: 736 or SEQ I D NO: 737, (iii) SEQ I D NO: 738 or SEQ I D NO: 739, (iv) SEQ I D NO: 740 or SEQ I D NO: 741 , (v) SEQ I D NO: 742 or SEQ I D NO: 743, (vi) SEQ I D NO: 744 or SEQ I D NO: 745, (vii) SEQ I D NO: 746 or SEQ ID NO 747, and (viii) SEQ I D NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3 sequence.
- Such materials include proteins, genetic sequences, cells and libraries.
- Such methods include methods of humanization and method of making and screening
- the present disclosure provides a humanized antibody or binding fragment thereof comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ I D NO: 734 or SEQ I D NO: 735, (ii) SEQ I D NO: 736 or SEQ I D NO: 737, (iii) SEQ I D NO: 738 or SEQ ID NO: 739, (iv) SEQ I D NO: 740 or SEQ I D NO: 741 , (v) SEQ I D NO: 742 or SEQ I D NO: 743, (vi) SEQ I D NO: 744 or SEQ I D NO: 745, (vii) SEQ I D NO: 746 or SEQ I D NO 747, and (viii) SEQ I D NO: 748 or SEQ I D NO:749; and (b) an ultralong CDR3.
- the ultralong CDR3 may be 35 amino acids in length or longer, 40 amino acids in length or longer, 45 amino acids in length or longer, 50 amino acids in length or longer, 55 amino acids in length or longer, or 60 amino acids in length or longer.
- the ultralong CDR3 may comprise 3 or more cysteine residues, 4 or more cysteine residues, 5 or more cysteine residues, 6 or more cysteine residues, 7 or more cysteine residues, 8 or more cysteine residues, 9 or more cysteine residues, 10 or more cysteine residues, 1 1 or more cysteine residues, or 12 or more cysteine residues.
- the ultralong CDR3 may comprise a cysteine motif including, for example, where the cysteine motif is selected from the group consisting of: CX 10 CX 5 CX 5 CXCX 7 C (SEQ I D NO: 41 ), CX 10 CX 6 CX 5 CXCX 15 C (SEQ ID NO: 42), CXn CXCX 5 C (SEQ ID NO: 43), CXnCX 5 CX 5 CXCX 7 C (SEQ ID NO: 44), CX 10 CX 6 CX 5 CXCX 13 C (SEQ ID NO: 45), CX 10 CX 5 CXCX 4 CX 8 C (SEQ ID NO: 46), CX 10 CX 6 CX 6 CXCX 7 C (SEQ ID NO: 47), CX 10 CX 4 CX 7 CXCX 8 C (SEQ ID NO: 48), CXioCX 4 CX 7 CXCX 7 C (SEQ ID NO: 49), CXi 3 CX 8 CX 8 C (SEQ ID NO
- the ultralong CDR3 may comprise a cysteine motif including, for example, where the cysteine motif is selected from the group consisting of: CCX 3 CXCX 3 CX 2 CCXCX 5 CX 9 CX 5 CXC (SEQ ID NO: 96), CXeCXzCXsCX ⁇ CXCX ⁇ XeCXC (SEQ ID NO: 97), ⁇ 7 ⁇ 5 ⁇ 4 ⁇ 4 ⁇ 6 ⁇ (SEQ ID NO: 98), CX 9 CX 3 CXCX 2 CXCCCX 6 CX 4 C (SEQ ID NO: 99), 0X 5 0X 3 0x0X 4 0X 4 00X 10 0X 2 00 (SEQ ID NO: 100), CX 5 CXCX 1 CXCX 3 CCX 3 CX 4 CX 10 C (SEQ ID NO: 101 ), CX 9 CCCX 3 CX 4 CCCX 5 CX 6 C (SEQ ID NO: 102),
- the present disclosure provides a humanized antibody or binding fragment thereof comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3, wherein the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T),
- the X 1 X 2 X 3 X 4 X 5 motif may be TTVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154), SSVTQ (SEQ ID NO: 155), STVHQ (SEQ ID NO: 156), ATVRQ (SEQ ID NO: 157), TTVYQ (SEQ ID NO: 158), SPVHQ (SEQ ID NO: 159), ATVYQ (SEQ ID NO: 160), TAVYQ (SEQ ID NO: 161 ), TNVHQ (SEQ ID NO: 162), ATVHQ (SEQ ID NO: 163), STVYQ (SEQ ID NO: 164), TIVHQ (SEQ ID NO: 165), AIVYQ (SEQ ID NO: 166), TTVFQ (SEQ ID NO: 167), AAVFQ (SEQ ID NO: 168), GTVHQ (SEQ ID NO: 169), ASVHQ (SEQ ID NO: 170), TAVFQ (SEQ ID NO:
- the present disclosure provides a humanized antibody or binding fragment thereof comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3, wherein the ultralong CDR3 comprises a (X a X b ) z motif, wherein X a is any amino acid residue, X b is an amino acid sequence,
- the (X a X b ) z motif may be CYTYNYEF (SEQ ID NO: 217), HYTYTYDF (SEQ ID NO: 218), HYTYTYEW (SEQ ID NO: 219), KHRYTYEW (SEQ ID NO: 220), NYIYKYSF (SEQ ID NO: 221 ), PYIYTYQF (SEQ ID NO: 222), SFTYTYEW (SEQ ID NO: 223), SYIYIYQW (SEQ ID NO: 224), SYNYTYSW (SEQ ID NO: 225), SYSYSYEY (SEQ ID NO: 226), SYTYNYDF (SEQ ID NO: 227), SYTYNYEW (SEQ ID NO: 228), SYTYNYQF (SEQ ID NO: 229), SYVWTHNF (SEQ ID NO: 230), TYKYVYEW (SEQ ID NO: 231 ), TYTYTYEF (SEQ ID NO
- the present disclosure provides a humanized antibody or binding fragment thereof comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3, wherein the ultralong CDR3 comprises a X 1 X 2 X 3 X 4 X 5 X n (X a X b ) z motif,
- the present disclosure provides a humanized antibody or binding fragment thereof comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3, wherein the ultralong CDR3 comprises: a CX 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T),
- the present disclosure provides a humanized antibody or binding fragment thereof comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3, wherein the ultralong CDR3 comprises: a CX 1 X 2 X 3 X 4 X 5 motif, wherein X 1 is threonine (T),
- the present disclosure also provides methods of generating a library of humanized antibodies that comprises an ultralong CDR3, comprising: combining a nucleic acid sequence encoding an ultralong CDR3 with a nucleic acid sequence encoding a human variable region framework (FR) sequence to produce nucleic acids encoding for humanized antibodies that comprises an ultralong CDR3; and expressing the nucleic acids encoding for humanized antibodies that comprises an ultralong CDR3 to generate a library of humanized antibodies that comprises an ultralong CDR3.
- FR human variable region framework
- the present disclosure also provides methods of generating a library of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 that comprises a non-antibody sequence, comprising: combining a nucleic acid sequence encoding an ultralong CDR3, a nucleic acid sequence encoding a human variable region framework (FR) sequence, and a nucleic acid sequence encoding a non-antibody sequence to produce nucleic acids encoding humanized antibodies or binding fragments thereof comprising an ultralong CDR3 and a non-antibody sequence, and expressing the nucleic acids encoding humanized antibodies or binding fragments thereof comprising an ultralong CDR3 and a non-antibody sequence to generate a library of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 and a non-antibody sequence.
- FR human variable region framework
- the present disclosure also provides libraries of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 that comprises a non-antibody sequence.
- the present disclosure also provides methods of generating a library of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 that comprises a cysteine motif, comprising: combining a human variable region framework (FR) sequence, and a nucleic acid sequence encoding an ultralong CDR3 and a cysteine motif; introducing one or more nucleotide changes to the nucleic acid sequence encoding one or more amino acid residues that are positioned between one or more cysteine residues in the cysteine motif for nucleotides encoding different amino acid residues to produce nucleic acids encoding humanized antibodies or binding fragments thereof comprising an ultralong CDR3 and a cysteine motif with one or more nucleotide changes introduced between one or more cysteine residues in the cysteine domain; and expressing the nucleic acids encoding humanized antibodies or binding fragments thereof comprising an ultralong CDR3 and a cysteine motif with one or more nucleotide changes introduced between one or more cysteine domain; and
- the present disclosure also provides libraries of humanized antibodies or binding fragments thereof comprising an ultralong CDR3 that comprises a cysteine motif, wherein the antibodies or binding fragments comprise one or more substitutions of amino acid residues that are positioned between cysteine residues in the cysteine motif.
- the present disclosure also provides methods of generating a library of humanized antibodies or binding fragments thereof comprising a bovine ultralong CDR3, comprising: combining a nucleic acid sequence encoding a human variable region framework (FR) sequence and a nucleic acid encoding a bovine ultralong CDR3, and expressing the nucleic acids encoding a human variable region framework (FR) sequence and a nucleic acid encoding a bovine ultralong CDR3 to generate a library of humanized antibodies or binding fragments thereof comprising a bovine ultralong CDR3.
- FR human variable region framework
- FR human variable region framework
- the present disclosure provides humanized antibodies comprising heavy chain variable regions comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3 sequence.
- the present disclosure provides a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more (e.g., 40 or more, 45 or more, 50 or more, 55 or more, 60 or more).
- a humanized antibody may comprise at least 3 cysteine residues or more (e.g., 4 or more, 6 or more, 8 or more) within the ultralong CDR3.
- the present disclosure provides a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and is derived from or based on a non-human sequence.
- the ultralong CDR3 sequence may be derived from any species that naturally produces ultralong CDR3 antibodies, including ruminants such as cattle (Bos taurus).
- the present disclosure provides a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and is derived from a non-antibody sequence.
- the non-antibody sequence may be derived from any protein family including, but not limited to, chemokines, growth factors, peptides, cytokines, cell surface proteins, serum proteins, toxins, extracellular matrix proteins, clotting factors, secreted proteins, etc.
- the non-antibody sequence may be of human or non-human origin and may comprise a portion of a non-antibody protein such as a peptide or domain.
- the non-antibody sequence of an ultralong CDR3 may contain mutations from its natural sequence, including amino acid changes (e.g., substitutions), insertions or deletions. Engineering additional amino acids at the junction between the non-antibody sequence may be done to facilitate or enhance proper folding of the non- antibody sequence within the humanized antibody.
- the present disclosure provides a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and comprises at least 3 cysteine residues or more, including, for example, 4 or more, 6 or more, and 8 or more.
- the present disclosure provides for a humanized antibody comprising an ultralong CDR3 wherein the CDR3 is 35 amino acids in length or more and comprises at least 3 cysteine residues or more and wherein the ultralong CDR3 is a component of a multispecific antibody.
- the multispecific antibody may be bispecific or comprise greater valencies.
- the present disclosure provides a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and comprises at least 3 cysteine residues or more, wherein the partially human ultralong CDR3 is a component of an immunoconjugate.
- the present disclosure provides a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and comprises at least 3 cysteine residues or more, wherein the humanized antibody comprising an ultralong CDR3 binds to a transmembrane protein target.
- transmembrane targets may include, but are not limited to, GPCRs, ion channels, transporters, and cell surface receptors.
- the present disclosure provides genetic sequences (e.g., genes, nucleic acids, polynucleotides) encoding humanized antibodies comprising a heavy chain variable region comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3 sequence.
- an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734
- the present disclosure also provides genetic sequences (e.g., genes, nucleic acids, polynucleotides) encoding an ultralong CDR3.
- genetic sequences e.g., genes, nucleic acids, polynucleotides
- the present disclosure provides genetic sequences encoding a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more (e.g., 40 or more, 45 or more, 50 or more, 55 or more, 60 or more).
- a humanized antibody may comprise at least 3 cysteine residues or more (e.g., 4 or more, 6 or more, 8 or more) within the ultralong CDR3.
- the present disclosure provides genetic sequences encoding a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and is derived from or based on a non-human sequence.
- the genetic sequences encoding the ultralong CDR3 may be derived from any species that naturally produces ultralong CDR3 antibodies, including ruminants such as cattle (Bos taurus).
- the present disclosure provides genetic sequences encoding a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and is derived from a non-antibody protein sequence.
- the genetic sequences encoding the non-antibody protein sequences may be derived from any protein family including, but not limited to, chemokines, growth factors, peptides, cytokines, cell surface proteins, serum proteins, toxins, extracellular matrix proteins, clotting factors, secreted proteins, etc.
- the non-antibody protein sequence may be of human or non-human origin and may comprise a portion of a non-antibody protein such as a peptide or domain.
- the non-antibody protein sequence of an ultralong CDR3 may contain mutations from its natural sequence, including amino acid changes (e.g., substitutions), insertions or deletions. Engineering additional amino acids at the junction between the non-antibody sequence may be done to facilitate or enhance proper folding of the non-antibody sequence within the humanized antibody.
- the present disclosure provides genetic sequences encoding a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and comprises at least 3 cysteine residues or more, including, for example, 4 or more, 6 or more, and 8 or more.
- the present disclosure provides genetic sequences encoding a humanized antibody comprising an ultralong CDR3 wherein the CDR3 is 35 amino acids in length or more and comprises at least 3 cysteine residues or more and wherein the ultralong CDR3 is a component of a multispecific antibody.
- the multispecific antibody may be bispecific or comprise greater valencies.
- the present disclosure provides genetic sequences encoding a humanized antibody comprising an ultralong CDR3, wherein the CDR3 is 35 amino acids in length or more and comprises at least 3 cysteine residues or more, wherein the ultralong CDR3 is a component of an immunoconjugate.
- the present disclosure provides genetic sequences encoding a humanized antibody comprising an ultralong CDR3 wherein the CDR3 is 35 amino acids in length or more and comprises at least 3 cysteine residues or more and wherein the humanized antibody comprising an ultralong CDR3 binds to a transmembrane protein target.
- transmembrane targets may include, but are not limited to, GPCRs, ion channels, transporters, and cell surface receptors.
- the present disclosure provides collections, libraries, and arrays of humanized antibodies comprising ultralong CDR3 sequences.
- the present disclosure provides a library or an array of humanized antibodies comprising ultralong CDR3 sequences wherein at least two members of the library or array differ in the positions of at least one of the cysteines in the ultralong CDR3 sequence.
- Structural diversity may be enhanced through different numbers of cysteines in the ultralong CDR3 sequence (e.g., at least 3 or more cysteine residues such as 4 or more, 6 or more and 8 or more) and/or through different disulfide bond formation, and hence different loop structures.
- the present disclosure provides for a library or an array of humanized antibodies comprising ultralong CDR3 sequences wherein at least two members of the library or the array differ in at least one amino acid located between cysteines in the ultralong CDR3.
- members of the library or the array can contain cysteines in the same positions of CDR3, resulting in similar overall structural folds, but with fine differences brought about through different amino acid side chains.
- Such libraries or arrays may be useful for affinity maturation.
- the present disclosure provides libraries or arrays of humanized antibodies comprising ultralong CDR3 sequences wherein at least two of the ultralong CDR3 sequences differ in length (e.g., 35 amino acids in length or more such as 40 or more, 45 or more, 50 or more, 55 or more and 60 or more).
- the amino acid and cysteine content may or may not be altered between the members of the library or the array.
- Different lengths of ultralong CDR3 sequences may provide for unique binding sites, including, for example, due to steric differences, as a result of altered length.
- the present disclosure provides libraries or arrays of humanized antibodies comprising ultralong CDR3 sequences wherein at least two members of the library differ in the human framework used to construct the humanized antibody comprising an ultralong CDR3.
- the present disclosure provides libraries or arrays of humanized antibodies comprising ultralong CDR3 sequences wherein at least two members of the library or the array differ in having a non-antibody protein sequence that comprises a portion of the ultralong CDR3.
- Such libraries or arrays may contain multiple non-antibody protein sequences, including for chemokines, growth factors, peptides, cytokines, cell surface proteins, serum proteins, toxins, extracellular matrix proteins, clotting factors, secreted proteins, viral or bacterial proteins, etc.
- the non-antibody protein sequence may be of human or non-human origin and may be comprised of a portion of a non-antibody protein such as a peptide or domain.
- the non-antibody protein sequence of the ultralong CDR3 may contain mutations from its natural sequence, including amino acid changes (e.g., substitutions), or insertions or deletions. Engineering additional amino acids at the junction between the non-antibody sequence within the ultralong CDR3 may be done to facilitate or enhance proper folding of the non-antibody sequence within the humanized antibody.
- the libraries or the arrays of the present disclosure may be in several formats well known in the art.
- the library or the array may be an addressable library or an addressable array.
- the library or array may be in display format, for example, the antibody sequences may be expressed on phage, ribosomes, mRNA, yeast, or mammalian cells.
- the present disclosure provides cells comprising genetic sequences encoding humanized antibodies comprising heavy chain variable regions comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 734 or SEQ ID NO: 735, (ii) SEQ ID NO: 736 or SEQ ID NO: 737, (iii) SEQ ID NO: 738 or SEQ ID NO: 739, (iv) SEQ ID NO: 740 or SEQ ID NO: 741 , (v) SEQ ID NO: 742 or SEQ ID NO: 743, (vi) SEQ ID NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3 sequence.
- the present disclosure provides cells expressing a humanized antibody comprising an ultralong CDR3.
- the cells may be prokaryotic or eukaryotic, and a humanized antibody comprising an ultralong CDR3 may be expressed on the cell surface or secreted into the media.
- a humanized antibody preferentially contains a motif for insertion into the plasmid membrane such as a membrane spanning domain at the C-terminus or a lipid attachment site.
- a humanized antibody comprising an ultralong CDR3 may be secreted into the periplasm.
- the cells are eukaryotic, they may be transiently transfected with genetic sequences encoding a humanized antibody comprising an ultralong CDR3.
- a stable cell line or stable pools may be created by transfecting or transducing genetic sequences encoding a humanized antibody comprising an ultralong CDR3 by methods well known to those of skill in the art.
- Cells can be selected by fluorescence activated cell sorting (FACS) or through selection for a gene encoding drug resistance.
- FACS fluorescence activated cell sorting
- Cells useful for producing humanized antibodies comprising ultralong CDR3 sequences include prokaryotic cells like E. coli, eukaryotic cells like the yeasts Saccharomyces cerevisiae and Pichia pastoris, Chinese hamster ovary (CHO) cells, monkey cells like COS-1 , or human cells like HEK-293, HeLa, SP-1 .
- the present disclosure provides methods for making humanized antibodies comprising ultralong CDR3 sequences, comprising the steps of engineering an ultralong CDR3 sequence derived from a non-human CDR3 into a human framework.
- the human framework may be of germline origin, or may be derived from non-germline (e.g. mutated or affinity matured) sequences.
- Genetic engineering techniques well known to those in the art, including as disclosed herein, may be used to generate a hybrid DNA sequence containing a human framework and a non-human ultralong CDR3.
- bovine antibodies which produce ultralong CDR3 sequences appear to utilize a single V region family which may be considered to be most homologous to the human VH4 family.
- ultralong CDR3 sequences derived from cattle are to be humanized to produce an antibody comprising an ultralong CDR3
- human V region sequences derived from the VH4 family may be genetically fused to a bovine- derived ultralong CDR3 sequence.
- Exemplary VH4 germline gene sequences in the human antibody locus are shown in Figure 5A (e.g., SEQ ID NOS: 31 -34; and 368-371 ).
- the present disclosure also provides methods of humanizing an antibody variable region comprising the step of genetically combining a nucleic acid sequence encoding a non-human ultralong CDR3 (ULCDR3) with a nucleic acid sequence encoding a human variable region framework (FR) sequence. Also provided are methods of making a humanized antibody variable region comprising selecting a human framework sequence comprising FR1 , FR2, and FR3; selecting a CDR1 sequence; selecting a CDR2 sequence; selecting an ultralong CDR3 sequence; and combining the sequences as FR1 -CDR1 -FR2- CDR2-FR3-ULCDR3.
- Also provided are methods of making a humanized antibody variable region sequence comprising selecting a human antibody variable region sequence comprising a sequence encoding FR1 -CDR1 -FR2-CDR2-FR3; selecting a sequence encoding a non-human ultralong CDR3 (ULCDR3); and genetically fusing the human sequence of step (a) in frame with the non-human sequence of step (b) to generate a sequence encoding FR1 -CDR1 -FR2-CDR2-FR3-ULCDR3.
- the present disclosure provides a fusion of a human VH4 framework sequence to a bovine-derived ultralong CDR3, for example, as may be accomplished through the following steps.
- the second cysteine of a V region genetic sequence is identified along with the nucleotide sequence encoding the second cysteine.
- the second cysteine marks the boundary of the framework and CDR3 two residues upstream (N-terminal) of the CDR3.
- the second cysteine in a bovine- derived V region sequence is identified which similarly marks 2 residues upstream (N- terminal) of the CDR3.
- the genetic material encoding the human V region is combined with the genetic sequence encoding the ultralong CDR3.
- a genetic fusion may be made, wherein the ultralong CDR3 sequence is placed in frame of the human V region sequence.
- a humanized antibody comprising an ultralong CDR3 is as near to human in amino acid composition as possible.
- a J region sequence may be mutated from bovine-derived sequence to a human sequence.
- a humanized heavy chain may be paired with a human light chain.
- the present disclosure provides pairing of a human ultralong CDR3 heavy chain with a non-human light chain.
- the present disclosure provides pairing of a humanized heavy chain comprising an ultralong CDR3 with a human light chain.
- the light chain is homologous to a bovine light chain known to pair with a bovine ultralong CDR3 heavy chain.
- An exemplary bovine light chain is shown in Figure 7A (e.g., SEQ I D NO: 36-39; and 373-376).
- the present disclosure provides methods for making libraries comprising humanized antibodies comprising heavy chain variable regions comprising: (a) an amino acid sequence selected from the group consisting of: (i) SEQ I D NO: 734 or SEQ I D NO: 735, (ii) SEQ I D NO: 736 or SEQ I D NO: 737, (iii) SEQ I D NO: 738 or SEQ I D NO: 739, (iv) SEQ I D NO: 740 or SEQ I D NO: 741 , (v) SEQ ID NO: 742 or SEQ I D NO: 743, (vi) SEQ I D NO: 744 or SEQ ID NO: 745, (vii) SEQ ID NO: 746 or SEQ ID NO 747, and (viii) SEQ ID NO: 748 or SEQ ID NO:749; and (b) an ultralong CDR3 sequence.
- Methods for making libraries of spatially addressed libraries are described in WO 2010/054007. Methods of making libraries in yeast, phage, E.
- the present disclosure also provides methods of screening libraries of humanized antibodies comprising ultralong CDR3 sequences.
- An "ultralong CDR3" or an “ultralong CDR3 sequence”, used interchangeably herein, comprises a CDR3 or CDR3 sequence that is not derived from a human antibody sequence.
- An ultralong CDR3 may be 35 amino acids in length or longer, for example, 40 amino acids in length or longer, 45 amino acids in length or longer, 50 amino acids in length or longer, 55 amino acids in length or longer, or 60 amino acids in length or longer.
- the length of the ultralong CDR3 may include a non-antibody sequence.
- An ultralong CDR3 may comprise a non-antibody sequence, including, for example, an interleukin sequence, a hormone sequence, a cytokine sequence, a toxin sequence, a lymphokine sequence, a growth factor sequence, a chemokine sequence, a toxin sequence, or combinations thereof.
- the ultralong CDR3 is a heavy chain CDR3 (CDR-H3 or CDRH3).
- the ultralong CDR3 is a sequence derived from or based on a ruminant (e.g., bovine) sequence.
- the ultralong CDR3 comprises an amino acid sequence of SEQ ID NO: 498, SEQ ID NO: 499 or both.
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507); (ii) any one of EAGGPDYRNGYNY (SEQ ID NO: 508), EAGGPDYRNGYN (SEQ ID NO: 509), EAGGPDYRNGY (SEQ ID NO: 510), EAGGPDYRNG (SEQ ID NO: 51 1 ), EAGGPDYRN (SEQ ID NO: 512), EAGGPDYR (SEQ ID NO: 513), EAGGPDY (SEQ ID NO: 514), or EAGGPD (SEQ ID NO:
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of YGPNYEEWGDYLATLDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO: 537), PNYEEWGDYLATLDV (SEQ ID NO: 538), NYEEWGDYLATLDV (SEQ ID NO: 539), YEEWGDYLATLDV (SEQ ID NO: 540), or EEWGDYLATLDV (SEQ ID NO: 541 ); (ii) any one of YDFYDGYYNYHYMDV (SEQ ID NO: 542), DFYDGYYNYHYMDV (SEQ ID NO:
- the ultralong CDR3 comprises an amino acid sequence of: (i) any one of GSKHRLRDYFLYNE (SEQ ID NO: 501 ), GSKHRLRDYFLYN (SEQ ID NO: 502), GSKHRLRDYFLY (SEQ ID NO: 503), GSKHRLRDYFL (SEQ ID NO: 504), GSKHRLRDYF (SEQ ID NO: 505), GSKHRLRDY (SEQ ID NO: 506), or GSKHRLRD (SEQ ID NO: 507), and any one of YGPNYEEWGDYLATLDV (SEQ ID NO: 536), GPNYEEWGDYLATLDV (SEQ ID NO: 537), PNYEEWGDYLATLDV (SEQ ID NO: 538), NYEEWGDYLATLDV (SEQ ID NO: 539), YEEWGDYLATLDV (SEQ ID NO: 540), or EEWGDYLATLDV (SEQ ID NO: 541 ); (ii) any one of EAGGPDYR
- YDGYYNYHYMDV (SEQ ID NO: 545), DGYYNYHYMDV (SEQ ID NO: 546), GYYNYHYMDV (SEQ ID NO: 547), or YYNYHYMDV (SEQ ID NO: 548); (iii) any one of EAGGPIWHDDVKY (SEQ ID NO: 516), EAGGPIWHDDVK (SEQ ID NO: 517), EAGGPIWHDDV (SEQ ID NO: 518), EAGGPIWHDD (SEQ ID NO: 519), EAGGPIWHD (SEQ ID NO: 520), EAGGPIWH (SEQ ID NO: 521 ), EAGGPIW (SEQ ID NO: 522), or EAGGPI (SEQ ID NO: 523), and any one of YDFNDGYYNYHYMDV (SEQ ID NO: 549), DFYDGYYNYHYMDV (SEQ ID NO: 550), FYDGYYNYHYMDV
- An ultralong CDR3 may comprise at least 3 or more cysteine residues, for example, 4 or more cysteine residues, 6 or more cysteine residues, 8 or more cysteine residues, 10 or more cysteine residues, or 12 or more cysteine residues (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12 or more).
- An ultralong CDR3 may comprise one or more of the following motifs: a cysteine motif, a X 1 X 2 X 3 X 4 X 5 motif, a CX 1 X 2 X 3 X 4 X 5 motif, or a (X a X b ) z motif.
- cyste motif is a segment of amino acid residues in an ultralong CDR3 that comprises 3 or more cysteine residues including, 4 or more cysteine residues, 5 or more cysteine residues, 6 or more cysteine residues, 7 or more cysteine residues, 8 or more cysteine residues, 9 or more cysteine residues, 10 or more cysteine residues, 1 1 or more cysteine residues, or 12 or more cysteine residues.
- a cysteine motif may comprise an amino acid sequence selected from the group consisting of: CX1 0 CX5CX5CXCX7C (SEQ ID NO: 41 ), CXioCX 6 CX 5 CXCXi 5 C (SEQ ID NO: 42), CXn CXCX 5 C (SEQ ID NO: 43), CXiiCX 5 CX 5 CXCX 7 C (SEQ ID NO: 44), CXi 0 CX 6 CX 5 CXCXi 3 C (SEQ ID NO: 45), CXioCX 5 CXCX4CX 8 C (SEQ ID NO: 46), CXi 0 CX 6 CX 6 CXCX 7 C (SEQ ID NO: 47), CXioCX 4 CX 7 CXCX 8 C (SEQ ID NO: 48), CXi 0 CX 4 CX 7 CXCX 7 C (SEQ ID NO: 49), CXi 3 CX 8 CX 8 C (SEQ ID NO: 50),
- a cysteine motif may comprise an amino acid sequence selected from the group consisting of: CCX 3 CXCX 3 CX 2 CCXCX 5 CX 9 CX 5 CXC (SEQ ID NO: 96), CX 6 CX 2 CX 5 CX4CCXCX 4 CX 6 CXC (SEQ ID NO: 97), CX 7 CXCX 5 CX4CCCX 4 CX 6 CXC (SEQ ID NO: 98), CX 9 CX 3 CXCX 2 CXCCCX 6 CX 4 C (SEQ ID NO: 99), CX 5 CX 3 CXCX4CX 4 CCXioCX 2 CC (SEQ ID NO: 100), CX 5 CXCXiCXCX 3 CCX 3 CX4CXioC (SEQ ID NO: 101 ), CX 9 CCCX 3 CX 4 CCCX 5 CX 6 C (SEQ ID NO: 102), CCX 8 CX 5 CX4CX
- a cysteine motif is preferably positioned within an ultralong CDR3 between a X 1 X 2 X 3 X 4 X 5 motif and a (X a X b ) z motif.
- a "X 1 X 2 X 3 X 4 X 5 motif is a series of five consecutive amino acid residues in an ultralong CDR3, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenyla
- the X 1 X 2 X 3 X 4 X 5 motif may be TTVHQ (SEQ ID NO: 153), TSVHQ (SEQ ID NO: 154), SSVTQ (SEQ ID NO: 155), STVHQ (SEQ ID NO: 156), ATVRQ (SEQ ID NO: 157), TTVYQ (SEQ ID NO: 158), SPVHQ (SEQ ID NO: 159), ATVYQ (SEQ ID NO: 160), TAVYQ (SEQ ID NO: 161 ), TNVHQ (SEQ ID NO: 162), ATVHQ (SEQ ID NO: 163), STVYQ (SEQ ID NO: 164), TIVHQ (SEQ ID NO: 165), AIVYQ (SEQ ID NO: 166), TTVFQ (SEQ ID NO: 167), AAVFQ (SEQ ID NO: 168), GTVHQ (SEQ ID NO: 169), ASVHQ (SEQ ID NO: 170), TAVFQ (SEQ ID NO:
- a "CX 1 X 2 X 3 X 4 X 5 motif” is a series of six consecutive amino acid residues in an ultralong CDR3, wherein the first amino acid residue is cysteine, wherein X 1 is threonine (T), glycine (G), alanine (A), serine (S), or valine (V), wherein X 2 is serine (S), threonine (T), proline (P), isoleucine (I), alanine (A), valine (V), or asparagine (N), wherein X 3 is valine (V), alanine (A), threonine (T), or aspartic acid (D), wherein X 4 is histidine (H), threonine (T), arginine (R), tyrosine (Y), phenylalanine (F), or leucine (L), and wherein X 5 is glutamine (Q).
- the CX 1 X 2 X 3 X 4 X 5 motif is CTTVHQ (SEQ ID NO: 185), CTSVHQ (SEQ ID NO: 186), CSSVTQ (SEQ ID NO: 187), CSTVHQ (SEQ ID NO: 188), CATVRQ (SEQ ID NO: 189), CTTVYQ (SEQ ID NO: 190), CSPVHQ (SEQ ID NO: 191 ), CATVYQ (SEQ ID NO: 192), CTAVYQ (SEQ ID NO: 193), CTNVHQ (SEQ ID NO: 194), CATV HQ (SEQ ID NO: 195), CSTVYQ (SEQ ID NO: 196), CTIVHQ (SEQ ID NO: 197), CAIVYQ (SEQ ID NO: 198), CTTVFQ (SEQ ID NO: 199), CAAVFQ (SEQ ID NO: 200), CGTVHQ (SEQ ID NO: 201 ), CASVHQ (SEQ ID NO: 202), CTA
- a "(X a X b ) z " motif is a repeating series of two amino acid residues in an ultralong CDR3, wherein X a is any amino acid residue, X b is an aromatic amino acid selected from the group consisting of: tyrosine (Y), phenylalanine (F), tryptophan (W), and histidine (H), and wherein z is 1 - 4.
- the (X a X b ) z motif may comprise CYTYNYEF (SEQ ID NO: 217), HYTYTYDF (SEQ ID NO: 218), HYTYTYEW (SEQ ID NO: 219), KHRYTYEW (SEQ ID NO: 220), NYIYKYSF (SEQ ID NO: 221 ), PYIYTYQF (SEQ ID NO: 222), SFTYTYEW (SEQ ID NO: 223), SYIYIYQW (SEQ ID NO: 224), SYNYTYSW (SEQ ID NO: 225), SYSYSYEY (SEQ ID NO: 226), SYTYNYDF (SEQ ID NO: 227), SYTYNYEW (SEQ ID NO: 228), SYTYNYQF (SEQ ID NO: 229), SYVWTHNF (SEQ ID NO: 230), TYKYVYEW (SEQ ID NO: 231 ), TYTYTYEF (SEQ ID NO
- the (X a X b ) z motif is YXYXYX.
- An ultralong CDR3 may comprise an amino acid sequence that is derived from or based on SEQ ID NO: 40 (see, e.g., amino acid residues 3-6 of SEQ ID NO: 1 -4; see also, e.g., VH germline sequences in Figures 2A-C).
- a variable region that comprises an ultralong CDR3 may include an amino acid sequence that is SEQ ID NO: 1 (CTTVHQ), SEQ ID NO:2 (CTSVHQ), SEQ ID NO:3 (CSSVTQ) or SEQ ID NO: 4 (CTTVHP).
- Such a sequence may be derived from or based on a bovine germline VH gene sequence ⁇ e.g., SEQ ID NO: 1 ).
- An ultralong CDR3 may comprise a sequence derived from or based on a non-human DH gene sequence, for example, SEQ ID NO: 5 (see also, e.g., Koti, et al. (2010) Mol. Immunol. 47: 21 19-2128), or alternative sequences such as SEQ ID NO: 6, 7, 8, 9, 10, 1 1 or 12 (see also, e.g., DH2 germline sequences in Figures 2A-C).
- An ultralong CDR3 may comprise a sequence derived from or based on a JH sequence, for example, SEQ ID NO: 13 (see also, e.g., Hosseini, et al. (2004) Int. Immunol. 16: 843-852), or alternative sequences such as SEQ ID NO: 14, 15, 16 or 17 (see also, e.g., JH1 germline sequences in Figures 2A-C).
- SEQ ID NO: 13 see also, e.g., Hosseini, et al. (2004) Int. Immunol. 16: 843-852
- alternative sequences such as SEQ ID NO: 14, 15, 16 or 17 (see also, e.g., JH1 germline sequences in Figures 2A-C).
- an ultralong CDR3 may comprise a sequence derived from or based on a non-human VH sequence (e.g., SEQ ID NO: 1 , 2, 3 or 4; alternatively VH sequences in Figures 2A-C) and/or a sequence derived from or based on a non-human DH sequence (e.g., SEQ ID NO: 5, 6, 7, 8, 9, 10, 1 1 or 12; alternatively DH sequences in Figures 2A-C) and/or a sequence derived from or based on a JH sequence (e.g., SEQ ID NO: 13, 14, 15, 16, or 17; alternatively JH sequences in Figures 2A-C), and optionally an additional sequence comprising two to six amino acids or more (e.g., IR, IF, SEQ ID NO: 18, 19, 20 or 21 ) such as, for example, between the VH derived sequence and the DH derived sequence.
- an ultralong CDR3 may comprise a sequence derived from or based on SEQ ID
- An "isolated" biological molecule refers to a biological molecule that has been identified and separated and/or recovered from at least one component of its natural environment.
- Antagonist refers to any molecule that partially or fully blocks, inhibits, or neutralizes an activity (e.g., biological activity) of a polypeptide. Also encompassed by “antagonist” are molecules that fully or partially inhibit the transcription or translation of mRNA encoding the polypeptide. Suitable antagonist molecules include, e.g., antagonist antibodies or antibody fragments; fragments or amino acid sequence variants of a native polypeptide; peptides; antisense oligonucleotides; small organic molecules; and nucleic acids that encode polypeptide antagonists or antagonist antibodies. Reference to "an” antagonist encompasses a single antagonist or a combination of two or more different antagonists.
- Antist refers to any molecule that partially or fully mimics a biological activity of a polypeptide.
- agonist molecules that stimulate the transcription or translation of mRNA encoding the polypeptide.
- Suitable agonist molecules include, e.g., agonist antibodies or antibody fragments; a native polypeptide; fragments or amino acid sequence variants of a native polypeptide; peptides; antisense oligonucleotides; small organic molecules; and nucleic acids that encode polypeptides agonists or antibodies.
- Reference to "an” agonist encompasses a single agonist or a combination of two or more different agonists.
- An "isolated" antibody refers to one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
- the antibody will be purified (1 ) to greater than 95% by weight of antibody ⁇ e.g., as determined by the Lowry method), and preferably to more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence ⁇ e.g., by use of a spinning cup sequenator), or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions ⁇ e.g., using CoomassieTM blue or, preferably, silver stain).
- Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Similarly, isolated antibody includes the antibody in medium around recombinant cells. An isolated antibody may be prepared by at least one purification step.
- An "isolated" nucleic acid molecule refers to a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the natural source of the antibody nucleic acid.
- An isolated nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from the nucleic acid molecule as it exists in natural cells.
- an isolated nucleic acid molecule includes a nucleic acid molecule contained in cells that express an antibody where, for example, the nucleic acid molecule is in a chromosomal location different from that of natural cells.
- Variable domain residue numbering as in Kabat or amino acid position numbering as in Kabat refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991 ). Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
- a heavy chain variable domain may include a single amino acid insert ⁇ e.g., residue 52a according to Kabat) after residue 52 of H2 and inserted residues ⁇ e.g., residues 82a, 82b, and 82c, etc according to Kabat) after heavy chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
- substantially similar refers to a sufficiently high degree of similarity between two numeric values (generally one associated with an antibody disclosed herein and the other associated with a reference/comparator antibody) such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said values ⁇ e.g., Kd values).
- the difference between said two values is preferably less than about 50%, preferably less than about 40%, preferably less than about 30%, preferably less than about 20%, preferably less than about 10% as a function of the value for the reference/comparator antibody.
- Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule ⁇ e.g., an antibody) and its binding partner ⁇ e.g., an antigen). Unless indicated otherwise, "binding affinity” refers to intrinsic binding affinity which reflects a 1 :1 interaction between members of a binding pair ⁇ e.g., antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant. Affinity can be measured by common methods known in the art, including those described herein. Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high- affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present disclosure.
- An "on-rate” or “rate of association” or “association rate” or “k on” can be determined with a surface plasmon resonance technique such as Biacore ⁇ e.g., Biacore A100, BiacoreTM-2000, BiacoreTM-3000, Biacore, Inc., Piscataway, N.J.) carboxymethylated dextran biosensor chips (CM5, Biacore Inc.) and according to the supplier's instructions.
- Biacore ⁇ e.g., Biacore A100, BiacoreTM-2000, BiacoreTM-3000, Biacore, Inc., Piscataway, N.J.
- CM5, Biacore Inc. carboxymethylated dextran biosensor chips
- Vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- phage vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced ⁇ e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors ⁇ e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors" (or simply, “recombinant vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. Accordingly, "plasmid” and “vector” may, at times, be used interchangeably as the plasmid is a commonly used form of vector.
- Gene refers to a nucleic acid ⁇ e.g., DNA) sequence that comprises coding sequences necessary for the production of a polypeptide, precursor, or RNA ⁇ e.g., rRNA, tRNA).
- the polypeptide can be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or functional properties ⁇ e.g., enzymatic activity, ligand binding, signal transduction, immunogenicity, etc.) of the full- length or fragment are retained.
- the term also encompasses the coding region of a structural gene and the sequences located adjacent to the coding region on both the 5' and 3' ends for a distance of about 1 kb or more on either end such that the gene corresponds to the length of the full-length mRNA. Sequences located 5' of the coding region and present on the mRNA are referred to as 5' non-translated sequences. Sequences located 3' or downstream of the coding region and present on the mRNA are referred to as 3' non- translated sequences.
- the term "gene” encompasses both cDNA and genomic forms of a gene.
- a genomic form or clone of a gene contains the coding region interrupted with non- coding sequences termed "introns” or “intervening regions” or “intervening sequences.”
- Introns are segments of a gene that are transcribed into nuclear RNA (hnRNA); introns can contain regulatory elements such as enhancers. Introns are removed or “spliced out” from the nuclear or primary transcript; introns therefore are absent in the messenger RNA (mRNA) transcript.
- mRNA messenger RNA
- the mRNA functions during translation to specify the sequence or order of amino acids in a nascent polypeptide.
- genomic forms of a gene can also include sequences located on both the 5' and 3' end of the sequences that are present on the RNA transcript.
- flanking sequences or regions are referred to as “flanking" sequences or regions (these flanking sequences are located 5' or 3' to the non-translated sequences present on the mRNA transcript).
- the 5' flanking region can contain regulatory sequences such as promoters and enhancers that control or influence the transcription of the gene.
- the 3' flanking region can contain sequences that direct the termination of transcription, post transcriptional cleavage and polyadenylation.
- Polynucleotide refers to polymers of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase, or by a synthetic reaction.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after synthesis, such as by conjugation with a label.
- Other types of modifications include, for example, "caps", substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages ⁇ e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.) and with charged linkages ⁇ e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins ⁇ e.g., nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc.), those with intercalators ⁇ e.g., acridine, psoralen, etc.), those containing chelators ⁇ e.g.
- any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid or semi-solid supports.
- the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
- Other hydroxyls may also be derivatized to standard protecting groups.
- Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl, 2'-fluoro- or 2'-azido-ribose, carbocyclic sugar analogs, alpha-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and a basic nucleoside analogs such as methyl riboside.
- One or more phosphodiester linkages may be replaced by alternative linking groups.
- linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(0)S("thioate”), P(S)S ("dithioate”), "(0)NR 2 ("amidate”), P(0)R, P(0)OR', CO or CH 2 ("formacetal”), in which each R or R' is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
- Oligonucleotide refers to short, generally single stranded, generally synthetic polynucleotides that are generally, but not necessarily, less than about 200 nucleotides in length.
- oligonucleotide and polynucleotide are not mutually exclusive. The description above for polynucleotides is equally and fully applicable to oligonucleotides.
- Stringent hybridization conditions refer to conditions under which a probe will hybridize to its target subsequence, typically in a complex mixture of nucleic acids, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology-Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays” (1993). Generally, stringent conditions are selected to be about 5-10°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength pH.
- Tm thermal melting point
- the Tm is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at Tm, 50% of the probes are occupied at equilibrium).
- Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide.
- a positive signal is at least two times background, preferably 10 times background hybridization.
- Exemplary stringent hybridization conditions can be as following: 50% formamide, 5xSSC, and 1 % SDS, incubating at 42° C, or, 5xSSC, 1 % SDS, incubating at 65° C, with wash in 0.2xSSC, and 0.1 % SDS at 65° C.
- Recombinant when used with reference to a cell, nucleic acid, protein or vector indicates that the cell, nucleic acid, protein or vector has been modified by the introduction of a heterologous nucleic acid or protein, the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified.
- recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are overexpressed or otherwise abnormally expressed such as, for example, expressed as non-naturally occurring fragments or splice variants.
- nucleic acid By the term “recombinant nucleic acid” herein is meant nucleic acid, originally formed in vitro, in general, by the manipulation of nucleic acid, e.g., using polymerases and endonucleases, in a form not normally found in nature. In this manner, operably linkage of different sequences is achieved.
- an isolated nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined are both considered recombinant for the purposes of this disclosure.
- a recombinant nucleic acid is made and introduced into a host cell or organism, it will replicate non-recombinantly, e.g., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes disclosed herein.
- a "recombinant protein” is a protein made using recombinant techniques, e.g., through the expression of a recombinant nucleic acid as depicted above.
- Percent (%) amino acid sequence identity refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MegAlign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- Polypeptide may be used interchangeably to refer to a polymer of amino acid residues.
- the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups ⁇ e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
- amino acid variants refers to amino acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical or associated ⁇ e.g., naturally contiguous) sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode most proteins. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
- nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes silent variations of the nucleic acid.
- AUG which is ordinarily the only codon for methionine
- TGG which is ordinarily the only codon for tryptophan
- nucleic acid which encodes a polypeptide is implicit in a described sequence with respect to the expression product, but not with respect to actual probe sequences.
- amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" including where the alteration results in the substitution of an amino acid with a chemically similar amino acid.
- Conservative substitution tables providing functionally similar amino acids are well known in the art.
- conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles disclosed herein.
- conservative substitutions include: 1 ) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
- Antibodies are glycoproteins having similar structural characteristics. While antibodies may exhibit binding specificity to a specific antigen, immunoglobulins may include both antibodies and other antibody-like molecules which generally lack antigen specificity. Polypeptides of the latter kind are, for example, produced at low levels by the lymph system and at increased levels by myelomas.
- Antibody and "immunoglobulin” are used interchangeably in the broadest sense and include monoclonal antibodies ⁇ e.g., full length or intact monoclonal antibodies), polyclonal antibodies, multivalent antibodies, multispecific antibodies ⁇ e.g., bispecific antibodies so long as they exhibit the desired biological activity) and may also include certain antibody fragments (as described in greater detail herein).
- An antibody can be human, humanized and/or affinity matured.
- An antibody may refer to immunoglobulins and immunoglobulin portions, whether natural or partially or wholly synthetic, such as recombinantly produced, including any portion thereof containing at least a portion of the variable region of the immunoglobulin molecule that is sufficient to form an antigen binding site.
- an antibody or portion thereof includes any protein having a binding domain that is homologous or substantially homologous to an immunoglobulin antigen binding site.
- an antibody may refer to an antibody that contains two heavy chains (which can be denoted H and H') and two light chains (which can be denoted L and L'), where each heavy chain can be a full-length immunoglobulin heavy chain or a portion thereof sufficient to form an antigen binding site ⁇ e.
- heavy chains include, but are not limited to, VH, chains VH-CH1 chains and VH-CH1 -CH2-CH3 chains), and each light chain can be a full-length light chain or a thereof sufficient to form an antigen binding site ⁇ e.g.
- VL chains include, but are not limited to, VL chains and VL-CL chains). Each heavy chain (H and H') pairs with one light chain (L and L', respectively).
- antibodies minimally include all or at least a portion of the variable heavy (VH) chain and/or the variable light (VL) chain.
- the antibody also can include all or a portion of the constant region.
- a full- length antibody is an antibody having two full-length heavy chains ⁇ e.g. VH-CH1 -CH2-CH3 or VH-CH 1-CH2-CH3- CH4) and two full-length light chains (VL-CL) and hinge regions, such as antibodies produced by antibody secreting B cells and antibodies with the same domains that are produced synthetically.
- an "antibody” refers to a protein of the immunoglobulin family or a polypeptide comprising fragments of an immunoglobulin that is capable of noncovalently, reversibly, and in a specific manner binding a corresponding antigen.
- An exemplary antibody structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kD) and one "heavy" chain (about 50-70 kD), connected through a disulfide bond.
- the recognized immunoglobulin genes include the ⁇ , ⁇ , ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ constant region genes, as well as the myriad immunoglobulin variable region genes.
- Light chains are classified as either ⁇ or ⁇ .
- Heavy chains are classified as ⁇ , ⁇ , ⁇ , ⁇ , or ⁇ , which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD, and IgE, respectively.
- the N-terminus of each chain defines a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
- the terms variable light chain (VL) and variable heavy chain (VH) refer to these regions of light and heavy chains respectively.
- variable refers to the fact that certain portions of the variable domains (also referred to as variable regions) differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity- determining regions (CDRs) or hypervariable regions (HVRs) both in the light-chain and the heavy-chain variable domains. CDRs include those specified as Kabat, Chothia, and IMGT as shown herein within the variable region sequences. The more highly conserved portions of variable domains are called the framework (FR).
- CDRs complementarity- determining regions
- HVRs hypervariable regions
- variable domains of native heavy and light chains each comprise four FR regions, largely adopting a ⁇ -sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
- the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991 )).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody- dependent cellular toxicity.
- Papain digestion of antibodies produces two identical antigen- binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, whose name reflects its ability to crystallize readily.
- Pepsin treatment yields an F(ab') 2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
- Fv refers to an antibody fragment which contains an antigen- recognition and antigen-binding site.
- this region consists of a dimer of one heavy and one light chain variable domain in non-covalent association.
- scFv single chain Fv
- one heavy chain and one light chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a "dimeric" structure analogous to that in a two-chain Fv (scFv) species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer.
- the six CDRs confer antigen-binding specificity to the antibody.
- a single variable domain or half of an Fv comprising only three CDRs specific for an antigen
- the Fab fragment also contains the constant domain of the light chain and the first constant domain (CHI) of the heavy chain.
- Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- the "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., IgG ⁇ lgG 2 , lgG 3 , lgG 4, lgA 1 ; and lgA 2 .
- the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
- Antibody fragments comprise only a portion of an intact antibody, wherein the portion preferably retains at least one, preferably most or all, of the functions normally associated with that portion when present in an intact antibody.
- antibody fragments include Fab, Fab', F(ab')2, single-chain Fvs (scFv), Fv, dsFv, diabody, Fd and Fd' fragments Fab fragments, Fd fragments, scFv fragments, linear antibodies, single-chain antibody molecules, and multispecific antibodies formed from antibody fragments (see, for example, Methods in Molecular Biology, Vol 207: Recombinant Antibodies for Cancer Therapy Methods and Protocols (2003); Chapter 1 ; p 3-25, Kipriyanov).
- an antibody fragment comprises an antigen binding site of the intact antibody and thus retains the ability to bind antigen.
- an antibody fragment for example one that comprises the Fc region, retains at least one of the biological functions normally associated with the Fc region when present in an intact antibody, such as FcRn binding, antibody half life modulation, ADCC function and complement binding.
- an antibody fragment is a monovalent antibody that has an in vivo half life substantially similar to an intact antibody.
- such an antibody fragment may comprise on antigen binding arm linked to an Fc sequence capable of conferring in vivo stability to the fragment.
- an antibody fragment or antibody portion refers to any portion of a full- length antibody that is less than full length but contains at least a portion of the variable region of the antibody sufficient to form an antigen binding site (e.g. one or more CDRs) and thus retains the a binding specificity and/or an activity of the full-length antibody;
- antibody fragments include antibody derivatives produced by enzymatic treatment of full- length antibodies, as well as synthetically, e.g. recombinantly produced derivatives.
- a "dsFv” refers to an Fv with an engineered intermolecular disulfide bond, which stabilizes the VH-VL pair.
- a “Fd fragment” refers to a fragment of an antibody containing a variable domain (VH) and one constant region domain (CH1 ) of an antibody heavy chain.
- a "Fab fragment” refers to an antibody fragment that contains the portion of the full-length antibody that would results from digestion of a full-length immunoglobulin with papain, or a fragment having the same structure that is produced synthetically, e.g. recombinantly.
- a Fab fragment contains a light chain (containing a VL and CL portion) and another chain containing a variable domain of a heavy chain (VH) and one constant region domain portion of the heavy chain (CH1 ); it can be recombinantly produced.
- a "F(ab')2 fragment” refers to an antibody fragment that results from digestion of an immunoglobulin with pepsin at pH 4.0-4.5, or a synthetically, e.g. recombinantly, produced antibody having the same structure.
- the F(ab')2 fragment contains two Fab fragments but where each heavy chain portion contains an additional few amino acids, including cysteine residues that form disulfide linkages joining the two fragments; it can be recombinantly produced.
- a "Fab' fragment” refers to a fragment containing one half (one heavy chain and one light chain) of the F(ab')2 fragment.
- a "Fd' fragment refers to a fragment of an antibody containing one heavy chain portion of a F(ab')2 fragment.
- a "Fv' fragment” refers to a fragment containing only the VH and VL domains of an antibody molecule.
- a "scFv fragment” refers to an antibody fragment that contains a variable light chain (VL) and variable heavy chain (VH), covalently connected by a polypeptide linker in any order.
- the linker is of a length such that the two variable domains are bridged without substantial interference.
- Exemplary linkers are (Gly-Ser)n residues with some Glu or Lys residues dispersed throughout to increase solubility.
- Diabodies are dimeric scFv; diabodies typically have shorter peptide linkers than scFvs, and they preferentially dimerize.
- HsFv refers to antibody fragments in which the constant domains normally present in a Fab fragment have been substituted with a heterodimeric coiled-coil domain (see, e.g., Arndt ef a/. (2001 ) J Mol Biol. 7:312:221-228).
- Hypervariable region may refer to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
- antibodies comprise six hypervariable or CDR regions; three in the VH (H1 , H2, H3), and three in the VL (L1 , L2, L3).
- a number of hypervariable region or CDR delineations are in use and are encompassed herein.
- the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
- Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901 -917 (1987)).
- the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, (Chothia "CDRs") and are used by Oxford Molecular's AbM antibody modeling software.
- the "contact" hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these hypervariable regions are noted below.
- IMGT referes to the international ImMunoGeneTics Information System, as described by Lefrace et al., Nucl. Acids, Res. 37; D1006-D1012 (2009), including for example, IMGT designated CDRs for antibodies.
- Hypervariable regions may comprise "extended hypervariable regions” as follows: 24-36 or 24-34 (L1 ), 46-56 or 50-56 (L2) and 89-97 (L3) in the VL and 26-35 (H1 ), 50-65 or 49-65 (H2) and 93-102, 94-102 or 95-102 (H3) in the VH.
- the variable domain residues are numbered according to Kabat et al., Supra for each of these definitions.
- “Framework” or “FR” residues are those variable domain residues other than the hypervariable region residues as herein defined.
- “Framework regions” are the domains within the antibody variable region domains comprising framework residues that are located within the beta sheets; the FR regions are comparatively more conserved, in terms of their amino acid sequences, than the hypervariable regions.
- “Monoclonal antibody” refers to an antibody from a population of substantially homogeneous antibodies, that is, for example, the individual antibodies comprising the population are identical and/or bind the same epitope(s), except for possible variants that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts.
- Such monoclonal antibody typically includes an antibody comprising a polypeptide sequence that binds a target, wherein the target-binding polypeptide sequence was obtained by a process that includes the selection of a single target binding polypeptide sequence from a plurality of polypeptide sequences.
- the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones or recombinant DNA clones.
- the selected target binding sequence can be further altered, for example, to improve affinity for the target, to humanize the target binding sequence, to improve its production in cell culture, to reduce its immunogenicity in vivo, to create a multispecific antibody, etc., and that an antibody comprising the altered target binding sequence is also a monoclonal antibody of this disclosure.
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- the monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins.
- the modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present disclosure may be made by a variety of techniques, including, for example, the hybridoma method ⁇ e.g., Kohler et al., Nature, 256:495 (1975); Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 , (Elsevier, N.Y., 1981 )), recombinant DNA methods (see, e.g., U.S. Patent No.
- phage display technologies see, e.g., Clackson et al., Nature, 352:624-628 (1991 ); Marks et al., J. Mol. Biol., 222:581-597 (1991 ); Sidhu et al., J. Mol. Biol. 338(2):299-310 (2004); Lee et al., J. Mol. Biol. 340(5):1073-1093 (2004); Fellouse, Proc. Nat. Acad. Sci. USA 101 (34):12467-12472 (2004); and Lee et al. J. Immunol.
- Methods 284(1 -2): 1 19-132 (2004) and technologies for producing human or human-like antibodies in animals that have parts or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences (see, e.g., WO 1998/24893; WO 1996/34096; WO 1996/33735; WO 1991/10741 ; Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggemann et al., Year in Immune, 7:33 (1993); U.S. Patent Nos.
- “Humanized” or “Human engineered” forms of non-human ⁇ e.g., murine) antibodies are chimeric antibodies that contain amino acids represented in human immunoglobulin sequences, including, for example, wherein minimal sequence is derived from non-human immunoglobulin.
- humanized antibodies may be human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in non-human ⁇ e.g., rodent) antibodies.
- humanized or human engineered antibodies may be non-human ⁇ e.g., rodent) antibodies in which some residues are substituted by residues from analogious sites in human antibodies (see, e.g., U.S. Patent No. 5,766,886).
- Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody, including, for example non-antibody sequences such as a chemokine, growth factor, peptide, cytokine, cell surface protein, serum protein, toxin, extracellular matrix protein, clotting factor, or secreted protein sequence.
- Humanized antibodies include human engineered antibodies, for example, as described by U.S. Patent No. 5,766,886, including methods for preparing modified antibody variable domains.
- a humanized antibody may comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
- a humanized antibody optionally may also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- Hybrid antibodies refer to immunoglobulin molecules in which pairs of heavy and light chains from antibodies with different antigenic determinant regions are assembled together so that two different epitopes or two different antigens can be recognized and bound by the resulting tetramer.
- “Chimeric" antibodies have a portion of the heavy and/or light chain identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see e.g., Morrison et al., Proc. Natl. Acad. Sci. USA 81 :6851 - 6855 (1984)).
- Humanized antibody refers to a subset of chimeric antibodies.
- Single-chain Fv or “scFv” antibody fragments may comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
- the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
- an "antigen” refers to a predetermined antigen to which an antibody can selectively bind.
- the target antigen may be polypeptide, carbohydrate, nucleic acid, lipid, hapten or other naturally occurring or synthetic compound.
- the target antigen is a polypeptide.
- epitope or "antigenic determinant”, used interchangeably herein, refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody.
- the antigen is a polypeptide
- epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing.
- An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation.
- Antibodies may bind to the same or a different epitope on an antigen.
- Antibodies may be characterized in different epitope bins. Whether an antibody binds to the same or different epitope as another antibody ⁇ e.g., a reference antibody or benchmark antibody) may be determined by competition between antibodies in assays ⁇ e.g., competitive binding assays).
- Competition between antibodies may be determined by an assay in which the immunoglobulin under test inhibits specific binding of a reference antibody to a common antigen.
- Numerous types of competitive binding assays are known, for example: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay or enzyme-linked immunosorbent assay (EIA or ELISA), sandwich competition assay including an ELISA assay (see Stahli et al., Methods in Enzymology 9:242-253 (1983)); solid phase direct biotin-avidin EIA (see Kirkland et al., J. Immunol.
- solid phase direct labeled assay solid phase direct labeled sandwich assay (see Harlow and Lane, "Antibodies, A Laboratory Manual,” Cold Spring Harbor Press (1988)); solid phase direct label RIA using 1-125 label (see Morel et al., Molec. Immunol. 25(1 ):7-15 (1988)); solid phase direct biotin-avidin EIA (Cheung et al., Virology 176:546-552 (1990)); and direct labeled RIA (Moldenhauer et al., Scand. J. Immunol., 32:77-82 (1990)).
- Competition binding assays may be performed using Surface Plasmon Resonance (SPR), for example, with a Biacore ® instrument for kinetic analysis of binding interactions.
- SPR Surface Plasmon Resonance
- a humanized antibody comprising an ultralong CDR3 of unknown epitope specificity may be evaluated for its ability to compete for binding against a comparator antibody ⁇ e.g., a BA1 or BA2 antibody as described herein).
- An assay may involve the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test immunoglobulin and a labeled reference immunoglobulin.
- Competitive inhibition may be measured by determining the amount of label bound to the solid surface or cells in the presence of the test immunoglobulin. Usually the test immunoglobulin is present in excess.
- An assay may include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
- a competing antibody when present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 50%, or at least about 70%, or at least about 80%, or least about 90%, or at least about 95%, or at least about 99% or about 100% for a competitor antibody.
- That an antibody “selectively binds” or “specifically binds” means that the antibody reacts or associates more frequently, more rapidly, with greater duration, with greater affinity, or with some combination of the above to an antigen or an epitope than with alternative substances, including unrelated proteins.
- “Selectively binds” or “specifically binds” may mean, for example, that an antibody binds to a protein with a K D of at least about 0.1 mM, or at least about 1 ⁇ or at least about 0.1 ⁇ or better, or at least about 0.01 ⁇ or better. Because of the sequence identity between homologous proteins in different species, specific binding can include an antibody that recognizes a given antigen in more than one species.
- Non-specific binding and “background binding” when used in reference to the interaction of an antibody and a protein or peptide refer to an interaction that is not dependent on the presence of a particular structure ⁇ e.g., the antibody is binding to proteins in general rather that a particular structure such as an epitope).
- Diabodies refer to small antibody fragments with two antigen- binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL).
- VH heavy-chain variable domain
- VL light-chain variable domain
- VH-VL polypeptide chain
- a "human antibody” refers to one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non- human antigen-binding residues.
- affinity matured antibody refers to one with one or more alterations in one or more CDRs thereof which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
- Preferred affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
- Affinity matured antibodies are produced by procedures known in the art. Marks et al., Bio/Technology 10:779-783 (1992) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by: Barbas et al., Proc Nat. Acad. Sci.
- Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
- ADCC antibody-dependent cell-mediated cytotoxicity
- FcRs Fc receptors
- cytotoxic cells ⁇ e.g., Natural Killer (NK) cells, neutrophils, and macrophages
- NK Natural Killer
- the antibodies “arm” the cytotoxic cells and are absolutely required for such killing.
- ADCC activity of a molecule of interest is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991 ).
- an in vitro ADCC assay may be performed.
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- PBMC peripheral blood mononuclear cells
- NK Natural Killer
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA 95:652-656 (1998).
- Human effector cells are leukocytes which express one or more
- the cells express at least FCYRI I I and perform ADCC effector function.
- human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred.
- PBMC peripheral blood mononuclear cells
- NK natural killer cells
- monocytes monocytes
- cytotoxic T cells cytotoxic T cells and neutrophils
- the effector cells may be isolated from a native source, e.g., from blood.
- Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FCYRI , FCYRI I, and FCYRI I I subclasses, including allelic variants and alternatively spliced forms of these receptors.
- FcyRII receptors include FcyRIIA (an "activating receptor") and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
- Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine- based inhibition motif (ITIM) in its cytoplasmic domain, (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)).
- FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991 ); Capel et al., Immunomethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126:330-41 (1995).
- FcR FcR
- the term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 1 17:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)) and regulates homeostasis of immunoglobulins.
- FcRn neonatal receptor
- antibody variants with improved or diminished binding to FcRs have been described (see, e.g., Shields et al. J. Biol. Chem. 9(2): 6591 -6604 (2001 )).
- Binding to human FcRn in vivo and serum half life of human FcRn high affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates administered with the Fc variant polypeptides.
- CDC complement dependent cytotoxicity
- Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
- Clq first component of the complement system
- a CDC assay for example, as described in Gazzano- Santoro et al., J. Immunol. Methods 202:163 (1996), may be performed.
- Fc region-comprising polypeptide refers to a polypeptide, such as an antibody or immunoadhesin (see definitions below), which comprises an Fc region.
- the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during purification of the polypeptide or by recombinant engineering the nucleic acid encoding the polypeptide.
- blocking antibody or an “antagonist” antibody refers to one which inhibits or reduces biological activity of the antigen it binds.
- Preferred blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
- Antist antibody refers to an antibody which mimics ⁇ e.g., partially or fully) at least one of the functional activities of a polypeptide of interest.
- acceptor human framework refers to a framework comprising the amino acid sequence of a VL or VH framework derived from a human immunoglobulin framework, or from a human consensus framework.
- An acceptor human framework "derived from” a human immunoglobulin framework or human consensus framework may comprise the same amino acid sequence thereof, or may contain pre-existing amino acid sequence changes. Where pre-existing amino acid changes are present, preferably no more than 5 and preferably 4 or less, or 3 or less, pre-existing amino acid changes are present.
- a "human consensus framework” refers to a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91 -3242, Bethesda Md. (1991 ), vols. 1-3.
- the subgroup is subgroup kappa I as in Kabat et al., supra.
- the subgroup is subgroup III as in Kabat et al., supra.
- Disorder or “disease” refers to any condition that would benefit from treatment with a substance/molecule (e.g., a humanized antibody comprising an ultralong CDR3 as dislosed herein) or method disclosed herein. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
- a substance/molecule e.g., a humanized antibody comprising an ultralong CDR3 as dislosed herein
- This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
- Treatment refers to clinical intervention in an attempt to alter the natural course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- antibodies disclosed herein are used to delay development of a disease or disorder.
- “Individual” ⁇ e.g., a “subject” refers to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, farm animals (such as cows), sport animals, pets (such as cats, dogs and horses), primates, mice and rats.
- mammal for purposes of treatment refers to any animal classified as a mammal, including humans, rodents ⁇ e.g., mice and rats), and monkeys; domestic and farm animals; and zoo, sports, laboratory, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, etc.
- the mammal is selected from a human, rodent, or monkey.
- “Pharmaceutically acceptable” refers to approved or approvable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.
- “Pharmaceutically acceptable salt” refers to a salt of a compound that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound.
- “Pharmaceutically acceptable excipient, carrier or adjuvant” refers to an excipient, carrier or adjuvant that can be administered to a subject, together with at least one antibody of the present disclosure, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the compound.
- “Pharmaceutically acceptable vehicle” refers to a diluent, adjuvant, excipient, or carrier with which at least one antibody of the present disclosure is administered.
- Providing a prognosis refers to providing information, including for example the presence of cancer cells in a subject's tumor, regarding the impact of the presence of cancer ⁇ e.g., as determined by the diagnostic methods of the present disclosure) on a subject's future health ⁇ e.g., expected morbidity or mortality, the likelihood of getting cancer, and the risk of metastasis).
- Terms such as “treating” or “treatment” or “to treat” or “alleviating” or “to alleviate” refer to both 1 ) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
- those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented.
- Providing a diagnosis” or “diagnostic information” refers to any information, including for example the presence of cancer cells, that is useful in determining whether a patient has a disease or condition and/or in classifying the disease or condition into a phenotypic category or any category having significance with regards to the prognosis of or likely response to treatment (either treatment in general or any particular treatment) of the disease or condition.
- diagnosis refers to providing any type of diagnostic information, including, but not limited to, whether a subject is likely to have a condition (such as a tumor), whether a subject's tumor comprises cancer stem cells, information related to the nature or classification of a tumor as for example a high risk tumor or a low risk tumor, information related to prognosis and/or information useful in selecting an appropriate treatment.
- Selection of treatment can include the choice of a particular chemotherapeutic agent or other treatment modality such as surgery or radiation or a choice about whether to withhold or deliver therapy.
- a "human consensus framework” refers to a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda Md. (1991 ), vols. 1-3.
- the subgroup is subgroup kappa I as in Kabat et al., supra.
- the subgroup is subgroup III as in Kabat et al., supra.
- an "acceptor human framework” for the purposes herein refers to a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
- An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- Antigen-binding site refers to the interface formed by one or more complementary determining regions .
- An antibody molecule has two antigen combining sites, each containing portions of a heavy chain variable region and portions of a light chain variable region. The antigen combining sites can contain other portions of the variable region domains in addition to the CDRs.
- An "antibody light chain” or an “antibody heavy chain” refers to a polypeptide comprising the VL or VH, respectively.
- the VL is encoded by the minigenes V (variable) and J (junctional), and the VH by minigenes V, D (diversity), and J.
- Each of VL or VH includes the CDRs as well as the framework regions.
- antibody light chains and/or antibody heavy chains may, from time to time, be collectively referred to as "antibody chains.”
- antibody chains encompass antibody chains containing mutations that do not disrupt the basic structure of VL or VH, as one skilled in the art will readily recognize.
- Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures.
- native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide bonded. From N- to C-terminus, each heavy chain has a variable region (V H), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CH1 , CH2, and CH3). Similarly, from N- to C- terminus, each light chain has a variable region (V L), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain.
- V H variable region
- V L variable region
- CL constant light domain
- the light chain of an antibody may be assigned to one of two types, called kappa (K) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
- Combinatorial library refers to collections of compounds formed by reacting different combinations of interchangeable chemical "building blocks” to produce a collection of compounds based on permutations of the building blocks.
- the building blocks are the component V, D and J regions (or modified forms thereof) from which antibodies are formed.
- library or “collection” are used interchangeably.
- a “combinatorial antibody library” refers to a collection of antibodies (or portions thereof, such as Fabs), where the antibodies are encoded by nucleic acid molecules produced by the combination of V, D and J gene segments, particularly human V, D and J germline segments.
- the combinatorial libraries herein typically contain at least 50 different antibody (or antibody portions or fragment) members, typically at or about 50, 100, 500, 103, 1 x 103, 2 x 103, 3 x 103, 4x 103, 5 x 103, 6 x 103, 7 x 103, 8 x 103, 9 x 103, 1 x 104, 2 x 104, 3 x 104, 4x 104, 5 x 104, 6 x 104, 7 x 104, 8 x 104, 9 x 104 , 1 x 105, 2 x 105, 3 x 105, 4x 105, 5 x 105, 6 x 105, 7 x 105, 8 x 105, 9 x 105, 106, 107, 108, 109, 1010, or more different members.
- a "human combinatorial antibody library” refers to a collection of antibodies or portions thereof, whereby each member contains a VL and VH chains or a sufficient portion thereof to form an antigen binding site encoded by nucleic acid containing human germline segments produced as described herein.
- a "variable germline segment” refers to V, D and J groups, subgroups, genes or alleles thereof. Gene segment sequences are accessible from known database (e.g., National Center for Biotechnology Information (NCBI), the international ImMunoGeneTics information system® (IMGT), the Kabat database and the Tomlinson's VBase database (Lefranc (2003) Nucleic Acids Res., 31 :307-310; Martin et al., Bioinformatics Tools for Antibody Engineering in Handbook of Therapeutic Antibodies, Wiley-VCH (2007), pp. 104-107). Tables 3-5 list exemplary human variable germline segments.
- germline segments are set forth in SEQ ID NOS: 10-451 and 868.
- a germline segment includes modified sequences thereof, that are modified in accord with the rules of sequence compilation provided herein to permit practice of the method.
- germline gene segments include those that contain one amino acid deletion or insertion at the 5' or 3' end compared to any of the sequences of nucleotides set forth in SEQ ID NOS:10-451 , 868.
- variable heavy chain germline segments are assembled such that the VH segment is 5' to the DH segment which is 5' to the JH segment, thereby resulting in a nucleic acid sequence encoding a VH chain.
- Variable light chain germline segments are assembled such that the VL segment is 5' to the JL segment, thereby resulting in a nucleic acid sequence encoding a VL chain.
- a constant gene segment or segments also can be assembled onto the 3' end of a nucleic acid encoding a VH or VL chain.
- Linkage refers to the joining of germline segments. Linkage can be direct or indirect. Germline segments can be linked directly without additional nucleotides between segments, or additional nucleotides can be added to render the entire segment in- frame, or nucleotides can be deleted to render the resulting segment in-frame. It is understood that the choice of linker nucleotides is made such that the resulting nucleic acid molecule is in-frame and encodes a functional and productive antibody.
- "In-frame” or “linked in-frame” with reference to linkage of human germline segments means that there are insertions and/or deletions in the nucleotide germline segments at the joined junctions to render the resulting nucleic acid molecule in-frame with the 5' start codon (ATG), thereby producing a "productive" or functional full-length polypeptide.
- the choice of nucleotides inserted or deleted from germline segments, particularly at joints joining various VD, DJ and VJ segments, is in accord with the rules provided in the method herein for V(D)J joint generation. For example, germline segments are assembled such that the VH segment is 5' to the DH segment which is 5' to the JH segment.
- nucleotides can be inserted or deleted from the individual VH, DH or JH segments, such that the resulting nucleic acid molecule containing the joined VDJ segments are in-frame with the 5' start codon (ATG).
- a portion of an antibody includes sufficient amino acids to form an antigen binding site.
- a "reading frame” refers to a contiguous and non-overlapping set of three- nucleotide codons in DNA or RNA. Because three codons encode one amino acid, there exist three possible reading frames for given nucleotide sequence, reading frames 1 , 2 or 3. For example, the sequence ACTGGTCA will be ACT GGT CA for reading frame 1 , A CTG GTC A for reading frame 2 and AC TGG TCA for reading frame 3. Generally for practice of the method described herein, nucleic acid sequences are combined so that the V sequence has reading frame 1 .
- a "stop codon” refers to a three-nucleotide sequence that signals a halt in protein synthesis during translation, or any sequence encoding that sequence (e.g. a DNA sequence encoding an RNA stop codon sequence), including the amber stop codon (UAG or TAG)), the ochre stop codon (UAA or TAA)) and the opal stop codon (UGA or TGA)). It is not necessary that the stop codon signal termination of translation in every cell or in every organism. For example, in suppressor strain host cells, such as amber suppressor strains and partial amber suppressor strains, translation proceeds through one or more stop codon (e.g. the amber stop codon for an amber suppressor strain), at least some of the time.
- a stop codon e.g. the amber stop codon for an amber suppressor strain
- VH variable heavy chain or a “variable light” (VL) chain
- VH domain VL domain
- VH domain VL domain
- heavy chain germline segments are designated as VH, DH and JH, and compilation thereof results in a nucleic acid encoding a VH chain.
- Light chain germline segments are designated as VL or JL, and include kappa and lambda light chains (VK and JK; ⁇ and J ⁇ .) and compilation thereof results in a nucleic acid encoding a VL chain. It is understood that a light chain is either a kappa or lambda light chain, but does not include a kappa/lambda combination by virtue of compilation of a VK and ⁇ .
- a "degenerate codon” refers to three-nucleotide codon that specifies the same amino acid as a codon in a parent nucleotide sequence.
- One of skill in the art is familiar with degeneracy of the genetic code and can identify degenerate codons.
- Diversity with respect to members in a collection refers to the number of unique members in a collection. Hence, diversity refers to the number of different amino acid sequences or nucleic acid sequences, respectively, among the analogous polypeptide members of that collection.
- a collection of polynucleotides having a diversity of 104 contains 104 different nucleic acid sequences among the analogous polynucleotide members.
- the provided collections of polynucleotides and/or polypeptides have diversities of at least at or about 102, 103, 104, 105, 106, 107, 108, 109, 1010 or more.
- Sequence diversity refers to a representation of nucleic acid sequence similarity and is determined using sequence alignments, diversity scores, and/or sequence clustering. Any two sequences can be aligned by laying the sequences side-by-side and analyzing differences within nucleotides at every position along the length of the sequences. Sequence alignment can be assessed in silico using Basic Local Alignment Search Tool (BLAST), an NCBI tool for comparing nucleic acid and/or protein sequences. The use of BLAST for sequence alignment is well known to one of skill in the art. The Blast search algorithm compares two sequences and calculates the statistical significance of each match (a Blast score). Sequences that are most similar to each other will have a high Blast score, whereas sequences that are most varied will have a low Blast score.
- BLAST Basic Local Alignment Search Tool
- a "polypeptide domain” refers to a part of a polypeptide (a sequence of three or more, generally 5 or 7 or more amino acids) that is a structurally and/or functionally distinguishable or definable.
- Exemplary of a polypeptide domain is a part of the polypeptide that can form an independently folded structure within a polypeptide made up of one or more structural motifs (e.g. combinations of alpha helices and/or beta strands connected by loop regions) and/or that is recognized by a particular functional activity, such as enzymatic activity or antigen binding.
- a polypeptide can have one, typically more than one, distinct domains.
- the polypeptide can have one or more structural domains and one or more functional domains.
- a single polypeptide domain can be distinguished based on structure and function.
- a domain can encompass a contiguous linear sequence of amino acids.
- a domain can encompass a plurality of noncontiguous amino acid portions, which are non-contiguous along the linear sequence of amino acids of the polypeptide.
- a polypeptide contains a plurality of domains.
- each heavy chain and each light chain of an antibody molecule contains a plurality of immunoglobulin (Ig) domains, each about 1 10 amino acids in length.
- Ig domain refers to a domain, recognized as such by those in the art, that is distinguished by a structure, called the Immunoglobulin (Ig) fold, which contains two beta-pleated sheets, each containing anti-parallel beta strands of amino acids connected by loops. The two beta sheets in the Ig fold are sandwiched together by hydrophobic interactions and a conserved intra-chain disulfide bond. Individual immunoglobulin domains within an antibody chain further can be distinguished based on function. For example, a light chain contains one variable region domain (VL) and one constant region domain (CL), while a heavy chain contains one variable region domain (VH) and three or four constant region domains (CH). Each VL, CL, VH, and CH domain is an example of an immunoglobulin domain.
- VL variable region domain
- CL constant region domain
- CH constant region domain
- variable domain refers to a specific Ig domain of an antibody heavy or light chain that contains a sequence of amino acids that varies among different antibodies.
- Each light chain and each heavy chain has one variable region domain (VL, and, VH).
- VL, and, VH variable region domain
- the variable domains provide antigen specificity, and thus are responsible for antigen recognition.
- Each variable region contains CDRs that are part of the antigen binding site domain and framework regions (FRs).
- a "constant region domain” refers to a domain in an antibody heavy or light chain that contains a sequence of amino acids that is comparatively more conserved among antibodies than the variable region domain.
- Each light chain has a single light chain constant region (CL) domain and each heavy chain contains one or more heavy chain constant region (CH) domains, which include, CH1 , CH2, CH3 and CH4.
- CH1 , CH2, CH3 and CH4 Full-length IgA, IgD and IgG isotypes contain CH1 , CH2 CH3 and a hinge region, while IgE and IgM contain CH1 , CH2 CH3 and CH4.
- CH 1 and CL domains extend the Fab arm of the antibody molecule, thus contributing to the interaction with antigen and rotation of the antibody arms.
- Antibody constant regions can serve effector functions, such as, but not limited to, clearance of antigens, pathogens and toxins to which the antibody specifically binds, e.g. through interactions with various cells, biomolecules and tissues.
- an "antibody or portion thereof that is sufficient to form an antigen binding site” means that the antibody or portion thereof contains at least 1 or 2, typically 3, 4, 5 or all 6 CDRs of the VH and VL sufficient to retain at least a portion of the binding specificity of the corresponding full-length antibody containing all 6 CDRs.
- a sufficient antigen binding site at least requires CDR3 of the heavy chain (CDRH3). It typically further requires the CDR3 of the light chain (CDRL3).
- CDRH3 heavy chain
- CDRL3 CDR3 of the light chain
- CDR-LI corresponds to residues L24-L34
- CDR-L2 corresponds to residues L50-L56
- CDR-L3 corresponds to residues L89-L97
- CDR-H1 corresponds to residues H31 - H35, 35a or 35b depending on the length
- CDR-H2 corresponds to residues H50-H65
- CDR-H3 corresponds to residues H95-H102.
- a "peptide mimetic” refers to a peptide that mimics the activity of a polypeptide.
- an erythropoietin (EPO) peptide mimetic is a peptide that mimics the activity of Epo, such as for binding and activation of the EPO receptor.
- An "address” refers to a unique identifier for each locus in a collection whereby an addressed member (e.g. an antibody) can be identified.
- An addressed moiety is one that can be identified by virtue of its locus or location. Addressing can be effected by position on a surface, such as a well of a microplate. For example, an address for a protein in a microwell plate that is F9 means that the protein is located in row F, column 9 of the microwell plate. Addressing also can be effected by other identifiers, such as a tag encoded with a bar code or other symbology, a chemical tag, an electronic, such RF tag, a color-coded tag or other such identifier.
- An "array” refers to a collection of elements, such as antibodies, containing three or more members.
- spatial array refers to an array where members are separated or occupy a distinct space in an array.
- spatial arrays are a type of addressable array.
- Examples of spatial arrays include microtiter plates where each well of a plate is an address in the array.
- Spacial arrays include any arrangement wherein a plurality of different molecules, e.g., polypeptides, are held, presented, positioned, situated, or supported.
- arrays can include microtiter plates, such as 48-well, 96-well, 144-well, 192- well, 240-well, 288-well, 336-well, 384-well, 432-well, 480-well, 576-well, 672-well, 768- well, 864-well, 960-well, 1056-well, 1 152-well, 1248-well, 1344-well, 1440-well, or 1536- well plates, tubes, slides, chips, flasks, or any other suitable laboratory apparatus.
- arrays can also include a plurality of sub-arrays. A plurality of sub-arrays encompasses an array where more than one arrangement is used to position the polypeptides.
- an "addressable library” or “spatially addressed library” refers to a collection of molecules such as nucleic acid molecules or protein agents, such as antibodies, in which each member of the collection is identifiable by virtue of its address.
- An "addressable array” refers to one in which the members of the array are identifiable by their address, the position in a spatial array, such as a well of a microtiter plate, or on a solid phase support, or by virtue of an identifiable or detectable label, such as by color, fluorescence, electronic signal (i.e. RF, microwave or other frequency that does not substantially alter the interaction of the molecules of interest), bar code or other symbology, chemical or other such label.
- a spatial array such as a well of a microtiter plate, or on a solid phase support
- an identifiable or detectable label such as by color, fluorescence, electronic signal (i.e. RF, microwave or other frequency that does not substantially alter the interaction of the molecules of interest), bar code or other symbology, chemical or other such label.
- the members of the array are located at identifiable loci on the surface of a solid phase or directly or indirectly linked to or otherwise associated with the identifiable label, such as affixed to a microsphere or other particulate support (herein referred to as beads) and suspended in solution or spread out on a surface.
- a microsphere or other particulate support herein referred to as beads
- An addressable combinatorial antibody library refers to a collection of antibodies in which member antibodies are identifiable and all antibodies with the same identifier, such as position in a spatial array or on a solid support, or a chemical or RF tag, bind to the same antigen, and generally are substantially the same in amino acid sequence.
- identifier such as position in a spatial array or on a solid support, or a chemical or RF tag
- reference to an "addressable arrayed combinatorial antibody library” means that the antibody members are addressed in an array.
- the antibody members of a library can be designed using a computer program that selects component V, D and J germline segments from among those input into the computer and joins them in-frame to output a list of nucleic acid molecules for synthesis.
- the recombination of the components of the antibodies in the collections or libraries provided herein can be performed in silico by combining the nucleotide sequences of each building block in accord with software that contains rules for doing so. The process could be performed manually without a computer, but the computer provides the convenience of speed.
- a “database” refers to a collection of data items.
- reference to a database is typically with reference to antibody databases, which provide a collection of sequence and structure information for antibody genes and sequences.
- Exemplary antibody databases include, but are not limited to, IMGT®, the international ImMunoGeneTics information system (imgt.cines.fr; see e.g., Lefranc et al. (2008) Briefings in Bioinformatics, 9:263-275), National Center for Biotechnology Information (NCBI), the Kabat database and the Tomlinson's VBase database (Lefranc (2003) Nucleic Acids Res.,
- a database also can be created by a user to include any desired sequences.
- the database can be created such that the sequences are inputted in a desired format (e.g., in a particular reading frame; lacking stop codons; lacking signal sequences).
- the database also can be created to include sequences in addition to antibody sequences.
- Screening refers to identification or selection of an antibody or portion thereof from a collection or library of antibodies and/or portions thereof, based on determination of the activity or property of an antibody or portion thereof. Screening can be performed in any of a variety of ways, including, for example, by assays assessing direct binding (e.g. binding affinity) of the antibody to a target protein or by functional assays assessing modulation of an activity of a target protein.
- Activity towards a target protein refers to binding specificity and/or modulation of a functional activity of a target protein, or other measurements that reflects the activity of an antibody or portion thereof towards a target protein.
- a "target protein” refers to candidate proteins or peptides that are specifically recognized by an antibody or portion thereof and/or whose activity is modulated by an antibody or portion thereof.
- a target protein includes any peptide or protein that contains an epitope for antibody recognition.
- Target proteins include proteins involved in the etiology of a disease or disorder by virtue of expression or activity. Exemplary target proteins are described herein.
- Hide refers to an antibody or portion thereof identified, recognized or selected as having an activity in a screening assay.
- "Iterative" with respect to screening means that the screening is repeated a plurality of times, such as 2, 3, 4, 5 or more times, until a "Hit” is identified whose activity is optimized or improved compared to prior iterations.
- High-throughput refers to a large-scale method or process that permits manipulation of large numbers of molecules or compounds, generally tens to hundred to thousands of compounds. For example, methods of purification and screening can be rendered high-throughput. High-throughput methods can be performed manually.
- high-throughput methods involve automation, robotics or software.
- Basic Local Alignment Search Tool is a search algorithm developed by Altschul et al. (1990) to separately search protein or DNA databases, for example, based on sequence identity.
- blastn is a program that compares a nucleotide query sequence against a nucleotide sequence database (e.g. GenBank).
- BlastP is a program that compares an amino acid query sequence against a protein sequence database.
- a BLAST bit score is a value calculated from the number of gaps and substitutions associated with each aligned sequence. The higher the score, the more significant the alignment.
- a "human protein” refers to a protein encoded by a nucleic acid molecule, such as DNA, present in the genome of a human, including all allelic variants and conservative variations thereof.
- a variant or modification of a protein is a human protein if the modification is based on the wildtype or prominent sequence of a human protein.
- Naturally occurring amino acids refer to the 20 L-amino acids that occur in polypeptides. The residues are those 20 oamino acids found in nature which are incorporated into protein by the specific recognition of the charged tRNA molecule with its cognate mRNA codon in humans.
- Non-naturally occurring amino acids refer to amino acids that are not genetically encoded.
- a non-natural amino acid is an organic compound that has a structure similar to a natural amino acid but has been modified structurally to mimic the structure and reactivity of a natural amino acid.
- Non-naturally occurring amino acids thus include, for example, amino acids or analogs of amino acids other than the 20 naturally-occurring amino acids and include, but are not limited to, the D-isostereomers of amino acids.
- Exemplary non-natural amino acids are known to those of skill in the art.
- Nucleic acids include DNA, RNA and analogs thereof, including peptide nucleic acids (PNA) and mixtures thereof. Nucleic acids can be single or double-stranded.
- probes or primers which are optionally labeled, such as with a detectable label, such as a fluorescent or radiolabel, single-stranded molecules are contemplated. Such molecules are typically of a length such that their target is statistically unique or of low copy number (typically less than 5, generally less than 3) for probing or priming a library.
- a probe or primer contains at least 14, 16 or 30 contiguous nucleotides of sequence complementary to or identical to a gene of interest. Probes and primers can be 10, 20, 30, 50, 100 or more nucleic acids long.
- a "peptide” refers to a polypeptide that is from 2 to 40 amino acids in length.
- amino acids which occur in the various sequences of amino acids provided herein are identified according to their known, three-letter or one-letter abbreviations (Table 1 ).
- the nucleotides which occur in the various nucleic acid fragments are designated with the standard single-letter designations used routinely in the art.
- An "amino acid” is an organic compound containing an amino group and a carboxylic acid group.
- a polypeptide contains two or more amino acids.
- amino acids include the twenty naturally-occurring amino acids, non-natural amino acids and amino acid analogs (i.e., amino acids wherein the ocarbon has a side chain).
- amino acid residue refers to an amino acid formed upon chemical digestion (hydrolysis) of a polypeptide at its peptide linkages.
- the amino acid residues described herein are presumed to be in the "L” isomeric form. Residues in the "D" isomeric form, which are so designated, can be substituted for any L-amino acid residue as long as the desired functional property is retained by the polypeptide.
- NH2 refers to the free amino group present at the amino terminus of a polypeptide.
- COOH refers to the free carboxy group present at the carboxyl terminus of a polypeptide.
- amino acid residue sequences represented herein by formulae have a left to right orientation in the conventional direction of amino- terminus to carboxyl-terminus.
- amino acid residue is broadly defined to include the amino acids listed in the Table of Correspondence (Table 1 ) and modified and unusual amino acids, such as those referred to in 37 C.F.R. ⁇ 1 .821 -1 .822, and incorporated herein by reference.
- a dash at the beginning or end of an amino acid residue sequence indicates a peptide bond to a further sequence of one or more amino acid residues, to an amino-terminal group such as NH2 or to a carboxyl-terminal group such as COOH.
- L-amino acid is identified by the standard three letter code (or single letter code) or the standard three letter code (or single letter code) with the prefix "L-"; the prefix "D-" indicates that the stereoisomeric form of the amino acid is D.
- an “immunoconjugate” refers to an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
- An immunoconjugate may include non-antibody sequences.
- Kb kilobases
- bp base pairs
- Kb kilobases
- bp base pairs
- kD kilo-Daltons
- Proteins sizes are estimated from gel electrophoresis, from sequenced proteins, from derived amino acid sequences, or from published protein sequences.
- Oligonucleotides that are not commercially available can be chemically synthesized according to the solid phase phosphoramidite triester method first described by Beaucage and Caruthers, Tetrahedron Letters, 22:1859-1862 (1981 ), using an automated synthesizer, as described in Van Devanter et al., Nucleic Acids Res., 12:6159- 6168 (1984). Purification of oligonucleotides is by either native polyacrylamide gel electrophoresis or by anion-exchange chromatography as described in Pearson & Reanier, J. Chrom., 255:137-149 (1983).
- sequence of the cloned genes and synthetic oligonucleotides can be verified after cloning using, e.g., the chain termination method for sequencing double-stranded templates of Wallace et al., Gene, 16:21-26 (1981 ).
- the nucleic acids encoding recombinant polypeptides of the present disclosure may be cloned into an intermediate vector before transformation into prokaryotic or eukaryotic cells for replication and/or expression.
- the intermediate vector may be a prokaryote vector such as a plasmid or shuttle vector.
- cattle are the only species where ultralong CDR3 sequences have been identified.
- other species for example other ruminants, may also possess antibodies with ultralong CDR3 sequences.
- CDR3 sequence identified in cattle include those designated as: BLV1 H12 (see, SEQ ID NO:
- BLV5B8 see, SEQ ID NO: 23
- BLV5D3 see, SEQ ID NO: 24
- BLV8C1 1 see, SEQ ID NO: 25
- bovine antibodies are identified and humanized.
- Antibodies of the present disclosure may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al.
- repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et
- Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Phage display libraries of bovine antibodies may be a source of bovine antibody gene sequences, including ultralong CDR3 sequences.
- a non-human antibody is humanized to reduce imrnunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
- a humanized antibody comprises one or more variable domains in which CDRs (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
- a humanized antibody optionally will also comprise at least a portion of a human constant region.
- some FR residues in a humanized antibody are substituted with corresponding residues from a non- human antibody (e.g., the antibody from which the CDR residues are derived), e.g., to restore or improve antibody specificity or affinity.
- Human variable region framework sequences that may be used for humanization include but are not limited to: framework sequences selected using the "best- fit" method (see, e.g., Sims et al. J. Immunol. 151 :2296 (1993)); framework sequences derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J.
- Humanized antibodies with ultralong CDR3 sequences may also include engineered non-antibody sequences, such as cytokines or growth factors, into the CDR3 region, such that the resultant humanized antibody is effective, for example, in inhibiting tumor metastasis.
- Non-antibody sequences may include an interleukin sequence, a hormone sequence, a cytokine sequence, a toxin sequence, a lymphokine sequence, a growth factor sequence, a chemokine sequence, or combinations thereof.
- Non-antibody sequences may be human, non-human, or synthetic.
- the cytokine or growth factor may be shown to have an antiproliferative effect on at least one cell population.
- Such cytokines, lymphokines, growth factors, or other hematopoietic factors include M-CSF, GM-CSF, TNF, IL-1 , IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-1 1 , IL-12, IL-13, IL-14, IL-15, IL-16, IL-1 , IL-18, IFN, TNFol , TNF1 , TNF2, G-CSF, Meg-CSF, GM-CSF, thrombopoietin, stem cell factor, and erythropoietin.
- Additional growth factors for use in humanized antibodies and/or pharmaceutical compositions of the present disclosure include: angiogenin, bone morphogenic protein-1 , bone morphogenic protein-2, bone morphogenic protein-3, bone morphogenic protein-4, bone morphogenic protein-5, bone morphogenic protein-6, bone morphogenic protein-7, bone morphogenic protein-8, bone morphogenic protein-9, bone morphogenic protein-10, bone morphogenic protein-1 1 , bone morphogenic protein-12, bone morphogenic protein-13, bone morphogenic protein-14, bone morphogenic protein-15, bone morphogenic protein receptor IA, bone morphogenic protein receptor IB, brain derived neurotrophic factor, ciliary neutrophic factor, ciliary neutrophic factor receptor, cytokine-induced neutrophil chemotactic factor 1 , cytokine- induced neutrophil, chemotactic factor 2, cytokine-induced neutrophil chemotactic factor 2, endothelial cell growth factor, endothelin 1 , epidermal growth factor, epithelial-
- Exemplary hormone sequences include a glucagon-like peptide-1 (GLP-1 ), Melatonin (MT), Thyroxine (T4), Triiodothyronine (T3), Adrenaline (EPI), Noradrenaline (NRE), Dopamine (DA), Antimullerian Hormone, Adrenocorticotropic (ACTH), Angiotensin (AGT), Antidiuretic Hormone (ADH), Calcitonin (CT), Cholecystokinin (CCK), Corticotropin-releasing hormone (CRH), Erythropoietin (EPO), FollicLe-Stimulating Hormone (FSH), Gastrin (GRP), Ghrelin, Glucagon (GCG), Gonadotropin-releasing Hormone (GnRH), Growth-Hormone Releasing Hormone (GNRH), Human Chorionic Gonadotropin (hCG), Growth Hormone (GH), Insulin (INS), Insu
- Exemplary toxin sequences include an ADWX-1 sequence, an HsTxl sequence, an OSK1 sequence, a Pi2 sequence, a Hongotoxin (HgTX) sequence, a Margatoxin sequence, an Agitoxin-2 sequence, a Pi3 sequence, a Kaliotoxin sequence, an Anuroctoxin sequence, a Charybdotoxin sequence, a Tityustoxin -K- alpha sequence, a Maurotoxin sequence, a Ceratotoxin 1 (CcoTxl ) sequence, a CcoTx2 sequence, a CcoTx3 sequence, a Phrixotoxin 3 (PaurTx3) sequence, a Hanatoxin 1 sequence, a Phrixotoxin 1 sequence, a Huwentoxin- IV sequence, an oconotoxin Iml sequence, an oconotoxin Epl sequence, an oconotoxin PnIA sequence, an oconot
- Exemplary toxin sequences include SEQ ID NOS: 475-481 , 599-655, 666-698, 727-733, 808-810 and 831-835 (see, e.g., Figures 17).
- Exemplary non-antibody sequences include interleukin 8 (IL-8, SEQ ID NO: 475), interleukin 21 (IL-21 , SEQ ID NO: 480), CXCL12/SDF-1 alpha (SEQ ID NO: 479), somatostain (SEQ ID NO: 477), ProTx-ll (SEQ I D NO: 481 ), chlorotoxin (SEQ ID NO: 478), and ziconotide (SEQ ID NO: 476).
- a non-human antibody may be humanized to reduce imrnunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
- a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
- HVRs e.g., CDRs
- FRs or portions thereof
- a humanized antibody optionally will also comprise at least a portion of a human constant region.
- some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody ⁇ e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
- the humanized antibodies comprising an ultralong CDR3 as disclosed herein are preferably monoclonal. Also encompassed within the scope of the disclosure are Fab, Fab', Fab'-SH and F(ab') 2 fragments of the humanized antibodies comprising an ultralong CDR3 as provided herein. These antibody fragments can be created by traditional means, such as enzymatic digestion, or may be generated by recombinant techniques. Such antibody fragments may be chimeric or humanized. These fragments are useful for the diagnostic and therapeutic purposes set forth below.
- Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, e.g., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Thus, the modifier "monoclonal" indicates the character of the antibody as not being a mixture of discrete antibodies.
- the humanized antibodies comprising an ultralong CDR3 as disclosed herein can be made using a hybridoma cell-based method first described by Kohler ef a/., Nature, 256:495 (1975), or may be made by recombinant DNA methods.
- Hybridoma cells can be generated by fusing B cells producing a desired antibody with an immortalized cell line, usually a myeloma cell line, so that the resulting fusion cells will be an immortalized cell line that secrets a particular antibody.
- myeloma cells can be first transfected with a nucleic acid encoding a germline antibody V region and can be screened for the expression of the germline V region. Those myeloma cells with highest level of proteolytic light chain expression can be subsequently fused with B cells that produce an antibody with desired target protein specificity.
- the fusion cells will produce two types of antibodies: one is a heterologous antibody containing an endogenous antibody chain (either heavy or light) operably joined to the recombinant germline V region (either heavy or light), and the other is the same antibody that the parental B cells would secrete (e.g. both endogenous heavy and light chains).
- the operably joined heterologous heavy and light chains can be isolated by conventional methods such as chromatography and identification can be confirmed by target protein binding assays, assays identifying a unique tag of the germline polypeptide, or endopeptidase activity assays described in other sections of this disclosure. In some cases, where the heterologous antibody is the predominant type in quantity among the two types of antibodies, such isolation may not be needed.
- the hybridoma cells may be seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
- a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
- the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
- Preferred myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium.
- myeloma cell lines may be murine myeloma lines, such as those derived from MOPC-21 and MPC-1 1 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, Calif. USA, and SP-2 or X63-Ag8-653 cells available from the American Type Culture Collection, Rockville, Md. USA.
- Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J.
- Culture medium in which hybridoma cells are growing is assayed for production of humanized antibodies comprising an ultralong CDR3.
- the binding specificity of monoclonal antibodies produced by hybridoma cells may be determined by immunoprecipitation or by an in vitro binding assay, such as an enzyme- linked immunoadsorbent assay (ELISA).
- ELISA enzyme- linked immunoadsorbent assay
- the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson et al., Anal. Biochem., 107:220 (1980).
- the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (Academic Press, 1986)). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium.
- the hybridoma cells may be grown in vivo as ascites tumors in an animal.
- the monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- the humanized antibodies comprising an ultralong CDR3 as disclosed herein may be made by using combinatorial libraries to screen for synthetic antibody clones with the desired activity or activities.
- synthetic antibody clones are selected by screening phage libraries containing phage that display various fragments of antibody variable regions ⁇ e.g., scFv or Fab) fused to phage coat protein.
- phage libraries may be panned, for example, by affinity chromatography against the desired antigen.
- Clones expressing antibody fragments capable of binding to the desired antigen may be adsorbed to the antigen and thus separated from the non-binding clones in the library.
- the binding clones may then be eluted from the antigen, and can be further enriched by additional cycles of antigen adsorption/elution.
- Any of the humanized antibodies comprising an ultralong CDR3 as disclosed herein may be obtained by designing a suitable antigen screening procedure to select for the phage clone of interest followed by construction of a full length antibody comprising an ultralong CDR3 clone using the VH and VL ⁇ e.g., from scFv or Fab) sequences from the phage clone of interest and suitable constant region (Fc) sequences described in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda Md. (1991 ), vols. 1-3.
- the antigen-binding domain of an antibody is formed from two variable (V) regions, one each from the light (VL) and heavy (VH) chains, that both present three hypervariable loops or complementarity-determining regions (CDRs).
- Variable domains may be displayed functionally on phage, either as single-chain Fv (scFv, also referred to as single-chain antibody (SCA)) fragments, in which VH and VL are covalently linked through a short, flexible peptide, or as Fab fragments, in which they are each fused to a constant domain and interact non-covalently, as described in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994).
- scFv or SCA encoding phage clones and Fab encoding phage clones may be separately or collectively referred to as "Fv phage clones" or "Fv clones”.
- Repertoires of VH and VL genes may be separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be searched for antigen-binding clones as described in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994).
- Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
- the naive repertoire may be cloned to provide a single source of human antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al., EMBO J. 12: 725-734 (1993).
- naive libraries can also be made synthetically by cloning the unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro as described by Hoogenboom and Winter, J. Mol. Biol., 227: 381 -388 (1992).
- Filamentous phage is used to display antibody fragments by fusion to the minor coat protein pill.
- Protein pill may include truncated forms of pill.
- the antibody fragments can be displayed as single chain Fv fragments, in which VH and VL domains are connected on the same polypeptide chain by a flexible polypeptide spacer, ⁇ e.g., as described by Marks et al., J. Mol.
- VH and VL segments are recovered from the cells of interest and and may be amplified or copies made by recombinant DNA techniques ⁇ e.g., Kunkel mutagenesis).
- the desired DNA may be obtained by isolating genomic DNA or mRNA from lymphocytes followed by polymerase chain reaction (PCR) with primers matching the 5' and 3' ends of rearranged VH and VL genes as described in Orlandi et al., Proc. Natl. Acad. Sci. (USA), 86: 3833-3837 (1989), thereby making diverse V gene repertoires for expression.
- the V genes may be amplified from cDNA and genomic DNA, with back primers at the 5' end of the exon encoding the mature V-domain and forward primers based within the J-segment as described in Orlandi et al. (1989) and in Ward et al., Nature, 341 : 544-546 (1989).
- back primers can also be based in the leader exon as described in Jones et al., Biotechnol., 9: 88-89 (1991 ), and forward primers within the constant region as described in Sastry et al., Proc. Natl. Acad. Sci. (USA), 86: 5728-5732 (1989).
- degeneracy may be incorporated in the primers as described in Orlandi et al. (1989) or Sastry et al. (1989).
- Library diversity may be enhanced or maximized by using PCR primers targeted to each V-gene family in order to amplify available VH and VL arrangements present in the immune cell nucleic acid sample, for example, as described in the method of Marks et al., J. Mol. Biol., 222: 581 -597 (1991 ) or as described in the method of Orum et al., Nucleic Acids Res., 21 : 4491 -4498 (1993).
- rare restriction may be introduced within the PCR primer as a tag at one end as described in Orlandi et al. (1989), or by further PCR amplification with a tagged primer as described in Clackson et al., Nature, 352: 624-628 (1991 ).
- Repertoires of synthetically rearranged V genes may be derived in vitro from V gene segments. Most of the human VH-gene segments have been cloned and sequenced ⁇ e.g., reported in Tomlinson et al., J. Mol. Biol., 227: 776-798 (1992)), and mapped ⁇ e.g., reported in Matsuda et al., Nature Genet., 3: 88-94 (1993); these cloned segments (including all the major conformations of the H 1 and H2 loop) may be used to generate diverse VH gene repertoires with PCR primers encoding H3 loops of diverse sequence and length as described in Hoogenboom and Winter, J. Mol.
- VH repertoires may also be made with all the sequence diversity focused in a long H3 loop of a single length as described in Barbas et al., Proc. Natl. Acad. Sci. USA, 89: 4457-4461 (1992).
- Human VK and VA. segments have been cloned and sequenced (reported in Williams and Winter, Eur. J. Immunol., 23: 1456-1461 (1993)) and can be used to make synthetic light chain repertoires.
- Synthetic V gene repertoires based on a range of VH and VL folds, and L3 and H3 lengths, will encode antibodies of considerable structural diversity.
- germline V-gene segments can be rearranged in vitro according to the methods of Hoogenboom and Winter, J. Mol. Biol., 227: 381 -388 (1992).
- Repertoires of antibody fragments may be constructed by combining
- VH and VL gene repertoires together in several ways. Each repertoire may be created in different vectors, and the vectors recombined in vitro, for example, as described in Hogrefe et al., Gene, 128: 1 19-126 (1993), or in vivo by combinatorial infection, for example, the ⁇ system described in Waterhouse et al., Nucl. Acids Res., 21 : 2265-2266 (1993).
- the in vivo recombination approach exploits the two-chain nature of Fab fragments to overcome the limit on library size imposed by E. coli transformation efficiency.
- Naive VH and VL repertoires are cloned separately, one into a phagemid and the other into a phage vector.
- the two libraries are then combined by phage infection of phagemid-containing bacteria so that each cell contains a different combination and the library size is limited only by the number of cells present (about 10 12 clones).
- Both vectors contain in vivo recombination signals so that the VH and VL genes are recombined onto a single replicon and are co-packaged into phage virions.
- These large libraries may provide large numbers of diverse antibodies of good affinity (K d "1 of about 10 "8 M).
- the repertoires may be cloned sequentially into the same vector, for example, as described in Barbas et al., Proc. Natl. Acad. Sci. USA, 88: 7978-7982 (1991 ), or assembled together by PCR and then cloned, for example, as described in Clackson et al., Nature, 352: 624-628 (1991 ).
- PCR assembly may also be used to join VH and VL DNAs with DNA encoding a flexible peptide spacer to form single chain Fv (scFv) repertoires.
- in cell PCR assembly may be used to combine VH and VL genes within lymphocytes by PCR and then clone repertoires of linked genes as described in Embleton et al., Nucl. Acids Res., 20: 3831 -3837 (1992).
- the antibodies produced by naive libraries can be of moderate affinity (K d "1 of about 10 6 to 10 7 M “1 ), but affinity maturation may also be mimicked in vitro by constructing and reselecting from secondary libraries as described in Winter et al. (1994), supra.
- mutation can be introduced at random in vitro by using error-prone polymerase (reported in Leung et al., Technique, 1 : 1 1 -15 (1989)) in the method of Hawkins et al., J. Mol. Biol., 226: 889-896 (1992) or in the method of Gram et al., Proc. Natl. Acad. Sci.
- affinity maturation may be performed by randomly mutating one or more CDRs, for example, using PCR with primers carrying random sequence spanning the CDR of interest, in selected individual Fv clones and screening for higher affinity clones.
- WO 9607754 described a method for inducing mutagenesis in a complementarity determining region of an immunoglobulin light chain to create a library of light chain genes.
- the phage library samples are contacted with an immobilized protein under conditions suitable for binding of at least a portion of the phage particles with the adsorbent. Normally, the conditions, including pH, ionic strength, temperature and the like are selected to mimic physiological conditions.
- the phages bound to the solid phase are washed and then eluted by acid, e.g., as described in Barbas et al., Proc. Natl. Acad. Sci. USA, 88: 7978-7982 (1991 ), or by alkali, (e.g., as described in Marks et al., J. Mol. Biol., 222: 581-597 (1991 )), or by antigen competition, (e.g., in a procedure similar to the antigen competition method of Clackson et al., Nature, 352: 624-628 (1991 )).
- Phages may be enriched 20-1 ,000-fold in a single round of selection.
- the enriched phages may be grown in bacterial culture and subjected to further rounds of selection.
- the efficiency of selection depends on many factors, including the kinetics of dissociation during washing, and whether multiple antibody fragments on a single phage can simultaneously engage with antigen.
- Antibodies with fast dissociation kinetics (and weak binding affinities) may be retained by use of short washes, multivalent phage display and high coating density of antigen in solid phase. The high density not only stabilizes the phage through multivalent interactions, but favors rebinding of phage that has dissociated.
- DNA encoding the hybridoma-derived monoclonal antibodies or phage display Fv clones disclosed herein is readily isolated and sequenced using conventional procedures ⁇ e.g., by using oligonucleotide primers designed to specifically amplify the heavy and light chain coding regions of interest from hybridoma or phage DNA template).
- the DNA can be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of the desired monoclonal antibodies in the recombinant host cells.
- DNA encoding Fv clones as disclosed herein may be combined with known DNA sequences encoding heavy chain and/or light chain constant regions (e.g., the appropriate DNA sequences can be obtained from Kabat et al., supra) to form clones encoding full or partial length heavy and/or light chains.
- constant regions of any isotype can be used for this purpose, including IgG, IgM, IgA, IgD, and IgE constant regions, and that such constant regions may be obtained from any human or animal species.
- a Fv clone derived from the variable domain DNA of one animal (such as human) species and then fused to constant region DNA of another animal species to form coding sequence(s) for "hybrid", full length heavy chain and/or light chain is included in the definition of "chimeric” and "hybrid” antibody as used herein.
- aFv clone derived from human variable DNA is fused to human constant region DNA to form coding sequence(s) for all human, full or partial length heavy and/or light chains.
- DNA encoding a humanized antibody comprising an ultralong CDR3 derived from a hybridoma disclosed herein may also be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of homologous murine sequences derived from the hybridoma clone ⁇ e.g., as in the method of Morrison et al., Proc. Natl. Acad. Sci. USA, 81 : 6851-6855 (1984)).
- DNA encoding a hybridoma or Fv clone-derived antibody or fragment can be further modified by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
- chimeric or “hybrid” antibodies are prepared that have the binding specificity of the Fv clone or hybridoma clone-derived antibodies disclosed herein.
- the present disclosure provides antibody genes and proteins including, for example, humanized antibody genes or proteins that comprise an ultralong CDR3 sequence and/or a CDR3 scaffold.
- the present disclosure additionally provides VH, DH, and JH sequences useful in the preparation of ultralong CDR3 sequences.
- Such sequences may comprise motifs (e.g., cysteine motifs) as described herein including those as described in the many embodiments disclosed herein.
- the antibodies disclosed herein may selectively or specifically bind to an epitope of a target protein.
- the antibody may be an antagonist (e.g., blocking) antibody or an agonist antibody.
- variable region of the heavy and light chains are encoded by multiple germline gene segments separated by non-coding regions, or introns, and often are present on different chromosomes.
- the genes for the human immunoglobulin heavy chain region contains approximately 65 variable (VH) genes, 27 Diversity (DH) genes, and 6 Joining (JH) genes.
- the human kappa ( ⁇ ) and lambda ( ⁇ ) light chains are also each encoded by a similar number of VL and JL gene segments, but do not include any D gene segments.
- Exemplary VH, DH, JH and VL (VK or ⁇ ) and JL (JK or ⁇ ) germline gene segments are set forth in WO 2010/054007.
- ⁇ heavy chain that gets expressed on the surface of a pre- B cell and transmits a signal to shut off further heavy chain recombination, thereby preventing expression of the allelic heavy chain locus.
- the surface-expressed ⁇ heavy chain also acts to activate the kappa ( ⁇ ) locus for rearrangement.
- the lambda ( ⁇ ) locus is only activated for rearrangement if the ⁇ recombination is unproductive on both loci.
- the light chain rearrangement events are similar to the heavy chain, except that only the VL and JL segments are recombined. Before primary transcription of each, the corresponding constant chain gene is added. Subsequent transcription and RNA splicing leads to mRNA that is translated into an intact light chain or heavy chain.
- variable regions of antibodies confer antigen binding and specificity due to recombination events of individual germline V, D and J segments, whereby the resulting recombined nucleic acid sequences encoding the variable region domains differ among antibodies and confer antigen-specificity to a particular antibody.
- the variation is limited to three complementarity determining regions (CDR1 , CDR2, and CDR3) found within the N-terminal domain of the heavy (H) and (L) chain variable regions.
- the CDRs are interspersed with regions that are more conserved, termed "framework regions" (FR).
- FR framework regions
- Each VH and VL is typically composed of three CDRs and four FRs arranged from the amino terminus to carboxy terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3 and FR4. Sequence variability among VL and VH domains is generally limited to the CDRs, which are the regions that form the antigen binding site.
- VH genes encode the N-terminal three framework regions, the first two complete CDRs and the first part of the third CDR), the DH gene encodes the central portion of the third CDR, and the JH gene encodes the last part of the third CDR and the fourth framework region.
- VL genes encode the first CDR and second CDR.
- the third CDR (CDRL3) is formed by the joining of the VL and JL gene segments. Hence, CDRs 1 and 2 are exclusively encoded by germline V gene segment sequences.
- VH and VL chain CDR3s form the center of the Ag-binding site, with CDRs 1 and 2 form the outside boundaries; the FRs support the scaffold by orienting the H and L CDRs.
- an antigen binding site typically requires at least four of the CDRs make contact with the antigen's epitope, with CDR3 of both the heavy and light chain being the most variable and contributing the most specificity to antigen binding (see, e.g., Janis Kuby, Immunology, Third Edition, New York, W.H. Freeman and Company, 1998, pp. 1 15-1 18).
- CDRH3 which includes all of the D gene segment, is the most diverse component of the Ab-binding site, and typically plays a critical role in defining the specificity of the Ab. In addition to sequence variation, there is variation in the length of the CDRs between the heavy and light chains.
- the constant regions are encoded by sequences that are more conserved among antibodies. These domains confer functional properties to antibodies, for example, the ability to interact with cells of the immune system and serum proteins in order to cause clearance of infectious agents. Different classes of antibodies, for example IgM, IgD, IgG, IgE and IgA, have different constant regions, allowing them to serve distinct effector functions.
- Antibodies include bovine antibody BLVH12 (e.g., heavy chain variable region set forth in SEQ ID NO: 482, and light chain variable region set forth in SEQ ID NO: 483); and bovine antibody BLV5B8 (e.g., heavy chain variable region set forth in SEQ ID NO: 484, and light chain variable region set forth in SEQ ID NO: 485) Antibody Fragments
- the present disclosure encompasses antibody fragments.
- antibody fragments include, but are not limited to, Fab, Fab', Fab'-SH, F(ab')2, Fv, and scFv fragments, and other fragments described below.
- Fab fragment antigen
- Fab' fragment antigen binding domain
- Fab'-SH fragment antigen binding domain antigen binding domain antigen binding domain antigen binding domain antigen binding domain antigen binding domain antigen binding domains
- F(ab')2 Fv
- scFv fragments fragments.
- scFv fragments see, e.g., Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol.
- Diabodies are antibody fragments with two antigen binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01 161 ; Hudson et ai., Nat. Med. 9:129-134 (2003); and Hollinger et ai, Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et ai, Nat. Med. 9: 129134 (2003).
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
- a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, Mass.; see, e.g., U.S. Pat. No. 6,248,516).
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein.
- Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab') 2 fragments (see, e.g., Carter et ai., Bio/Technology 10: 163-167 (1992)).
- F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
- Fab and F(ab') 2 fragment with increased in vivo half-life comprising a salvage receptor binding epitope residues (see, e.g., in U.S. Patent No. 5,869,046).
- Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- the antibody of choice is a single chain Fv fragment (scFv or single chain antibody (SCA)).
- scFv or single chain antibody (SCA) single chain Fv fragment
- Fv and sFv are the only species with intact combining sites that are devoid of constant regions; thus, they are suitable for reduced nonspecific binding during in vivo use.
- sFv fusion proteins may be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an sFv. See Antibody Engineering, ed. Borrebaeck, Supra.
- the antibody fragment may also be a "linear antibody", for example, as described in U.S. Patent No. 5,641 ,870. Such linear antibody fragments may be monospecific or bispecific.
- Humanized antibodies comprising an ultralong CDR3.
- Humanized antibodies may include human engineered antibodies (see, e.g., Studnicka et al. (1994) Protein Eng.. 7(6) 805-814; and U.S. Patent No. 5,766,886).
- Various methods for humanizing non-human antibodies are known in the art.
- a humanized antibody can have one or more amino acid residues introduced into it from a source which is human or non-human. Humanization may be performed following the method of Studnicka (see, e.g., Studnicka et al. (1994) Protein Eng.. 7(6) 805-814; and U.S. Patent No. 5,766,886), including the preparation of modified antibody variable domains.
- Humanization may alternatively be performed following the method of Winter and co-workers (Jones et al. (1986) Nature 321 :522-525; Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239:1534-1536), by substituting hypervariable region sequences for the corresponding sequences of a human antibody.
- such "humanized” or “human engineered” antibodies are chimeric antibodies, including wherein substantially less than an intact human variable domain has been substituted by or incorporated into the corresponding sequence from a non-human species.
- humanized antibodies may be human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- humanized or human engineered antibodies may be non-human (e.g, rodent) antibodies in which some residues are substituted by residues from analogious sites in human antibodies (see, e.g., Studnicka et al. (1994) Protein Eng.. 7(6) 805-814; and U.S. Patent No. 5,766,886).
- variable domains both light and heavy
- the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is important to reduce antigenicity.
- sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
- the human sequence which is closest to that of the rodent is then accepted as the human framework for the humanized antibody (Sims et al. (1993) J. Immunol. 151 :2296; Chothia et al. (1987) J. Mol. Biol. 196:901 ).
- Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
- the same framework may be used for several different humanized antibodies (Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; Presta et al. (1993) J. Immunol., 151 :2623).
- humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three- dimensional models of the parental and humanized sequences.
- Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
- Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, e.g., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
- FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
- the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
- the humanized antibodies comprising ultralong CDR3 may be deimmunized.
- Methods of deimmunizing an antibody or protein are well known in the art.
- the immunogenicity of therapeutic proteins such as antibodies is thought to result from the presence of T-cell epitopes which can bind MHC class II molecules and generate a proliferative and cytokine response in CD4+ helper T-cells. These CD4+ helper cells then collaborate with B-cells to generate an antibody response against the therapeutic protein. Removal of the T-cell epitopes are thought to be key steps in deimmunizing a recombinant protein. T-cell epitopes can be predicted by in silico algorithms that identify residues required for binding MHC.
- epitopes can be identified directly by utilizing peripheral blood mononuclear cells from panels of human donors and measuring their response against the therapeutic protein when incubated with antigen presenting cells.
- peripheral blood mononuclear cells from panels of human donors and measuring their response against the therapeutic protein when incubated with antigen presenting cells.
- Such in silico and in vitro systems are well known in the art [Jones TD, Crompton LJ, Carr FJ, Baker MP. Methods Mol Biol. 2009;525:405- 23,Deimmunization of monoclonal antibodies; and Baker M, and Jones TD. The identification and removal of immunogenicity in therapeutic proteins. Curr. Opin. Drug Discovery Dev. 2007; (2007); 10(2): 219-227].
- the residues of the peptide can be mutated one by one and tested for T-cell activation until a mutation is found which disrupts MHC II binding and T-cell activation.
- Such mutations when found in an individual peptide, can be encoded directly in the recombinant therapeutic protein. Incubation of the whole protein with antigen presenting cells will not induce a significant CD4+ response, indicating successful deimmunization.
- Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. For example, one of the binding specificities may be for a first antigen and the other may be for any other antigen. Exemplary bispecific antibodies may bind to two different epitopes of the same protein. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express a particular protein. These antibodies possess a binding arm specific for the particular protein and an arm which binds the cytotoxic agent ⁇ e.g., saporin, anti-interferon- a, vinca alkaloid, ricin A chain, methotrexate or radioactive isotope hapten). Bispecific antibodies may be prepared as full length antibodies or antibody fragments ⁇ e.g., F(ab') 2 bispecific antibodies).
- bispecific antibodies Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co- expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature, 305: 537 (1983)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of 10 different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule, which is usually done by affinity chromatography steps, is rather cumbersome, and the product yields are low. Similar procedures are disclosed in WO 93/08829, and in Traunecker et al., EMBO J., 10: 3655 (1991 ).
- antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences.
- the fusion preferably is with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CH1 ), containing the site necessary for light chain binding, present in at least one of the fusions.
- DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co- transfected into a suitable host organism.
- the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm.
- This asymmetric structure may facilitate the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation.
- This approach is disclosed in WO 94/04690.
- For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121 :210 (1986).
- the interface between a pair of antibody molecules may can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
- the preferred interface comprises at least a part of the C H 3 domain of an antibody constant domain.
- one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains ⁇ e.g., tyrosine or tryptophan).
- Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones ⁇ e.g., alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
- Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
- one of the antibodies in the heteroconjugate may be coupled to avidin, the other to biotin.
- Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S. Patent No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/00373, and EP 03089).
- Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Patent No. 4,676,980, along with a number of cross-linking techniques.
- bispecific antibodies may be prepared using chemical linkage.
- Brennan et al., Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab') 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
- the Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
- One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody.
- the bispecific antibodies produced may be used as agents for the selective immobilization of enzymes.
- bispecific antibodies have been produced using leucine zippers. See, e.g., Kostelny et al., J. Immunol., 148(5):1547-1553 (1992).
- the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion.
- the antibody homodimers were reduced at the hinge region to form monomers and then re- oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
- the fragments comprise a heavy- chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen- binding sites.
- VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen- binding sites.
- sFv single-chain Fv
- Antibodies with more than two valencies are contemplated.
- trispecific antibodies can be prepared. See, e.g., Tutt et al. J. Immunol. 147: 60 (1991 ). Multivalent Antibodies
- a multivalent antibody may be internalized (and/or catabolized) faster than a bivalent antibody by a cell expressing an antigen to which the antibodies bind.
- the antibodies of the present disclosure may be multivalent antibodies (which are other than of the IgM class) with three or more antigen binding sites (e.g., tetravalent antibodies), which may be produced by recombinant expression of nucleic acid encoding the polypeptide chains of the antibody.
- the multivalent antibody may comprise a dimerization domain and three or more antigen binding sites.
- a preferred dimerization domain may comprise (or consist of) an Fc region or a hinge region. In this scenario, the antibody will comprise an Fc region and three or more antigen binding sites amino-terminal to the Fe region.
- a preferred multivalent antibody may comprise (or consist of) three to about eight, but preferably four, antigen binding sites.
- the multivalent antibody comprises at least one polypeptide chain (and preferably two polypeptide chains), wherein the polypeptide chain(s) comprise two or more variable domains.
- the polypeptide chain(s) may comprise VD1 -(X1 )n-VD2-(X2)n-Fc, wherein VD1 is a first variable domain, VD2 is a second variable domain, Fc is one polypeptide chain of an Fc region, X1 and X2 represent an amino acid or polypeptide, and n is 0 or 1 .
- the polypeptide chain(s) may comprise: VH-CH1 -flexible linker-VH-CH1 -Fc region chain; or VH-CH1 -VH-CH1-Fc region chain.
- a multivalent antibody may preferably further comprises at least two (and preferably four) light chain variable domain polypeptides.
- a multivalent antibody may, for instance, comprise from about two to about eight light chain variable domain polypeptides.
- the light chain variable domain polypeptides may comprise a light chain variable domain and, optionally, further comprise a CL domain.
- amino acid sequence modification(s) of the humanized antibodies comprising an ultralong CDR3 as described herein are contemplated.
- Amino acid sequence variants of the antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics.
- the amino acid alterations may be introduced in the subject antibody amino acid sequence at the time that sequence is made.
- a useful method for identification of certain residues or regions of the antibody that are preferred locations for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244:1081-1085.
- a residue or group of target residues are identified ⁇ e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen.
- Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution.
- the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region and the expressed immunoglobulins are screened for the desired activity.
- Amino acid sequence insertions include amino- and/or carboxyl- terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to a cytotoxic polypeptide.
- Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme ⁇ e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
- Glycosylation of polypeptides is typically either N-linked or O-linked.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagine-X- threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- O-linked glycosylation refers to the attachment of one of the sugars N- aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- Addition of glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
- the carbohydrate attached thereto may be altered.
- antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody have been described (see, e.g., US 2003/0157108, US 2004/0093621 .
- Antibodies with a bisecting N- acetylglucosamine (GlcNAc) in the carbohydrate attached to an Fc region of the antibody have been described (see, e.g., WO 2003/01 1878, and U.S. Patent No. 6,602,684).
- Antigen-binding molecules with modified glycosylation have been described (see, e.g., WO 99/54342, U.S. Patent Nos. 6,602,684 and 7,517,670, and US 2004/0072290; see also, e.g., U.S. Patent Nos. 7,214,775 and 7,682,610).
- the preferred glycosylation variant herein comprises an Fc region, wherein a carbohydrate structure attached to the Fc region lacks fucose.
- Such variants have improved ADCC function.
- the Fc region further comprises one or more amino acid substitutions therein which further improve ADCC, for example, substitutions at positions 298, 333, and/or 334 of the Fc region (Eu numbering of residues).
- Examples of publications related to "defucosylated" or "fucose-deficient" antibodies include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/01 15614 (now U.S. Patent No.6,946,292) US 2002/0164328 (now U.S. Patent No.
- variants Another type of variant is an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule replaced by a different residue.
- the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated.
- Conservative substitutions are shown in Table 2 under the heading of "preferred substitutions". If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions", or as further described below in reference to amino acid classes, may be introduced and the products screened.
- Original Residue Exemplary Substitutions Preferred Substitutions
- Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Naturally occurring residues are divided into groups based on common side-chain properties: (1 ) hydrophobic: norleucine, met, ala, val, leu, ile; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin; (3) acidic: asp, glu; (4) basic: his, lys, arg; (5) residues that influence chain orientation: gly, pro; and (6) aromatic: trp, tyr, phe.
- Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
- substitutional variant involves substituting one or more hypervariable region residues of a parent antibody ⁇ e.g., a humanized or human antibody).
- a parent antibody e.g., a humanized or human antibody
- the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated.
- a convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites ⁇ e.g., 6-7 sites) are mutated to generate all possible amino acid substitutions at each site.
- the antibodies thus generated are displayed from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle.
- the phage-displayed variants are then screened for their biological activity ⁇ e.g., binding affinity) as herein disclosed.
- alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
- Nucleic acid molecules encoding amino acid sequence variants of the antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the antibody.
- the Fc region variant may comprise a human Fc region sequence ⁇ e.g., a human lgG1 , lgG2, lgG3 or lgG4 Fc region) comprising an amino acid modification ⁇ e.g., a substitution) at one or more amino acid positions including that of a hinge cysteine.
- an antibody used in methods disclosed herein may comprise one or more alterations as compared to the wild type counterpart antibody, e.g,. in the Fc region. These antibodies would nonetheless retain substantially the same characteristics required for therapeutic utility as compared to their wild type counterpart. For example, it is thought that certain alterations can be made in the Fc region that would result in altered ⁇ e.g., either improved or diminished) Clq binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in W099/51642. See also Duncan & Winter Nature 322:738-40 (1988); U.S. Patent No. 5,648,260; U.S. Patent No.
- WO00/42072 and WO 2004/056312 describe antibody variants with improved or diminished binding to FcRs. See, also, Shields et al. J. Biol. Chem. 9(2): 6591 -6604 (2001 ). Antibodies with increased half lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 1 17:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in US2005/0014934 (Hinton et al.).
- These antibodies comprise an Fc reg on with one or more substitutions therein which improve binding of the Fc region to FcRn.
- Polypeptide variants with altered Fc region amino acid sequences and increased or decreased Clq binding capability are described in U.S. Patent No. 6, 194,551 , W099/51642. See, also, Idusogie et al. J. Immunol. 164:4178-4184 (2000).
- the present disclosure contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
- In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/ depletion of CDC and/ or ADCC activities.
- Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
- NK cells express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII.
- FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991 ).
- Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Pat. No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat'! Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc.
- non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry (CellTecl1 r1 ology, Inc. Mountain View, Calif.; and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, Wis.).
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. Proc. Nat 'lAcad. Sci. USA 95:652-656 (1998).
- Cl qbinding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. See, e.g., C1 q and C3c binding ELISA in WO 2006/029879 and WO 2005/ 100402.
- a CDC assay may be performed (see, for example, Gazzano-Santoro et al., Immunol.
- FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova, S. B. et al., Int ⁇ Immunol. 18(12):1759-1769 (2006)).
- Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737, 056).
- Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (U .S. Pat. No. 7,332,581 ).
- an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
- alterations are made in the Fc region that result in altered (i.e., either improved or diminished) C1 q binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in U.S. Pat. No. 6, 194,551 , WO 99/51642, and Idusogie et al. Immunol. 164: 41784184 (2000).
- CDC Complement Dependent Cytotoxicity
- Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286,303,305, 307, 31 1 ,312, 317, 340,356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (U.S. Pat. No. 7,371 ,826).
- the humanized antibodies comprising an ultralong CDR3 as disclosed herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
- the moieties suitable for derivatization of the antibody are water soluble polymers.
- Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1 ,3-dioxolane, poly-1 ,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols ⁇ e.g., glycerol), polyvinyl alcohol, and mixtures thereof.
- PEG polyethylene glycol
- copolymers of ethylene glycol/propylene glycol carboxymethylcellulose
- dextran polyvinyl alcohol
- Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the number of polymers attached to the antibody may vary, and if more than one polymers are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
- nucleic acid encoding it is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression.
- DNA encoding the antibody is readily isolated and sequenced using conventional procedures ⁇ e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- nucleic acid encoding a humanized antibody comprising an ultralong CDR3, a variable region comprising an ultralong CDR3, or an ultralong CDR3, is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression.
- vectors are available. The choice of vector depends in part on the host cell to be used. Generally, preferred host cells are of either prokaryotic or eukaryotic (generally mammalian) origin. It will be appreciated that constant regions of any isotype can be used for this purpose, including IgG, IgM, IgA, IgD, and IgE constant regions, and that such constant regions can be obtained from any human or animal species.
- Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus.
- exemplary eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, SV40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
- Some expression systems have markers that provide gene amplification such as thymidine kinase and dihydrofolate reductase.
- high yield expression systems not involving gene amplification are also suitable, such as using a baculovirus vector in insect cells, with a nucleic acid sequence encoding a partially human ultralong CDR3 antibody chain under the direction of the polyhedrin promoter or other strong baculovirus promoters.
- Polynucleotide sequences encoding polypeptide components of the antibodies disclosed herein can be obtained using standard recombinant techniques. Desired polynucleotide sequences may be isolated and sequenced from antibody producing cells such as hybridoma cells. Alternatively, polynucleotides can be synthesized using nucleotide synthesizer or PCR techniques. Once obtained, sequences encoding the polypeptides are inserted into a recombinant vector capable of replicating and expressing heterologous polynucleotides in prokaryotic hosts. Many vectors that are available and known in the art can be used for the purpose of the present disclosure.
- Selection of an appropriate vector will depend mainly on the size of the nucleic acids to be inserted into the vector and the particular host cell to be transformed with the vector.
- Each vector contains various components, depending on its function (amplification or expression of heterologous polynucleotide, or both) and its compatibility with the particular host cell in which it resides.
- the vector components generally include, but are not limited to: an origin of replication, a selection marker gene, a promoter, a ribosome binding site (RBS), a signal sequence, the heterologous nucleic acid insert and a transcription termination sequence.
- V regions comprising an ultralong CDR3 may optionally be fused to a C-region to produce an antibody comprising constant regions.
- plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell are used in connection with these hosts.
- the vector ordinarily carries a replication site, as well as marking sequences which are capable of providing phenotypic selection in transformed cells.
- E. coli is typically transformed using pBR322, a plasmid derived from an E. coli species.
- pBR322 contains genes encoding ampicillin (Amp) and tetracycline (Tet) resistance and thus provides easy means for identifying transformed cells.
- pBR322 its derivatives, or other microbial plasmids or bacteriophage may also contain, or be modified to contain, promoters which can be used by the microbial organism for expression of endogenous proteins. Examples of pBR322 derivatives used for expression of particular antibodies have been described (see, e.g., U.S. Patent No. 5,648,237).
- phage vectors containing replicon and control sequences that are compatible with the host microorganism can be used as transforming vectors in connection with these hosts.
- bacteriophage such as AGEMTM-1 1 may be utilized in making a recombinant vector which can be used to transform susceptible host cells such as E. coli LE392.
- the expression vectors disclosed herein may comprise two or more promoter-cistron pairs, encoding each of the polypeptide components.
- a promoter is an untranslated regulatory sequence located upstream (5') to a cistron that modulates its expression.
- Prokaryotic promoters typically fall into two classes, inducible and constitutive. Inducible promoter is a promoter that initiates increased levels of transcription of the cistron under its control in response to changes in the culture condition, e.g., the presence or absence of a nutrient or a change in temperature.
- promoters recognized by a variety of potential host cells are well known.
- the selected promoter can be operably linked to cistron DNA encoding the light or heavy chain by removing the promoter from the source DNA via restriction enzyme digestion and inserting the isolated promoter sequence into the vector disclosed herein.
- Both the native promoter sequence and many heterologous promoters may be used to direct amplification and/or expression of the target genes.
- heterologous promoters are utilized, as they generally permit greater transcription and higher yields of expressed target gene as compared to the native target polypeptide promoter.
- Promoters suitable for use with prokaryotic hosts include: an ara B promoter, a PhoA promoter, ⁇ -galactamase and lactose promoter systems, a tryptophan (trp) promoter system and hybrid promoters such as the tac or the trc promoter.
- trp tryptophan
- Other promoters that are functional in bacteria are suitable as well.
- Their nucleotide sequences have been published, thereby enabling a skilled worker operably to ligate them to cistrons encoding the target light and heavy chains ⁇ e.g., Siebenlist et al. (1980) Cell 20: 269) using linkers or adaptors to supply any required restriction sites.
- Suitable bacterial promoters are well known in the art and fully described in scientific literature such as Sambrook and Russell, supra, and Ausubel et al, supra.
- Bacterial expression systems for expressing antibody chains of the recombinant catalytic polypeptide are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al., Gene, 22:229-235 (1983); Mosbach et al., Nature, 302:543-545 (1983)).
- each cistron within the recombinant vector comprises a secretion signal sequence component that directs translocation of the expressed polypeptides across a membrane.
- the signal sequence may be a component of the vector, or it may be a part of the target polypeptide DNA that is inserted into the vector.
- the signal sequence should be one that is recognized and processed (e.g., cleaved by a signal peptidase) by the host cell.
- the signal sequence is substituted by a prokaryotic signal sequence selected, for example PelB, OmpA, alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II (STII) leaders, LamB, PhoE, and MBP.
- a prokaryotic signal sequence selected, for example PelB, OmpA, alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II (STII) leaders, LamB, PhoE, and MBP.
- the signal sequences used in both cistrons of the expression system are STII signal sequences or variants thereof.
- the production of the immunoglobulins according to the disclosure can occur in the cytoplasm of the host cell, and therefore does not require the presence of secretion signal sequences within each cistron.
- immunoglobulin light and heavy chains are expressed, folded and assembled to form functional immunoglobulins within the cytoplasm.
- Certain host strains ⁇ e.g., the E. co// trxB- strains) provide cytoplasm conditions that are favorable for disulfide bond formation, thereby permitting proper folding and assembly of expressed protein subunits (see e.g., Proba and Pluckthun Gene, 159:203 (1995)).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell, Human Embryonic Kidney (HEK) cell or lymphoid cell (e.g., YO, NSO, Sp20 cell).
- CHO Chinese Hamster Ovary
- HEK Human Embryonic Kidney
- lymphoid cell e.g., YO, NSO, Sp20 cell.
- antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523.
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gemgross, Nat. Biotech.
- Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. These examples are illustrative rather than limiting. Methods for constructing derivatives of any of the above-mentioned bacteria having defined genotypes are known in the art and described in, for example, Bass et al., Proteins, 8:309-314 (1990).
- E. coli, Serratia, or Salmonella species can be suitably used as the host when well known plasmids such as pBR322, pBR325, pACYC177, or pKN410 are used to supply the replicon.
- plasmids such as pBR322, pBR325, pACYC177, or pKN410 are used to supply the replicon.
- the host cell should secrete minimal amounts of proteolytic enzymes, and additional protease inhibitors may desirably be incorporated in the cell culture.
- Plant cell cultures can also be utilized as hosts. See, e.g. U.S. Pat. Nos. 5,959, 177, 6,040,498, 6,420,548, 7, 125, 978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants). Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., Gen VII'OI.
- CHO Chinese hamster ovary
- DHFR' CHO cells Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)
- myeloma cell lines such as YO, NSO and Sp2/0.
- a host cell comprises (e.g., has been transformed with): (1 ) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
- nucleic acid encoding a humanized antibody comprising an ultralong CDR3 is inserted into one or more expression vectors for further cloning and/or expression in a host cell.
- Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Host cells are transformed with such expression vectors and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- Transformation means introducing DNA into the prokaryotic host so that the DNA is replicable, either as an extrachromosomal element or by chromosomal integrant.
- transformation is done using standard techniques appropriate to such cells.
- the calcium treatment employing calcium chloride is generally used for bacterial cells that contain substantial cell-wall barriers.
- Another method for transformation employs polyethylene glycol/DMSO.
- Yet another technique used is electroporation.
- Prokaryotic cells used to produce the polypeptides disclosed herein are grown in media known in the art and suitable for culture of the selected host cells.
- suitable media include luria broth (LB) plus necessary nutrient supplements.
- the media also contains a selection agent, chosen based on the construction of the expression vector, to selectively permit growth of prokaryotic cells containing the expression vector. For example, ampicillin is added to media for growth of cells expressing ampicillin resistant gene.
- any necessary supplements besides carbon, nitrogen, and inorganic phosphate sources may also be included at appropriate concentrations introduced alone or as a mixture with another supplement or medium such as a complex nitrogen source.
- the culture medium may contain one or more reducing agents selected from the group consisting of glutathione, cysteine, cystamine, thioglycollate, dithioerythritol and dithiothreitol.
- the prokaryotic host cells are cultured at suitable temperatures. For example,
- E. coli growth for example, the preferred temperature ranges from about 20° C. to about 39° C, more preferably from about 25° C. to about 37° C, even more preferably at about 30° C.
- the pH of the medium may be any pH ranging from about 5 to about 9, depending mainly on the host organism.
- the pH is preferably from about 6.8 to about 7.4, and more preferably about 7.0.
- an inducible promoter is used in the expression vector disclosed herein, protein expression is induced under conditions suitable for the activation of the promoter.
- an ara B or phoA promoter may be used for controlling transcription of the polypeptides.
- a variety of inducers may be used, according to the vector construct employed, as is known in the art.
- the expressed polypeptides of the present disclosure are secreted into and recovered from the periplasm of the host cells or transported into the culture media. Protein recovery from the periplasm typically involves disrupting the microorganism, generally by such means as osmotic shock, sonication or lysis. Once cells are disrupted, cell debris or whole cells may be removed by centrifugation or filtration. The proteins may be further purified, for example, by affinity resin chromatography. Alternatively, proteins that are transported into the culture media may be isolated therein. Cells may be removed from the culture and the culture supernatant being filtered and concentrated for further purification of the proteins produced. The expressed polypeptides can be further isolated and identified using commonly known methods such as polyacrylamide gel electrophoresis (PAGE) and Western blot assay.
- PAGE polyacrylamide gel electrophoresis
- Antibody production may be conducted in large quantity by a fermentation process.
- Various large-scale fed-batch fermentation procedures are available for production of recombinant proteins.
- Large-scale fermentations have at least 1000 liters of capacity, preferably about 1 ,000 to 100,000 liters of capacity. These fermentors use agitator impellers to distribute oxygen and nutrients, especially glucose (a preferred carbon/energy source).
- Small scale fermentation refers generally to fermentation in a fermentor that is no more than approximately 100 liters in volumetric capacity, and can range from about 1 liter to about 100 liters.
- induction of protein expression is typically initiated after the cells have been grown under suitable conditions to a desired density, e.g., an OD550 of about 180-220, at which stage the cells are in the early stationary phase.
- a desired density e.g., an OD550 of about 180-220
- inducers may be used, according to the vector construct employed, as is known in the art and described above. Cells may be grown for shorter periods prior to induction. Cells are usually induced for about 12-50 hours, although longer or shorter induction time may be used.
- host strains deficient for proteolytic enzymes can be used for the present disclosure.
- host cell strains may be modified to effect genetic mutation(s) in the genes encoding known bacterial proteases such as Protease III, OmpT, DegP, Tsp, Protease I, Protease Mi, Protease V, Protease VI and combinations thereof.
- E. coli protease-deficient strains are available (see, e.g., Joly et al. (1998), supra; U.S. Patent No. 5,264,365; U.S. Patent No. 5,508, 192; Hara et al., Microbial Drug Resistance, 2:63-72 (1996)).
- E. coli strains deficient for proteolytic enzymes and transformed with plasmids overexpressing one or more chaperone proteins may be used as host cells in the expression systems disclosed herein.
- Standard protein purification methods known in the art can be employed.
- the following procedures are exemplary of suitable purification procedures: fractionation on immunoaffinity or ion-exchange columns, ethanol precipitation, reverse phase HPLC, chromatography on silica or on a cation-exchange resin such as DEAE, chromatofocusing, SDS-PAGE, ammonium sulfate precipitation, and gel filtration using, for example, Sephadex G-75.
- Protein A immobilized on a solid phase is used for immunoaffinity purification of the full length antibody products disclosed herein.
- Protein A is a 41 kD cell wall protein from Staphylococcus aureas which binds with a high affinity to the Fc region of antibodies (see, e.g., Lindmark et al (1983) J. Immunol. Meth. 62:1 -13).
- the solid phase to which Protein A is immobilized is preferably a column comprising a glass or silica surface, more preferably a controlled pore glass column or a silicic acid column. In some applications, the column has been coated with a reagent, such as glycerol, in an attempt to prevent nonspecific adherence of contaminants.
- the preparation derived from the cell culture as described above is applied onto the Protein A immobilized solid phase to allow specific binding of the antibody of interest to Protein A.
- the solid phase is then washed to remove contaminants non-specifically bound to the solid phase.
- the antibody of interest is recovered from the solid phase by elution.
- the vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
- a vector for use in a eukaryotic host cell may also contain a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide of interest.
- the heterologous signal sequence selected preferably is one that is recognized and processed ⁇ e.g., cleaved by a signal peptidase) by the host cell.
- mammalian signal sequences as well as viral secretory leaders for example, the herpes simplex gD signal, are available.
- the DNA for such precursor region is ligated in reading frame to DNA encoding the antibody.
- an origin of replication component is not needed for mammalian expression vectors.
- the SV40 origin may be used only because it contains the early promoter.
- Expression and cloning vectors may contain a selection gene, also termed a selectable marker.
- Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, where relevant, or (c) supply critical nutrients not available from complex media.
- One example of a selection scheme utilizes a drug to arrest growth of a host cell. Those cells that are successfully transformed with a heterologous gene produce a protein conferring drug resistance and thus survive the selection regimen. Examples of such dominant selection use the drugs neomycin, mycophenolic acid and hygromycin.
- Suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up the antibody nucleic acid, such as DHFR, thymidine kinase, metallothionein-l and -II, preferably primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, etc.
- cells transformed with the DHFR selection gene are first identified by culturing all of the transformants in a culture medium that contains methotrexate (Mtx), a competitive antagonist of DHFR.
- Mtx methotrexate
- An appropriate host cell when wild- type DHFR is employed is the Chinese hamster ovary (CHO) cell line deficient in DHFR activity ⁇ e.g., ATCC CRL-9096).
- host cells particularly wild-type hosts that contain endogenous DHFR transformed or co-transformed with DNA sequences encoding an antibody, wild-type DHFR protein, and another selectable marker such as aminoglycoside 3'-phosphotransferase (APH) can be selected by cell growth in medium containing a selection agent for the selectable marker such as an aminoglycosidic antibiotic, e.g., kanamycin, neomycin, or G418. See U.S. Patent No. 4,965, 199.
- APH aminoglycoside 3'-phosphotransferase
- Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the antibody polypeptide nucleic acid.
- Promoter sequences are known for eukaryotes.
- Virtually alleukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated.
- Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide.
- N may be any nucleotide.
- AATAAA sequence At the 3' end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the poly A tail to the 3' end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
- Antibody polypeptide transcription from vectors in mammalian host cells is controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.
- viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), from hetero
- the early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication.
- the immediate early promoter of the human cytomegalovirus is conveniently obtained as a Hind 111 E restriction fragment.
- a system for expressing DNA in mammalian hosts using the bovine papilloma virus as a vector is disclosed in U.S. Patent No. 4,419,446. A modification of this system is described in U.S. Patent No. 4,601 ,978.
- the Rous Sarcoma Virus long terminal repeat can be used as the promoter.
- Enhancer sequences are now known from mammalian genes (globin, elastase, albumin, a-fetoprotein, and insulin).
- An enhancer from a eukaryotic cell virus may also be used. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
- the enhancer may be spliced into the vector at a position 5' or 3' to the antibody polypeptide- encoding sequence, but is preferably located at a site 5' from the promoter.
- Expression vectors used in eukaryotic host cells will typically also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding an antibody.
- One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO94/1 1026 and the expression vector disclosed therein.
- Suitable host cells for cloning or expressing the DNA in the vectors herein include higher eukaryote cells described herein, including vertebrate host cells. Propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651 ); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad.
- mice Sertoli cells TM4, Mather, Biol. Reprod. 23:243-251 (1980); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51 ); TRI cells (Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
- Any of the well-known procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, biolistics, liposomes, microinjection, plasma vectors, viral vectors and any of the other well known methods for introducing cloned genomic DNA, cDNA, synthetic DNA, or other foreign genetic material into a host cell (see, e.g., Sambrook and Russell, supra). It is only necessary that the particular genetic engineering procedure used be capable of successfully introducing at least both genes into the host cell capable of expressing germline antibody polypeptide.
- Host cells are transformed with the above-described expression or cloning vectors for antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- the host cells used to produce an antibody of this disclosure may be cultured in a variety of media.
- Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells.
- any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCINTM drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
- the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
- the antibody can be produced intracellularly, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ® ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
- a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
- the antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being the preferred purification technique.
- affinity chromatography is the preferred purification technique.
- the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
- Protein A can be used to purify antibodies that are based on human ⁇ 1 , ⁇ 2, or ⁇ 4 heavy chains (Lindmark et al., J. Immunol. Meth. 62:1 -13 (1983)). Protein G is recommended for all mouse isotypes and for human ⁇ 3 (Guss et al., EMBO J.
- the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
- the antibody comprises a CH3 domain
- the Bakerbond ABXTM resin J. T. Baker, Phillipsburg, N.J. is useful for purification.
- Soluble forms of antibody or fragment present either in the cytoplasm or released from the periplasmic space may be further purified using methods known in the art, for example Fab fragments are released from the bacterial periplasmic space by osmotic shock techniques.
- inclusion bodies comprising an antibody or fragment have formed, they can often bind to the inner and/or outer cellular membranes and thus will be found primarily in the pellet material after centrifugation.
- the pellet material can then be treated at pH extremes or with chaotropic agent such as a detergent, guanidine, guanidine derivatives, urea, or urea derivatives in the presence of a reducing agent such as dithiothreitol at alkaline pH or tris carboxyethyl phosphine at acid pH to release, break apart, and solubilize the inclusion bodies.
- a reducing agent such as dithiothreitol at alkaline pH or tris carboxyethyl phosphine at acid pH to release, break apart, and solubilize the inclusion bodies.
- the soluble antibody or fragment can then be analyzed using gel electrophoresis, immunoprecipitation or the like.
- the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations ⁇ e.g., from about 0-0.25 M salt).
- an antibody or fragment may not be biologically active upon isolation.
- Various methods for "refolding" or converting a polypeptide to its tertiary structure and generating disulfide linkages can be used to restore biological activity. Such methods include exposing the solubilized polypeptide to a pH usually above 7 and in the presence of a particular concentration of a chaotrope. The selection of chaotrope is very similar to the choices used for inclusion body solubilization, but usually the chaotrope is used at a lower concentration and is not necessarily the same as chaotropes used for the solubilization.
- the refolding/oxidation solution will also contain a reducing agent or the reducing agent plus its oxidized form in a specific ratio to generate a particular redox potential allowing for disulfide shuffling to occur in the formation of the protein's cysteine bridge(s).
- Some of the commonly used redox couples include cysteine/cystamine, glutathione (GSH)/dithiobis GSH, cupric chloride, dithiothreitol(DTT)/dithiane DTT, and 2-mercaptoethanol(bME)/di-thio-b(ME).
- GSH glutathione
- DTT dithiothreitol
- bME 2-mercaptoethanol
- a cosolvent may be used to increase the efficiency of the refolding, and common reagents used for this purpose include glycerol, polyethylene glycol of various molecular weights, arginine and the like.
- the disclosure also provides immunoconjugates (interchangeably termed “antibody-drug conjugates” or "ADC”), comprising any of the humanized antibodies comprising an ultralong CDR3 as described herein conjugated to a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin ⁇ e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope ⁇ e.g., a radioconjugate).
- a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin ⁇ e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof
- a radioactive isotope e.g., a radioconjugate
- Toxins used in antibody-toxin conjugates include bacterial toxins such as diphtheria toxin, plant toxins such as ricin, small molecule toxins such as geldanamycin (Mandler et al (2000) Jour, of the Nat. Cancer Inst. 92(19):1573-1581 ; Mandler et al (2000) Bioorganic & Med. Chem. Letters 10: 1025-1028; Mandler et al (2002) Bioconjugate Chem. 13:786-791 ), maytansinoids (EP 1391213; Liu et al., (1996) Proc. Natl. Acad. Sci.
- cytotoxic drugs tend to be inactive or less active when conjugated to large antibodies or protein receptor ligands.
- ZEVALIN ® is an antibody- radioisotope conjugate composed of a murine lgG1 kappa monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes and 111 In or 90 Y radioisotope bound by a thiourea linker-chelator (Wiseman et al (2000) Eur. Jour. Nucl. Med. 27(7):766-77; Wiseman et al (2002) Blood 99(12):4336-42; Witzig et al (2002) J. Clin. Oncol.
- ZEVALIN has activity against B-cell non-Hodgkin's Lymphoma (NHL), administration results in severe and prolonged cytopenias in most patients.
- MYLOTARGTM (gemtuzumab ozogamicin, Wyeth Pharmaceuticals), an antibody drug conjugate composed of a hu CD33 antibody linked to calicheamicin, was approved in 2000 for the treatment of acute myeloid leukemia by injection (Drugs of the Future (2000) 25(7):686; U.S. Patent Nos.
- Cantuzumab mertansine (Immunogen, Inc.), an antibody drug conjugate composed of the huC242 antibody linked via the disulfide linker SPP to the maytansinoid drug moiety, DM1 , is advancing into Phase II trials for the treatment of cancers that express CanAg, such as colon, pancreatic, gastric, and others.
- MLN-2704 (Millennium Pharm., BZL Biologies, Immunogen Inc.), an antibody drug conjugate composed of the anti-prostate specific membrane antigen (PSMA) monoclonal antibody linked to the maytansinoid drug moiety, DM1 , is under development for the potential treatment of prostate tumors.
- PSMA anti-prostate specific membrane antigen
- auristatin peptides auristatin E (AE) and monomethylauristatin (MMAE), synthetic analogs of dolastatin, were conjugated to chimeric monoclonal antibodies cBR96 (specific to Lewis Y on carcinomas) and cAC10 (specific to CD30 on hematological malignancies) (Doronina et al (2003) Nature Biotechnology 21 (7):778-784) and are under therapeutic development.
- Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
- radionuclides are available for the production of radioconjugated antibodies. Examples include 212 Bi, 131 l, 131 ln, 90 Y, and 186 Re.
- Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N- succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCI), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p- diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1 ,5-difluoro-2,4-dinitrobenzene).
- SPDP N- succinimidyl-3-(2-
- a ricin immunotoxin may be prepared as described in Vitetta et al., Science, 238: 1098 (1987).
- Carbon-14-labeled 1 -isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See W094/1 1026.
- Conjugates of an antibody and one or more small molecule toxins such as a calicheamicin, maytansinoids, dolastatins, aurostatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity, are also contemplated herein.
- the immunoconjugate comprises a humanized antibody (full length or fragments) comprising an ultralong CDR3 as disclosed herein conjugated to one or more maytansinoid molecules.
- Maytansinoids are mitototic inhibitors which act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Patent No. 3,896, 1 1 1 ). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Patent No. 4, 151 ,042). Synthetic maytansinol and derivatives and analogues thereof are disclosed, for example, in U.S. Patent Nos.
- Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines.
- Immunoconjugates containing maytansinoids, methods of making same, and their therapeutic use are disclosed, for example, in U.S. Patent Nos. 5,208,020, 5,416,064 and EP 0 425 235.
- the conjugate was found to be highly cytotoxic towards cultured colon cancer cells, and showed antitumor activity in an in vivo tumor growth assay.
- the drug conjugate achieved a degree of cytotoxicity similar to the free maytansinoid drug, which could be increased by increasing the number of maytansinoid molecules per antibody molecule.
- the A7-maytansinoid conjugate showed low systemic cytotoxicity in mice.
- Antibody-maytansinoid conjugates are prepared by chemically linking an antibody to a maytansinoid molecule without significantly diminishing the biological activity of either the antibody or the maytansinoid molecule. See, e.g., U.S. Patent No. 5,208,020. An average of 3-4 maytansinoid molecules conjugated per antibody molecule has shown efficacy in enhancing cytotoxicity of target cells without negatively affecting the function or solubility of the antibody, although even one molecule of toxin/antibody would be expected to enhance cytotoxicity over the use of naked antibody. Maytansinoids are well known in the art and can be synthesized by known techniques or isolated from natural sources.
- Suitable maytansinoids are disclosed, for example, in U.S. Patent No. 5,208,020 and in the other patents and nonpatent publications referred to hereinabove.
- Preferred maytansinoids are maytansinol and maytansinol analogues modified in the aromatic ring or at other positions of the maytansinol molecule, such as various maytansinol esters.
- linking groups known in the art for making antibody- maytansinoid conjugates, including, for example, those disclosed in U.S. Patent Nos. 5,208,020, 6,441 , 163, or EP Patent 0 425 235, Chari et al., Cancer Research 52:127-131 (1992).
- Antibody-maytansinoid conjugates comprising the linker component SMCC may be prepared.
- the linking groups include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups, or esterase labile groups, as disclosed in the above-identified patents, disulfide and thioether groups being preferred. Additional linking groups are described and exemplified herein.
- Conjugates of the antibody and maytansinoid may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl)cyclohexane-1 -carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCI), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis- diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine
- SPDP
- Particularly preferred coupling agents include N-succinimidyl- 3-(2-pyridyldithio) propionate (SPDP) (Carlsson et al., Biochem. J. 173:723-737 (1978)) and N-succinimidyl-4-(2-pyridylthio)pentanoate (SPP) to provide for a disulfide linkage.
- SPDP N-succinimidyl- 3-(2-pyridyldithio) propionate
- SPP N-succinimidyl-4-(2-pyridylthio)pentanoate
- the linker may be attached to the maytansinoid molecule at various positions, depending on the type of the link.
- an ester linkage may be formed by reaction with a hydroxyl group using conventional coupling techniques. The reaction may occur at the C-3 position having a hydroxyl group, the C-14 position modified with hydroxymethyl, the C-15 position modified with a hydroxyl group, and the C-20 position having a hydroxyl group.
- the linkage is formed at the C-3 position of maytansinol or a maytansinol analogue.
- the immunoconjugate comprises an antibody disclosed herein conjugated to dolastatins or dolostatin peptidic analogs and derivatives, the auristatins (U.S. Patent Nos. 5,635,483; 5,780,588).
- Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001 ) Antimicrob. Agents and Chemother. 45(12):3580- 3584) and have anticancer (U.S. Patent No. 5,663, 149) and antifungal activity (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961 -2965).
- the dolastatin or auristatin drug moiety may be attached to the antibody through the N (amino) terminus or the C (carboxyl) terminus of the peptidic drug moiety (WO 02/088172).
- Exemplary auristatin embodiments include the N-terminus linked monomethylauristatin drug moieties DE and DF, (see, e.g., U.S. Patent No. 7,498,298).
- peptide-based drug moieties can be prepared by forming a peptide bond between two or more amino acids and/or peptide fragments.
- Such peptide bonds can be prepared, for example, according to the liquid phase synthesis method (see, e.g., E. Schroder and K. Lubke, "The Peptides", volume 1 , pp 76-136, 1965, Academic Press) that is well known in the field of peptide chemistry.
- the auristatin/dolastatin drug moieties may be prepared according to the methods of: U.S. Patent No. 5,635,483; U.S. Patent No. 5,780,588; Pettit et al (1989) J. Am. Chem. Soc.
- the immunoconjugate comprises an antibody disclosed herein conjugated to one or more calicheamicin molecules.
- the calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub- picomolar concentrations.
- For the preparation of conjugates of the calicheamicin family see U.S. Patent Nos. 5,712,374, 5,714,586, 5,739, 1 16, 5,767,285, 5,770,701 , 5,770,710, 5,773,001 , 5,877,296.
- Structural analogues of calicheamicin which may be used include, but are not limited to, ⁇ , ⁇ 2 ', ⁇ 3 ', N-acetyl-y , PSAG and ⁇ (see, e.g., Hinman et al., Cancer Research 53:3336-3342 (1993), Lode et al., Cancer Research 58:2925-2928 (1998) and the aforementioned U.S. patents).
- Another anti-tumor drug that the antibody can be conjugated is QFA which is an antifolate.
- QFA is an antifolate.
- Both calicheamicin and QFA have intracellular sites of action and do not readily cross the plasma membrane. Therefore, cellular uptake of these agents through antibody mediated internalization greatly enhances their cytotoxic effects.
- antitumor agents that can be conjugated to the antibodies disclosed herein include BCNU, streptozoicin, vincristine and 5-fluorouracil, the family of agents known collectively LL-E33288 complex described in U.S. Patent Nos. 5,053,394, 5,770,710, as well as esperamicins (U.S. Patent No. 5,877,296).
- Enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, WO 93/21232 published Oct. 28, 1993.
- the present disclosure further contemplates an immunoconjugate formed between an antibody and a compound with nucleolytic activity ⁇ e.g., a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).
- a compound with nucleolytic activity e.g., a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase.
- the antibody may comprise a highly radioactive atom.
- a variety of radioactive isotopes are available for the production of radioconjugated antibodies. Examples include At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu.
- the conjugate When used for detection, it may comprise a radioactive atom for scintigraphic studies, for example tc 99m or I 123 , or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine-123 again, iodine-131 , indium-1 1 1 , fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.
- NMR nuclear magnetic resonance
- the radiolabels or other labels may be incorporated in the conjugate in known ways.
- the peptide may be biosynthesized or may be synthesized by chemical amino acid synthesis using suitable amino acid precursors involving, for example, fluorine-19 in place of hydrogen.
- Labels such as tc 99m or I 123 , Re 186 , Re 188 and In 111 can be attached via a cysteine residue in the peptide.
- Yttrium-90 can be attached via a lysine residue.
- the IODOGEN method (Fraker et al (1978) Biochem. Biophys. Res. Commun. 80: 49-57) can be used to incorporate iodine-123. "Monoclonal Antibodies in Immunoscintigraphy" (Chatal, CRC Press 1989) describes other methods.
- Conjugates of the antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl)cyclohexane-1 -carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCI), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis- diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (
- SPDP
- a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987).
- Carbon-14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/1 1026.
- the linker may be a "cleavable linker" facilitating release of the cytotoxic drug in the cell.
- an acid-labile linker for example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari et al., Cancer Research 52:127- 131 (1992); U.S. Patent No. 5,208,020) may be used.
- the compounds disclosed herein expressly contemplate, but are not limited to, ADC prepared with cross-linker reagents: BMPS, EMCS, GMBS, HBVS, LC- SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate) which are commercially available ⁇ e.g., from Pierce Biotechnology, Inc., Rockford, III., U.S.A). See pages 467-498, 2003-2004 Applications Handbook and Catalog.
- an antibody is conjugated to one or more drug moieties (D), e.g,. about 1 to about 20 drug moieties per antibody, through a linker (L).
- D drug moieties
- L linker
- An ADC of Formula I [Ab-(L-D) p ] may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1 ) reaction of a nucleophilic group of an antibody with a bivalent linker reagent, to form Ab-L, via a covalent bond, followed by reaction with a drug moiety D; and (2) reaction of a nucleophilic group of a drug moiety with a bivalent linker reagent, to form D-L, via a covalent bond, followed by reaction with the nucleophilic group of an antibody. Additional methods for preparing ADC are described herein.
- the linker may be composed of one or more linker components.
- exemplary linker components include 6-maleimidocaproyl ("MC"), maleimidopropanoyl ("MP”), valine-citrulline (“val-cit”), alanine-phenylalanine (“ala-phe”), p- aminobenzyloxycarbonyl (“PAB”), N-Succinimidyl 4-(2-pyridylthio) pentanoate (“SPP”), N- Succinimidyl 4-(N-maleimidomethyl)cyclohexane-1 carboxylate (“SMCC”), and N- Succinimidyl (4-iodo-acetyl)aminobenzoate (“SIAB”). Additional linker components are known in the art and some are disclosed herein (see, e.g., U.S. Patent No. 7,498,298).
- the linker may comprise amino acid residues.
- Exemplary amino acid linker components include a dipeptide, a tripeptide, a tetrapeptide or a pentapeptide.
- Exemplary dipeptides include: valine-citrulline (vc or val-cit), alanine- phenylalanine (af or ala-phe).
- Exemplary tripeptides include: glycine-valine-citrulline (gly- val-cit) and glycine-glycine-glycine (gly-gly-gly).
- Amino acid residues which comprise an amino acid linker component include those occurring naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline.
- Amino acid linker components can be designed and optimized in their selectivity for enzymatic cleavage by a particular enzymes, for example, a tumor-associated protease, cathepsin B, C and D, or a plasmin protease.
- Nucleophilic groups on antibodies include, but are not limited to: (i)
- N-terminal amine groups (ii) side chain amine groups, e.g., lysine, (iii) side chain thiol groups, e.g., cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
- Amine, thiol, and hydroxyl groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) active esters such as NHS esters, HOBt esters, haloformates, and acid halides; (ii) alkyl and benzyl halides such as haloacetamides; (iii) aldehydes, ketones, carboxyl, and maleimide groups. Certain antibodies have reducible interchain disulfides, e.g., cysteine bridges. Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol).
- a reducing agent such as DTT (dithiothreitol).
- Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles.
- Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2- iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol.
- Reactive thiol groups may be introduced into the antibody (or fragment thereof) by introducing one, two, three, four, or more cysteine residues ⁇ e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues).
- Antibody drug conjugates disclosed herein may also be produced by modification of the antibody to introduce electrophilic moieties, which can react with nucleophilic substituents on the linker reagent or drug.
- the sugars of glycosylated antibodies may be oxidized, e.g., with periodate oxidizing reagents, to form aldehyde or ketone groups which may react with the amine group of linker reagents or drug moieties.
- the resulting imine Schiff base groups may form a stable linkage, or may be reduced, e.g., by borohydride reagents to form stable amine linkages.
- reaction of the carbohydrate portion of a glycosylated antibody with either glactose oxidase or sodium meta-periodate may yield carbonyl (aldehyde and ketone) groups in the protein that can react with appropriate groups on the drug (Hermanson, Bioconjugate Techniques).
- proteins containing N-terminal serine or threonine residues can react with sodium meta-periodate, resulting in production of an aldehyde in place of the first amino acid (Geoghegan & Stroh, (1992) Bioconjugate Chem. 3:138-146; U.S. Patent No. 5,362,852).
- Such aldehyde can be reacted with a drug moiety or linker nucleophile.
- nucleophilic groups on a drug moiety include, but are not limited to: amine, thiol, hydroxyl, hydrazide, oxime, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide groups capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) active esters such as NHS esters, HOBt esters, haloformates, and acid halides; (ii) alkyl and benzyl halides such as haloacetamides; (iii) aldehydes, ketones, carboxyl, and maleimide groups.
- a fusion protein comprising the antibody and cytotoxic agent may be made, e.g., by recombinant techniques or peptide synthesis.
- the length of DNA may comprise respective regions encoding the two portions of the conjugate either adjacent one another or separated by a region encoding a linker peptide which does not destroy the desired properties of the conjugate.
- the antibody may be conjugated to a
- receptor such streptavidin
- a "ligand” ⁇ e.g., avidin
- cytotoxic agent e.g., a radionucleotide
- Hybridoma cells can be generated by fusing B cells producing a desired antibody with an immortalized cell line, usually a myeloma cell line, so that the resulting fusion cells will be an immortalized cell line that secrets a particular antibody.
- myeloma cells can be first transfected with a nucleic acid encoding a germline antibody V region and can be screened for the expression of the germline V region. Those myeloma cells with highest level of proteolytic light chain expression can be subsequently fused with B cells that produce an antibody with desired target protein specificity.
- the fusion cells will produce two types of antibodies: one is a heterologous antibody containing an endogenous antibody chain (either heavy or light) operably joined to the recombinant germline V region (either heavy or light), and the other is the same antibody that the parental B cells would secrete ⁇ e.g. both endogenous heavy and light chains).
- the operably joined heterologous heavy and light chains can be isolated by conventional methods such as chromatography and identification can be confirmed by target protein binding assays, assays identifying a unique tag of the germline polypeptide, or endopeptidase activity assays described in other sections of this disclosure. In some cases, where the heterologous antibody is the predominant type in quantity among the two types of antibodies, such isolation may not be needed.
- Hybridomas. Including bovine hybridomas may be a source of bovine antibody gene sequences, including ultralong CDR3 sequences.
- a nucleic acid sequence encoding a germline antibody polypeptide of the present disclosure can be introduced into a non-human mammal to generate a transgenic animal that expresses the germline antibody polypeptide.
- the transgene expressed by the transgenic mammals of the present disclosure need not replace at least one allele of the endogenous coding sequence responsible for the variable regions of antibody chains following somatic recombination. Due to allelic exclusion, the presence of an exogenous, post-somatic rearrangement version of the germline V region DNA will inhibit the endogenous alleles of pre-somatic rearrangement V minigenes from undergoing somatic rearrangement and contributing to the makeup of antibody chains this mammal may produce.
- heterologous antibodies comprising one endogenously rearranged antibody chain, and one transgenic gene which was rearranged a priori.
- heterologous antibodies are invaluable in research and in treating certain conditions in live subjects.
- a method that directs the integration of the transgene to the locus of an endogenous allele will fully serve the purpose of practicing the present disclosure as well.
- transgenic animal of the present disclosure is mouse, whereas a number of other transgenic animals can also be produced using the same general method. These animals include, but are not limited to: rabbits, sheep, cattle, and pigs (Jaenisch Science 240:1468-1474 (1988); Hammer et al., J. Animal. Sci. 63:269 (1986); Hammer et al. Nature 315:680 (1985); Wagner et al., Theriogenology 21 :29 (1984)).
- Humanized antibodies comprising an ultralong CDR3, antibody fragments, nucleic acids, or vectors disclosed herein can be formulated in compositions, especially pharmaceutical compositions.
- Such compositions with humanized antibodies comprising an ultralong CDR3 comprise a therapeutically or prophylactically effective amount of a humanized antibodies comprising an ultralong CDR3, antibody fragment, nucleic acid, or vector disclosed herein in admixture with a suitable carrier, e.g., a pharmaceutically acceptable agent.
- a suitable carrier e.g., a pharmaceutically acceptable agent
- humanized antibodies comprising an ultralong CDR3, antibody fragments, nucleic acids, or vectors disclosed herein are sufficiently purified for administration before formulation in a pharmaceutical composition.
- Pharmaceutically acceptable agents for use in the present pharmaceutical compositions include carriers, excipients, diluents, antioxidants, preservatives, coloring, flavoring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials, and surfactants.
- Neutral buffered saline or saline mixed with serum albumin are exemplary appropriate carriers.
- the pharmaceutical compositions may include antioxidants such as ascorbic acid; low molecular weight polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as Tween, pluronics, or polyethylene glycol (PEG).
- antioxidants such as ascorbic acid
- low molecular weight polypeptides such as serum albumin, gelatin, or immunoglobulins
- hydrophilic polymers such as polyviny
- suitable tonicity enhancing agents include alkali metal halides (preferably sodium or potassium chloride), mannitol, sorbitol, and the like.
- Suitable preservatives include benzalkonium chloride, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid and the like. Hydrogen peroxide also may be used as preservative.
- Suitable cosolvents include glycerin, propylene glycol, and PEG.
- Suitable complexing agents include caffeine, polyvinylpyrrolidone, beta- cyclodextrin or hydroxy-propyl-beta-cyclodextrin.
- Suitable surfactants or wetting agents include sorbitan esters, polysorbates such as polysorbate 80, tromethamine, lecithin, cholesterol, tyloxapal, and the like.
- the buffers may be conventional buffers such as acetate, borate, citrate, phosphate, bicarbonate, or Tris-HCI.
- Acetate buffer may be about pH 4-5.5, and Tris buffer can be about pH 7-8.5. Additional pharmaceutical agents are set forth in Remington's Pharmaceutical Sciences, 18th Edition, A. R. Gennaro, ed., Mack Publishing Company, 1990.
- the composition may be in liquid form or in a lyophilized or freeze- dried form and may include one or more lyoprotectants, excipients, surfactants, high molecular weight structural additives and/or bulking agents (see, for example, U.S. Patent Nos. 6,685,940, 6,566,329, and 6,372,716).
- a lyoprotectant is included, which is a non-reducing sugar such as sucrose, lactose or trehalose.
- the amount of lyoprotectant generally included is such that, upon reconstitution, the resulting formulation will be isotonic, although hypertonic or slightly hypotonic formulations also may be suitable.
- lyoprotectant concentrations for sugars ⁇ e.g., sucrose, lactose, trehalose) in the pre-lyophilized formulation are from about 10 mM to about 400 mM.
- a surfactant is included, such as for example, nonionic surfactants and ionic surfactants such as polysorbates ⁇ e.g., polysorbate 20, polysorbate 80); poloxamers ⁇ e.g., poloxamer 188); poly(ethylene glycol) phenyl ethers ⁇ e.g., Triton); sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl- sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl, myristyl-, or cetyl- betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-
- surfactant that may be present in the pre-lyophilized formulation are from about 0.001-0.5%.
- High molecular weight structural additives may include for example, acacia, albumin, alginic acid, calcium phosphate (dibasic), cellulose, carboxymethylcellulose, carboxymethylcellulose sodium, hydroxyethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose, microcrystalline cellulose, dextran, dextrin, dextrates, sucrose, tylose, pregelatinized starch, calcium sulfate, amylose, glycine, bentonite, maltose, sorbitol, ethylcellulose, disodium hydrogen phosphate, disodium phosphate, disodium pyrosulfite, polyvinyl alcohol, gelatin, glucose, guar gum, liquid glucose, compressible sugar, magnesium aluminum silicate, maltodextrin, polyethylene oxide, polymethacrylates, povidone, sodium alginate, tragacanth microcrystalline cellulose, starch, and
- compositions may be suitable for parenteral administration.
- Exemplary compositions are suitable for injection or infusion into an animal by any route available to the skilled worker, such as intraarticular, subcutaneous, intravenous, intramuscular, intraperitoneal, intracerebral (intraparenchymal), intracerebroventricular, intramuscular, intraocular, intraarterial, or intralesional routes.
- a parenteral formulation typically will be a sterile, pyrogen-free, isotonic aqueous solution, optionally containing pharmaceutically acceptable preservatives.
- non-aqueous solvents examples include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringers' dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like.
- Preservatives and other additives may also be present, such as, for example, anti-microbials, anti-oxidants, chelating agents, inert gases and the like. See generally, Remington's Pharmaceutical Science, 16th Ed., Mack Eds., 1980.
- compositions described herein may be formulated for controlled or sustained delivery in a manner that provides local concentration of the product ⁇ e.g., bolus, depot effect) and/or increased stability or half-life in a particular local environment.
- the compositions can include the formulation of humanized antibodies comprising an ultralong CDR3, antibody fragments, nucleic acids, or vectors disclosed herein with particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, etc., as well as agents such as a biodegradable matrix, injectable microspheres, microcapsular particles, microcapsules, bioerodible particles beads, liposomes, and implantable delivery devices that provide for the controlled or sustained release of the active agent which then can be delivered as a depot injection.
- Such sustained- or controlled-delivery means are known and a variety of polymers have been developed and used for the controlled release and delivery of drugs.
- Such polymers are typically biodegradable and biocompatible.
- Polymer hydrogels including those formed by complexation of enantiomeric polymer or polypeptide segments, and hydrogels with temperature or pH sensitive properties, may be desirable for providing drug depot effect because of the mild and aqueous conditions involved in trapping bioactive protein agents ⁇ e.g., humanized antibodies comprising an ultralong CDR3). See, for example, the description of controlled release porous polymeric microparticles for the delivery of pharmaceutical compositions in WO 93/15722.
- Suitable materials for this purpose include polylactides (see, e.g., U.S. Patent No. 3,773,919), polymers of poly-(a-hydroxycarboxylic acids), such as poly-D- (-)-3-hydroxybutyric acid (EP 133,988A), copolymers of L-glutamic acid and gamma ethyl- L-glutamate (Sidman et al., Biopolymers, 22: 547-556 (1983)), poly(2-hydroxyethyl- methacrylate) (Langer et al., J. Biomed. Mater. Res., 15: 167-277 (1981 ), and Langer, Chem.
- biodegradable polymers include poly(lactones), poly(acetals), poly(orthoesters), and poly(orthocarbonates).
- Sustained-release compositions also may include liposomes, which can be prepared by any of several methods known in the art (see, e.g., Eppstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688-92 (1985)).
- the carrier itself, or its degradation products, should be nontoxic in the target tissue and should not further aggravate the condition. This can be determined by routine screening in animal models of the target disorder or, if such models are unavailable, in normal animals.
- Microencapsulation of recombinant proteins for sustained release has been performed successfully with human growth hormone (rhGH), interferon-(rhlFN-), interleukin-2, and MN rgp120. Johnson et al., Nat. Med., 2:795-799 (1996); Yasuda, Biomed. Ther., 27:1221-1223 (1993); Hora et al., Bio/Technology.
- rhGH human growth hormone
- interferon-(rhlFN-) interleukin-2
- MN rgp120 MN rgp120.
- the degradability of this polymer can be depending on its molecular weight and composition.
- Lewis "Controlled release of bioactive agents from lactide/glycolide polymer," in: M. Chasin and R. Langer (Eds.), Biodegradable Polymers as Drug Delivery Systems (Marcel Dekker: New York, 1990), pp. 1 -41 .
- Additional examples of sustained release compositions include, for example, EP 58,481A, U.S. Patent No. 3,887,699, EP 158,277A, Canadian Patent No. 1 176565, U. Sidman et al., Biopolymers 22, 547 [1983], R. Langer et al., Chem. Tech.
- Bioadhesive polymers are also contemplated for use in or with compositions of the present disclosure.
- Bioadhesives are synthetic and naturally occurring materials able to adhere to biological substrates for extended time periods.
- Carbopol and polycarbophil are both synthetic cross-linked derivatives of poly(acrylic acid).
- Bioadhesive delivery systems based on naturally occurring substances include for example hyaluronic acid, also known as hyaluronan.
- Hyaluronic acid is a naturally occurring mucopolysaccharide consisting of residues of D-glucuronic and N-acetyl-D-glucosamine.
- Hyaluronic acid is found in the extracellular tissue matrix of vertebrates, including in connective tissues, as well as in synovial fluid and in the vitreous and aqueous humor of the eye. Esterified derivatives of hyaluronic acid have been used to produce microspheres for use in delivery that are biocompatible and biodegradable (see, for example, Cortivo et al., Biomaterials (1991 ) 12:727-730; EP 517,565; WO 96/29998; Ilium et al., J. Controlled Rel. (1994) 29:133-141 ).
- Exemplary hyaluronic acid containing compositions of the present disclosure comprise a hyaluronic acid ester polymer in an amount of approximately 0.1 % to about 40% (w/w) of a humanized antibody comprising an ultralong CDR3 to hyaluronic acid polymer.
- Both biodegradable and non-biodegradable polymeric matrices may be used to deliver compositions of the present disclosure, and such polymeric matrices may comprise natural or synthetic polymers. Biodegradable matrices are preferred. The period of time over which release occurs is based on selection of the polymer. Typically, release over a period ranging from between a few hours and three to twelve months is most desirable.
- Exemplary synthetic polymers which may be used to form the biodegradable delivery system include: polymers of lactic acid and glycolic acid, polyamides, polycarbonates, polyalkylenes, polyalkylene glycols, polyalkylene oxides, polyalkylene terepthalates, polyvinyl alcohols, polyvinyl ethers, polyvinyl esters, poly-vinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyanhydrides, polyurethanes and co-polymers thereof, poly(butic acid), poly(valeric acid), alkyl cellulose, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, polymers of acrylic and methacrylic esters, methyl cellulose, ethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, hydroxybutyl methyl cellulose, cellulose acetate, cellulose propionate, cellulose
- Exemplary natural polymers include alginate and other polysaccharides including dextran and cellulose, collagen, chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), albumin and other hydrophilic proteins, zein and other prolamines and hydrophobic proteins, copolymers and mixtures thereof. In general, these materials degrade either by enzymatic hydrolysis or exposure to water in vivo, by surface or bulk erosion.
- the polymer optionally is in the form of a hydrogel (see, for example, WO 04/009664, WO 05/087201 , Sawhney, et al., Macromolecules, 1993, 26, 581 -587) that can absorb up to about 90% of its weight in water and further, optionally is cross-linked with multi-valent ions or other polymers.
- Delivery systems also include non-polymer systems that are lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-di- and tri-glycerides; hydrogel release systems; silastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like.
- lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-di- and tri-glycerides
- hydrogel release systems silastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like.
- Specific examples include, but are not limited to: (a) erosional systems in which the product is contained in a form within a matrix such as those described in U.S. Patent Nos. 4,452,775, 4,675,189 and 5,736, 152 and (b) diffusional systems in which a product permeates at a
- Patent Nos. 3,854,480, 5, 133,974 and 5,407,686 Liposomes containing the product may be prepared by methods known methods, such as for example (DE 3,218,121 ; Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688-3692 (1985); Hwang et al., Proc. Natl. Acad. Sci. USA, 77: 4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641 ; JP 83-1 18008; U.S. Patent Nos. 4,485,045 and 4,544,545; and EP 102,324).
- compositions may be administered locally via implantation into the affected area of a membrane, sponge, or other appropriate material on to which a humanized antibody comprising an ultralong CDR3, antibody fragment, nucleic acid, or vector disclosed herein has been absorbed or encapsulated.
- a humanized antibody comprising an ultralong CDR3 antibody fragment, nucleic acid, or vector disclosed herein may be directly through the device via bolus, or via continuous administration, or via catheter using continuous infusion.
- a pharmaceutical composition comprising a humanized antibody comprising an ultralong CDR3, antibody fragment, nucleic acid, or vector disclosed herein may be formulated for inhalation, such as for example, as a dry powder. Inhalation solutions also may be formulated in a liquefied propellant for aerosol delivery. In yet another formulation, solutions may be nebulized. Additional pharmaceutical composition for pulmonary administration include, those described, for example, in WO 94/20069, which discloses pulmonary delivery of chemically modified proteins. For pulmonary delivery, the particle size should be suitable for delivery to the distal lung. For example, the particle size may be from 1 ⁇ to 5 ⁇ ; however, larger particles may be used, for example, if each particle is fairly porous.
- compositions containing humanized antibodies comprising an ultralong CDR3, antibody fragments, nucleic acids, or vectors disclosed herein may be administered orally.
- Formulations administered in this fashion may be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized.
- Additional agents may be included to facilitate absorption of a selective binding agent. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders also can be employed.
- Another preparation may involve an effective quantity of a humanized antibody comprising an ultralong CDR3, antibody fragment, nucleic acid, or vector disclosed herein in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
- excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- Suitable and/or preferred pharmaceutical formulations may be determined in view of the present disclosure and general knowledge of formulation technology, depending upon the intended route of administration, delivery format, and desired dosage. Regardless of the manner of administration, an effective dose may be calculated according to patient body weight, body surface area, or organ size. Further refinement of the calculations for determining the appropriate dosage for treatment involving each of the formulations described herein are routinely made in the art and is within the ambit of tasks routinely performed in the art. Appropriate dosages may be ascertained through use of appropriate dose-response data.
- humanized antibodies comprising an ultralong CDR3 or fragments thereof are provided with a modified Fc region where a naturally-occurring Fc region is modified to increase the half-life of the antibody or fragment in a biological environment, for example, the serum half-life or a half-life measured by an in vitro assay.
- a naturally-occurring Fc region is modified to increase the half-life of the antibody or fragment in a biological environment, for example, the serum half-life or a half-life measured by an in vitro assay.
- molecules such as PEG or other water soluble polymers, including polysaccharide polymers
- This may also be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment ⁇ e.g., by mutation of the appropriate region in the antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody fragment at either end or in the middle, e.g., by DNA or peptide synthesis) (see, International Publication No. W096/32478).
- Salvage receptor binding epitope refers to an epitope of the Fc region of an IgG molecule ⁇ e.g., lgG1 , lgG2, lgG3, or lgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
- a salvage receptor binding epitope may include a region wherein any one or more amino acid residues from one or two loops of a Fc domain are transferred to an analogous position of the antibody fragment. Even more preferably, three or more residues from one or two loops of the Fc domain are transferred. Still more preferred, the epitope is taken from the CH2 domain of the Fc region ⁇ e.g., of an IgG) and transferred to the CH1 , CH3, or VH region, or more than one such region, of the antibody. Alternatively, the epitope is taken from the CH2 domain of the Fc region and transferred to the C L region or V L region, or both, of the antibody fragment. See also WO 97/34631 and WO 96/32478 which describe Fc variants and their interaction with the salvage receptor.
- Mutation of residues within Fc receptor binding sites may result in altered effector function, such as altered ADCC or CDC activity, or altered half-life.
- Potential mutations include insertion, deletion or substitution of one or more residues, including substitution with alanine, a conservative substitution, a non-conservative substitution, or replacement with a corresponding amino acid residue at the same position from a different IgG subclass ⁇ e.g., replacing an lgG1 residue with a corresponding lgG2 residue at that position).
- kits which comprise one or more compounds or compositions packaged in a manner which facilitates their use to practice methods of the present disclosure.
- a kit includes a compound or composition described herein (e.g., a composition comprising a humanized antibody comprising an ultralong CDR3 alone or in combination with a second agent), packaged in a container with a label affixed to the container or a package insert that describes use of the compound or composition in practicing the method.
- Suitable containers include, for example, bottles, vials, syringes, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises a humanized antibody comprising an ultralong CDR3 as disclosed herein; and (b) a second container with a composition contained therein, wherein the composition comprises a further therapeutic agent.
- the article of manufacture in this embodiment disclosed herein may further comprise a package insert indicating that the first and second compositions can be used to treat a particular condition.
- the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- At least 7 antibody heavy chain variable region sequences are publicly available that comprise an ultralong CDR3 of bovine origin. These sequences are shown in the alignment in Figure 1. As shown in Figure 1 , the ultralong CDR3s present within these variable region sequences range in length from 56 to 61 amino acids. Strikingly, the sequence alignment indicates that the amino acid residues positioned in the N-terminal ends of the CDR3s are particularly conserved. Following the first cysteine residue in each of these variable region sequences, an amino acid sequence pattern of "TTVHQ" and variants thereof are found. This is unusual in that most heavy chain variable regions of most species end with the amino acid sequence "CAK” or "CAR". This unusual sequence motif (e.g., "TTVHQ”) may be characteristic of the structure of an ultralong CDR3.
- TTVHQ amino acid sequence motif
- a VH4-39 human acceptor framework (SEQ ID NO: 31 ) is used.
- the nucleotides encoding the last two amino acid residues of VH4-39 e.g., "AR”
- nucleotides encoding a "TTVHQ” motif are added to the 3' end of the DNA sequence encoding the VH4-39 human acceptor framework after the nucleotides that encode the second cysteine residue of the VH4-39 human acceptor framework (e.g., after the nucleotides that code for amino acid position 97 of SEQ ID NO: 31 ).
- the DNA encoding a portion of the ultralong CDR3 from BLV1 H12 (e.g., the portion of the ultralong CDR3 beginning at the first glutamic acid residue (E) in BLV1 H12; ETKKYQSCPDGYRERSDCSNRPACGTSDCCRVSVFGNCLTTLPVSYSYTYNYEWHVD) is fused to the 3' end of the polynucleotide encoding the "TTVHQ" motif.
- DNA encoding a partial human JH4 region, beginning with the conserved tryptophan residue common to J region sequences, is added to the 3' end of the portion of the ultralong CDR3 sequence derived from BLV1H12.
- the following antibody gene encoding a partially human antibody comprising an ultralong CDR3 is derived: cagctgcagctgcaggagtcgggcccaggactggtgaagccttcggagaccctgtccctcacctgca ctgtctctggtggctccatcagcagtagtagttactactggggctggatccgccagcccccagggaa ggggctggagtggattgggagtatctattatagtgggagcacctactacaacccgtccctcaagagt cgagtcaccatatccgtagacacgtccaagaaccagttctcccctgaagctgtgtgaccgccgaccgccgcaccagaccagttctccctgaagctgtgtgaccgccg cagacacgg
- amino acid sequence as translated from this partially human variable region gene is:
- this humanized VH sequence is recombinantly fused in-frame with a human heavy chain constant region and paired with a light chain for recombinant antibody production.
- an ultralong CDR3 derived from BLV5B8 is incorporated into the VH4-34 human acceptor framework (e.g., 4-34 * 02 (SEQ ID NO: 33); or 4-34 * 09 (SEQ ID NO: 34), along with a portion of the human JH2 region to produce a humanized antibody comprising an ultralong CDR3.
- VH4-34 human acceptor framework e.g., 4-34 * 02 (SEQ ID NO: 33); or 4-34 * 09 (SEQ ID NO: 34
- nucleotides encoding the last two amino acid residues of the VH4-34 human acceptor framework are removed from the VH4-34 human acceptor framework, and nucleotides encoding a "TTVHQ" motif are added to the 3' end of the VH4-34 human acceptor framework after the nucleotides that code for the second conserved cysteine residue in the VH4-34 human acceptor framework (e.g., after the nucleotides that code for amino acid position 95 of SEQ ID NOS: 33 or 34).
- amino acid sequence as translated from this partially human variable region gene is:
- this humanized VH sequence is then recombinantly fused in-frame with a human heavy chain constant region and paired with a light chain for recombinant antibody production.
- any heavy chain variable region can be paired with a light chain variable region to produce a recombinant antibody.
- Bovine antibodies containing ultralong VH CDR3s typically pair with a restricted set of lambda light chains.
- Several human VL sequences can be used to pair with the sequences above, including VL1 -47, VL1-40, VL1 -51 , VL2-18, which are homologous to the lambda region derived from Bos taurus.
- Libraries of polynucleotides encoding antibodies that comprise an ultralong CDR3 may be constructed by any method known in the art.
- Such polynucleotide libraries may be present within a plurality of vectors (e.g., a library of vectors) including, for example, vectors present within a plurality of host cells (e.g., a library of host cells).
- the libraries may present in any known format including, in a spatially addressed format (see, e.g., WO 1 1/056997; and Mao et al. (2010) Nat Biotech 28:1 195-1202).
- bovine spleen and lymph nodes were obtained from Animal Technologies (Tyler, TX), or from Texas A&M University. Total RNA was isolated from bovine tissues from three different cows (MIDI , MID10, and MID 1 1 ) using TRIzol reagent (Invitrogen, Carlsbad, CA, USA) followed by on column digestion of DNA using the RNeasy Mini Kit (Qiagen, Valencia, CA, USA). Alternatively, cDNA may be obtained from the lymph nodes of a bovine immunized with an antigen (e.g., BVDV).
- an antigen e.g., BVDV
- RNA quantity and quality were assessed with Nanodrop (Thermal Scientific), Qubit RNA and Agilent 2100 Bioanalyzer (Agilent, Santa Clara, CA, USA), following the manufacturer's protocols. Total RNA was used as a template for cDNA synthesis catalyzed by Superscript II (Invitrogen).
- CDR H3s were defined by the third residue following the conserved cysteine in framework 3 to the residue immediately preceding the conserved tryptophan in framework 4.
- V H BUL was identified by BLAST searching the bovine genome (assembly Btau_4.6.1 ) with multiple ultralong V H sequences identified by deep sequencing.
- the deep sequencing identified a total of 1 1 ,728 ultralong CDR3 sequences with having a length between 44 and 69 amino acid residues.
- Table 2 Summary of deep sequencing results from bovine spleen
- ultralong CDR3 comprise a cysteine motif (e.g., a pattern of cysteine residues) that comprises between 3 and 12 cysteine residues.
- Representative examples of cysteine patterns are shown for the deep sequencing run for three different cows (MIDI , MID10, and MID1 1 ) as well as their abundance in the run (Tables 3-5).
- the cysteines in the ultralong CDR3 regions are symbolized as "C”.
- the amino acids between two cysteines are symbolized as "X n ".
- Exemplary sequences comprising cysteine motifs identified from the deep sequencing are presented in Figures 2A-C.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Virology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Peptides Or Proteins (AREA)
- Insects & Arthropods (AREA)
- Tropical Medicine & Parasitology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Endocrinology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/905,765 US10640574B2 (en) | 2013-07-18 | 2014-07-18 | Humanized antibodies with ultralong complementary determining regions |
| JP2016527148A JP6687520B2 (ja) | 2013-07-18 | 2014-07-18 | 極めて長い相補性決定領域を有するヒト化抗体 |
| CN201480051514.8A CN105814074B (zh) | 2013-07-18 | 2014-07-18 | 具有超长互补决定区的人源化抗体 |
| EP14748405.9A EP3022221B1 (en) | 2013-07-18 | 2014-07-18 | Humanized antibodies with ultralong complementarity determining regions |
| AU2014290361A AU2014290361B2 (en) | 2013-07-18 | 2014-07-18 | Humanized antibodies with ultralong complementarity determining regions |
| CA2918370A CA2918370A1 (en) | 2013-07-18 | 2014-07-18 | Humanized antibodies with ultralong complementarity determining regions |
| US16/831,508 US11530493B2 (en) | 2013-07-18 | 2020-03-26 | Humanized antibodies with ultralong complementary determining regions |
| US18/054,045 US12606937B2 (en) | 2013-07-18 | 2022-11-09 | Humanized antibodies with ultralong complementary determining regions |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361856010P | 2013-07-18 | 2013-07-18 | |
| US61/856,010 | 2013-07-18 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/905,765 A-371-Of-International US10640574B2 (en) | 2013-07-18 | 2014-07-18 | Humanized antibodies with ultralong complementary determining regions |
| US16/831,508 Continuation US11530493B2 (en) | 2013-07-18 | 2020-03-26 | Humanized antibodies with ultralong complementary determining regions |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2015010100A2 true WO2015010100A2 (en) | 2015-01-22 |
| WO2015010100A3 WO2015010100A3 (en) | 2015-06-25 |
Family
ID=51299010
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/047315 Ceased WO2015010100A2 (en) | 2013-07-18 | 2014-07-18 | Humanized antibodies with ultralong complementarity determining regions |
Country Status (7)
| Country | Link |
|---|---|
| US (3) | US10640574B2 (https=) |
| EP (1) | EP3022221B1 (https=) |
| JP (3) | JP6687520B2 (https=) |
| CN (2) | CN111518199A (https=) |
| AU (1) | AU2014290361B2 (https=) |
| CA (1) | CA2918370A1 (https=) |
| WO (1) | WO2015010100A2 (https=) |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10144768B2 (en) | 2015-12-04 | 2018-12-04 | Novartis Ag | Antibody cytokine engrafted compositions and methods of use for immunoregulation |
| WO2019140150A1 (en) | 2018-01-12 | 2019-07-18 | Bristol-Myers Squibb Company | Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer |
| WO2019241002A1 (en) | 2018-06-13 | 2019-12-19 | Crystal Bioscience Inc. | Transgenic chicken that makes antibodies with long cdr-h3s stabilized by multiple disulfide bridges and diversified by gene conversion |
| US10562980B2 (en) | 2012-01-09 | 2020-02-18 | The Scripps Research Institute | Humanized antibodies |
| US10640574B2 (en) | 2013-07-18 | 2020-05-05 | Taurus Biosciences, Llc | Humanized antibodies with ultralong complementary determining regions |
| WO2021081440A3 (en) * | 2019-10-24 | 2021-05-27 | Minotaur Therapeutics, Inc. | Chimeric cytokine modified antibodies and methods of use thereof |
| WO2021191424A1 (en) * | 2020-03-27 | 2021-09-30 | UCB Biopharma SRL | Autonomous knob domain peptides |
| WO2022232321A1 (en) * | 2021-04-28 | 2022-11-03 | Minotaur Therapeutics, Inc. | Humanized chimeric bovine antibodies and methods of use |
| WO2022241058A1 (en) * | 2021-05-12 | 2022-11-17 | Applied Biomedical Science Institute | Methods of screening and expression of disulfide-bonded binding polypeptides |
| WO2022241057A1 (en) * | 2021-05-12 | 2022-11-17 | Applied Biomedical Science Institute | Binding polypeptides against sars cov-2 and uses thereof |
| WO2023192478A1 (en) | 2022-04-01 | 2023-10-05 | Bristol-Myers Squibb Company | Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer |
| US11932673B2 (en) | 2017-07-12 | 2024-03-19 | Maxion Therapeutics Limited | Sodium channel inhibitors |
| US11930837B2 (en) | 2017-05-24 | 2024-03-19 | Novartis Ag | Antibody-cytokine engrafted proteins and methods of use for immune related disorders |
| US12006354B2 (en) | 2017-05-24 | 2024-06-11 | Novartis Ag | Antibody-IL2 engrafted proteins and methods of use in the treatment of cancer |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG181893A1 (en) * | 2009-12-22 | 2012-08-30 | Hoffmann La Roche | Sequence dependent aggregation |
| JP7308505B2 (ja) * | 2016-01-08 | 2023-07-14 | マキシオン セラピューティクス リミテッド | 多様性を変化させた足場ドメインを有する結合メンバー |
| US20230331827A1 (en) * | 2017-07-12 | 2023-10-19 | Maxion Therapeutics Limited | Potassium channel inhibitors |
| CN111954527A (zh) * | 2018-04-09 | 2020-11-17 | 梅约医学教育与研究基金会 | 治疗移植物抗宿主病的方法和材料 |
| EP3873540A4 (en) | 2018-10-31 | 2022-07-27 | Mayo Foundation for Medical Education and Research | METHODS AND MATERIALS FOR THE TREATMENT OF CANCER |
| WO2020092839A1 (en) | 2018-10-31 | 2020-05-07 | Mayo Foundation For Medical Education And Research | Methods and materials for treating cancer |
| RU2731293C1 (ru) * | 2019-04-12 | 2020-09-01 | Игорь Петрович Белецкий | Способ получения генно-модифицированных линий клеток натуральных киллеров с нокаутированным геном PD-1 и повышенной экспрессией белков семейства Фактора Некроза Опухолей для иммунотерапии онкологических заболеваний |
| CN120129934A (zh) | 2022-10-24 | 2025-06-10 | 软银集团股份有限公司 | 信息处理装置、信息处理方法以及信息处理程序 |
| TW202600011A (zh) | 2023-01-18 | 2026-01-01 | 美商基利科學股份有限公司 | 具有經改變重鏈基因座之嵌合基因轉殖免疫球蛋白小鼠及其製造及使用方法 |
Citations (176)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3854480A (en) | 1969-04-01 | 1974-12-17 | Alza Corp | Drug-delivery system |
| US3887699A (en) | 1969-03-24 | 1975-06-03 | Seymour Yolles | Biodegradable polymeric article for dispensing drugs |
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| EP0003089A1 (fr) | 1978-01-06 | 1979-07-25 | Bernard David | Séchoir pour feuilles imprimées par sérigraphie |
| US4248870A (en) | 1978-10-27 | 1981-02-03 | Takeda Chemical Industries, Ltd. | Maytansinoids and use |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| US4260608A (en) | 1978-11-14 | 1981-04-07 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and methods of use thereof |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| EP0033988A2 (en) | 1980-02-04 | 1981-08-19 | THE PROCTER & GAMBLE COMPANY | Method of making a pattern densified fibrous web having spaced, binder impregnated high density zones |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| US4308268A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4308269A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4317821A (en) | 1979-06-08 | 1982-03-02 | Takeda Chemical Industries, Ltd. | Maytansinoids, their use and pharmaceutical compositions thereof |
| US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| EP0052322A2 (de) | 1980-11-10 | 1982-05-26 | Gersonde, Klaus, Prof. Dr. | Verfahren zur Herstellung von Lipid-Vesikeln durch Ultraschallbehandlung, Anwendung des Verfahrens und Vorrichtung zur Durchführung des Verfahrens |
| USRE30985E (en) | 1978-01-01 | 1982-06-29 | Serum-free cell culture media | |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
| US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
| JPS58118008A (ja) | 1982-01-06 | 1983-07-13 | Nec Corp | デ−タ処理装置 |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| DE3218121A1 (de) | 1982-05-14 | 1983-11-17 | Leskovar, Peter, Dr.-Ing., 8000 München | Arzneimittel zur tumorbehandlung |
| US4419446A (en) | 1980-12-31 | 1983-12-06 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant DNA process utilizing a papilloma virus DNA as a vector |
| US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
| EP0102324A2 (de) | 1982-07-29 | 1984-03-07 | Ciba-Geigy Ag | Lipide und Tenside in wässriger Phase |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4452775A (en) | 1982-12-03 | 1984-06-05 | Syntex (U.S.A.) Inc. | Cholesterol matrix delivery system for sustained release of macromolecules |
| CA1176565A (en) | 1980-11-18 | 1984-10-23 | John S. Kent | Microencapsulation of water soluble polypeptides |
| US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
| EP0142641A2 (de) | 1983-09-26 | 1985-05-29 | Udo Dr. Ehrenfeld | Mittel und Erzeugnis für die Diagnose und Therapie von Tumoren sowie zur Behandlung von Schwächen der zelligen und humoralen Immunabwehr |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
| EP0158277A2 (de) | 1984-04-11 | 1985-10-16 | Hoechst Aktiengesellschaft | Implantierbare Zubereitungen von regulatorischen Peptiden mit gesteuerter Freisetzung und Verfahren zur ihrer Herstellung |
| US4560655A (en) | 1982-12-16 | 1985-12-24 | Immunex Corporation | Serum-free cell culture medium and process for making same |
| US4601978A (en) | 1982-11-24 | 1986-07-22 | The Regents Of The University Of California | Mammalian metallothionein promoter system |
| WO1987000195A1 (en) | 1985-06-28 | 1987-01-15 | Celltech Limited | Animal cell culture |
| US4657866A (en) | 1982-12-21 | 1987-04-14 | Sudhir Kumar | Serum-free, synthetic, completely chemically defined tissue culture media |
| US4675189A (en) | 1980-11-18 | 1987-06-23 | Syntex (U.S.A.) Inc. | Microencapsulation of water soluble active polypeptides |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4767704A (en) | 1983-10-07 | 1988-08-30 | Columbia University In The City Of New York | Protein-free culture medium |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| WO1990003430A1 (en) | 1988-09-23 | 1990-04-05 | Cetus Corporation | Cell culture medium for enhanced cell growth, culture longevity and product expression |
| US4927762A (en) | 1986-04-01 | 1990-05-22 | Cell Enterprises, Inc. | Cell culture medium with antioxidant |
| US4965199A (en) | 1984-04-20 | 1990-10-23 | Genentech, Inc. | Preparation of functional human factor VIII in mammalian cells using methotrexate based selection |
| US4970198A (en) | 1985-10-17 | 1990-11-13 | American Cyanamid Company | Antitumor antibiotics (LL-E33288 complex) |
| US4975278A (en) | 1988-02-26 | 1990-12-04 | Bristol-Myers Company | Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| EP0425235A2 (en) | 1989-10-25 | 1991-05-02 | Immunogen Inc | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5053394A (en) | 1988-09-21 | 1991-10-01 | American Cyanamid Company | Targeted forms of methyltrithio antitumor agents |
| US5079233A (en) | 1987-01-30 | 1992-01-07 | American Cyanamid Company | N-acyl derivatives of the LL-E33288 antitumor antibiotics, composition and methods for using the same |
| WO1992000373A1 (en) | 1990-06-29 | 1992-01-09 | Biosource Genetics Corporation | Melanin production by transformed microorganisms |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| US5122469A (en) | 1990-10-03 | 1992-06-16 | Genentech, Inc. | Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins |
| US5133974A (en) | 1989-05-05 | 1992-07-28 | Kv Pharmaceutical Company | Extended release pharmaceutical formulations |
| EP0517565A2 (en) | 1991-05-31 | 1992-12-09 | FIDIA S.p.A. | Process for the preparation of microspheres containing biologically active components |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| WO1993015722A1 (en) | 1992-02-07 | 1993-08-19 | Syntex (Usa) Inc. | Controlled delivery of pharmaceuticals from preformed porous microparticles |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| WO1993021232A1 (en) | 1992-04-10 | 1993-10-28 | Research Development Foundation | IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS |
| US5264365A (en) | 1990-11-09 | 1993-11-23 | Board Of Regents, The University Of Texas System | Protease-deficient bacterial strains for production of proteolytically sensitive polypeptides |
| WO1994004690A1 (en) | 1992-08-17 | 1994-03-03 | Genentech, Inc. | Bispecific immunoadhesins |
| WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
| WO1994020069A1 (en) | 1993-03-08 | 1994-09-15 | Amgen Inc. | Pulmonary administration of granulocyte colony stimulating factor |
| US5362852A (en) | 1991-09-27 | 1994-11-08 | Pfizer Inc. | Modified peptide derivatives conjugated at 2-hydroxyethylamine moieties |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| US5407686A (en) | 1991-11-27 | 1995-04-18 | Sidmak Laboratories, Inc. | Sustained release composition for oral administration of active ingredient |
| WO1996007399A1 (en) | 1994-09-09 | 1996-03-14 | Takeda Chemical Industries, Ltd. | Sustained release preparation containing metal salt of a peptide |
| WO1996007754A1 (en) | 1994-09-02 | 1996-03-14 | The Scripps Research Institute | Methods for producing antibody libraries using universal or randomized immunoglobulin light chains |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5508192A (en) | 1990-11-09 | 1996-04-16 | Board Of Regents, The University Of Texas System | Bacterial host strains for producing proteolytically sensitive polypeptides |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| WO1996029998A1 (en) | 1995-03-28 | 1996-10-03 | Fidia Advanced Biopolymers S.R.L. | Nanospheres comprising a biocompatible polysaccharide |
| WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| WO1996040072A2 (en) | 1995-06-07 | 1996-12-19 | Alkermes Controlled Therapeutics, Inc. | Composition for sustained release of human growth hormone |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
| WO1997003692A1 (en) | 1995-07-14 | 1997-02-06 | Novo Nordisk A/S | A stabilized pharmaceutical formulation comprising a growth hormone pre-treated with zinc and optionally lysine or calcium ions |
| US5606040A (en) | 1987-10-30 | 1997-02-25 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| WO1997017852A1 (de) | 1995-11-15 | 1997-05-22 | Hoechst Schering Agrevo Gmbh | Synergistische herbizide mischungen |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5648237A (en) | 1991-09-19 | 1997-07-15 | Genentech, Inc. | Expression of functional antibody fragments |
| US5654010A (en) | 1992-12-02 | 1997-08-05 | Alkermes, Inc. | Composition for sustained release of human growth hormone |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| US5736152A (en) | 1995-10-27 | 1998-04-07 | Atrix Laboratories, Inc. | Non-polymeric sustained release delivery system |
| US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6027888A (en) | 1996-04-05 | 2000-02-22 | Board Of Regents, The University Of Texas System | Methods for producing soluble, biologically-active disulfide-bond containing eukaryotic proteins in bacterial cells |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6083715A (en) | 1997-06-09 | 2000-07-04 | Board Of Regents, The University Of Texas System | Methods for producing heterologous disulfide bond-containing polypeptides in bacterial cells |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000061739A1 (fr) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| WO2001029246A1 (fr) | 1999-10-19 | 2001-04-26 | Kyowa Hakko Kogyo Co., Ltd. | Procede de production d'un polypeptide |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US6372716B1 (en) | 1994-04-26 | 2002-04-16 | Genetics Institute, Inc. | Formulations for factor IX |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
| US20020164328A1 (en) | 2000-10-06 | 2002-11-07 | Toyohide Shinkawa | Process for purifying antibody |
| WO2002088172A2 (en) | 2001-04-30 | 2002-11-07 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US6566329B1 (en) | 1999-06-28 | 2003-05-20 | Novo Nordisk A/S | Freeze-dried preparation of human growth hormone |
| US20030115614A1 (en) | 2000-10-06 | 2003-06-19 | Yutaka Kanda | Antibody composition-producing cell |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| WO2003085119A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa |
| WO2003084570A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM |
| WO2004009664A2 (en) | 2002-07-19 | 2004-01-29 | Omeros Corporation | Biodegradable triblock copolymers, synthesis methods therefor, and hydrogels and biomaterials made there from |
| US6685940B2 (en) | 1995-07-27 | 2004-02-03 | Genentech, Inc. | Protein formulation |
| EP1391213A1 (en) | 2002-08-21 | 2004-02-25 | Boehringer Ingelheim International GmbH | Compositions and methods for treating cancer using maytansinoid CD44 antibody immunoconjugates and chemotherapeutic agents |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6740747B2 (en) | 2001-04-20 | 2004-05-25 | Azad Kaushik | Bovine VDJ cassette, BF1H1, suitable for antigenization |
| US20040110282A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| US20040109865A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Antibody composition-containing medicament |
| US20040132140A1 (en) | 2002-04-09 | 2004-07-08 | Kyowa Hakko Kogyo Co., Ltd. | Production process for antibody composition |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2005035778A1 (ja) | 2003-10-09 | 2005-04-21 | Kyowa Hakko Kogyo Co., Ltd. | α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法 |
| WO2005035586A1 (ja) | 2003-10-08 | 2005-04-21 | Kyowa Hakko Kogyo Co., Ltd. | 融合蛋白質組成物 |
| WO2005053742A1 (ja) | 2003-12-04 | 2005-06-16 | Kyowa Hakko Kogyo Co., Ltd. | 抗体組成物を含有する医薬 |
| WO2005087201A1 (en) | 2004-03-18 | 2005-09-22 | Octoplus Technologies B.V. | Hydrogel microspheres with improved release profile |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US6998253B1 (en) | 1995-04-14 | 2006-02-14 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| US7196185B2 (en) | 2001-04-20 | 2007-03-27 | Azad Kumar Kaushik | Bovine germline D-genes and their application |
| US7498289B2 (en) | 1999-02-22 | 2009-03-03 | Celanese International Corporation | Ni catalysts and methods for alkane dehydrogenation |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2010054007A1 (en) | 2008-11-07 | 2010-05-14 | Fabrus Llc | Combinatorial antibody libraries and uses thereof |
| WO2011056997A1 (en) | 2009-11-04 | 2011-05-12 | Fabrus Llc | Methods for affinity maturation-based antibody optimization |
Family Cites Families (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB9014932D0 (en) * | 1990-07-05 | 1990-08-22 | Celltech Ltd | Recombinant dna product and method |
| GB9207479D0 (en) * | 1992-04-06 | 1992-05-20 | Scotgen Ltd | Novel antibodies for treatment and prevention of respiratory syncytial virus infection in animals and man |
| US6955900B1 (en) | 1993-02-02 | 2005-10-18 | The Scripps Research Institute | Methods for producing polypeptide binding sites, monoclonal antibodies and compositions thereof |
| EP0739981A1 (en) | 1995-04-25 | 1996-10-30 | Vrije Universiteit Brussel | Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes |
| JP2005500806A (ja) | 2000-09-15 | 2005-01-13 | コーリー ファーマシューティカル ゲーエムベーハー | CpGに基づく免疫アゴニスト/免疫アンタゴニストの高スループットスクリーニングのためのプロセス |
| MXPA05000511A (es) * | 2001-07-12 | 2005-09-30 | Jefferson Foote | Anticuepros super humanizados. |
| AU2002332041A1 (en) | 2001-10-05 | 2003-04-22 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| AU2002364586A1 (en) | 2001-12-21 | 2003-07-30 | Delta Biotechnology Limited | Albumin fusion proteins |
| US8491896B2 (en) | 2002-06-14 | 2013-07-23 | Immunomedics, Inc. | Anti-pancreatic cancer antibodies |
| AU2003210060B2 (en) * | 2002-03-22 | 2010-02-25 | Aprogen, Inc. | Humanized antibody and process for preparing same |
| US7939641B2 (en) | 2002-04-09 | 2011-05-10 | The Scripps Research Institute | Motif-grafted hybrid polypeptides and uses thereof |
| EP1585768A2 (en) | 2003-01-23 | 2005-10-19 | Genentech, Inc. | Methods for producing humanized antibodies and improving yield of antibodies or antigen binding fragments in cell culture |
| ES2383300T3 (es) | 2003-11-13 | 2012-06-20 | Hanmi Holdings Co., Ltd | Fragmento Fc de IgG para un vehículo de fármacos y procedimiento para su preparación |
| AU2004297616B2 (en) * | 2003-12-04 | 2008-12-18 | Xencor, Inc. | Methods of generating variant proteins with increased host string content and compositions thereof |
| US7833979B2 (en) * | 2005-04-22 | 2010-11-16 | Amgen Inc. | Toxin peptide therapeutic agents |
| WO2009011572A1 (en) | 2007-07-13 | 2009-01-22 | Bac Ip B.V. | Single-domain antigen-binding proteins that bind mammalian igg |
| ES2453592T3 (es) | 2007-08-02 | 2014-04-08 | Novimmune Sa | Anticuerpos anti-RANTES y métodos de uso de los mismos |
| JP5780951B2 (ja) | 2008-04-24 | 2015-09-16 | ダイアックス コーポレーション | 新規のhccdr1、cdr2、およびcdr3設計、ならびに新規のlccdr1、cdr2、およびcdr3設計を含む、遺伝子パッケージのライブラリ |
| WO2010028791A1 (en) | 2008-09-10 | 2010-03-18 | Philochem Ag | Display library for antibody selection |
| US20100184684A1 (en) | 2009-01-06 | 2010-07-22 | C3 Jian, Inc. | Antibacterial and antifungal peptides |
| ES3000111T3 (en) | 2009-02-13 | 2025-02-27 | Immunomedics Inc | Intermediates for preparing conjugates with an intracellularly-cleavable linkage |
| EP2485761B1 (en) | 2009-10-09 | 2019-02-27 | Armagen, Inc. | Methods and compositions for increasing iduronate 2-sulfatase activity in the cns |
| AU2012267492A1 (en) | 2011-06-10 | 2014-01-09 | President And Fellows Of Harvard College | Modulation of pancreatic beta cell proliferation |
| CA2863224A1 (en) | 2012-01-09 | 2013-07-18 | The Scripps Research Institute | Ultralong complementarity determining regions and uses thereof |
| JP2015509091A (ja) | 2012-01-09 | 2015-03-26 | ザ スクリプス リサーチ インスティテュート | ヒト化抗体 |
| US20140200127A1 (en) | 2013-01-11 | 2014-07-17 | Sealed Air Corporation (Us) | System for Producing Packaging Cushioning |
| EP2943512A4 (en) | 2013-01-11 | 2016-06-01 | California Inst Biomedical Res | BOVINE FUSION ANTIBODY |
| WO2015006744A1 (en) | 2013-07-11 | 2015-01-15 | The California Institute For Biomedical Research | Immunoglobulin fusion proteins and compositions thereof |
| CA2918370A1 (en) | 2013-07-18 | 2015-01-22 | Fabrus, Inc. | Humanized antibodies with ultralong complementarity determining regions |
| WO2015017146A2 (en) | 2013-07-18 | 2015-02-05 | Fabrus, Inc. | Antibodies with ultralong complementarity determining regions |
-
2014
- 2014-07-18 CA CA2918370A patent/CA2918370A1/en active Pending
- 2014-07-18 US US14/905,765 patent/US10640574B2/en active Active
- 2014-07-18 JP JP2016527148A patent/JP6687520B2/ja active Active
- 2014-07-18 AU AU2014290361A patent/AU2014290361B2/en active Active
- 2014-07-18 WO PCT/US2014/047315 patent/WO2015010100A2/en not_active Ceased
- 2014-07-18 CN CN202010240256.5A patent/CN111518199A/zh active Pending
- 2014-07-18 EP EP14748405.9A patent/EP3022221B1/en active Active
- 2014-07-18 CN CN201480051514.8A patent/CN105814074B/zh active Active
-
2020
- 2020-03-26 US US16/831,508 patent/US11530493B2/en active Active
- 2020-04-02 JP JP2020066669A patent/JP2020114245A/ja active Pending
-
2022
- 2022-11-09 US US18/054,045 patent/US12606937B2/en active Active
-
2023
- 2023-01-10 JP JP2023001446A patent/JP7680480B2/ja active Active
Patent Citations (195)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3887699A (en) | 1969-03-24 | 1975-06-03 | Seymour Yolles | Biodegradable polymeric article for dispensing drugs |
| US3854480A (en) | 1969-04-01 | 1974-12-17 | Alza Corp | Drug-delivery system |
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| USRE30985E (en) | 1978-01-01 | 1982-06-29 | Serum-free cell culture media | |
| EP0003089A1 (fr) | 1978-01-06 | 1979-07-25 | Bernard David | Séchoir pour feuilles imprimées par sérigraphie |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| US4361650A (en) | 1978-03-24 | 1982-11-30 | Takeda Chemical Industries, Ltd. | Fermentation process of preparing demethyl maytansinoids |
| US4248870A (en) | 1978-10-27 | 1981-02-03 | Takeda Chemical Industries, Ltd. | Maytansinoids and use |
| US4260608A (en) | 1978-11-14 | 1981-04-07 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and methods of use thereof |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
| US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4317821A (en) | 1979-06-08 | 1982-03-02 | Takeda Chemical Industries, Ltd. | Maytansinoids, their use and pharmaceutical compositions thereof |
| US4308268A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4308269A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
| EP0033988A2 (en) | 1980-02-04 | 1981-08-19 | THE PROCTER & GAMBLE COMPANY | Method of making a pattern densified fibrous web having spaced, binder impregnated high density zones |
| US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| EP0052322A2 (de) | 1980-11-10 | 1982-05-26 | Gersonde, Klaus, Prof. Dr. | Verfahren zur Herstellung von Lipid-Vesikeln durch Ultraschallbehandlung, Anwendung des Verfahrens und Vorrichtung zur Durchführung des Verfahrens |
| CA1176565A (en) | 1980-11-18 | 1984-10-23 | John S. Kent | Microencapsulation of water soluble polypeptides |
| US4675189A (en) | 1980-11-18 | 1987-06-23 | Syntex (U.S.A.) Inc. | Microencapsulation of water soluble active polypeptides |
| US4419446A (en) | 1980-12-31 | 1983-12-06 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant DNA process utilizing a papilloma virus DNA as a vector |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
| US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
| JPS58118008A (ja) | 1982-01-06 | 1983-07-13 | Nec Corp | デ−タ処理装置 |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| DE3218121A1 (de) | 1982-05-14 | 1983-11-17 | Leskovar, Peter, Dr.-Ing., 8000 München | Arzneimittel zur tumorbehandlung |
| EP0102324A2 (de) | 1982-07-29 | 1984-03-07 | Ciba-Geigy Ag | Lipide und Tenside in wässriger Phase |
| US4601978A (en) | 1982-11-24 | 1986-07-22 | The Regents Of The University Of California | Mammalian metallothionein promoter system |
| US4452775A (en) | 1982-12-03 | 1984-06-05 | Syntex (U.S.A.) Inc. | Cholesterol matrix delivery system for sustained release of macromolecules |
| US4560655A (en) | 1982-12-16 | 1985-12-24 | Immunex Corporation | Serum-free cell culture medium and process for making same |
| US4657866A (en) | 1982-12-21 | 1987-04-14 | Sudhir Kumar | Serum-free, synthetic, completely chemically defined tissue culture media |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
| EP0142641A2 (de) | 1983-09-26 | 1985-05-29 | Udo Dr. Ehrenfeld | Mittel und Erzeugnis für die Diagnose und Therapie von Tumoren sowie zur Behandlung von Schwächen der zelligen und humoralen Immunabwehr |
| US4767704A (en) | 1983-10-07 | 1988-08-30 | Columbia University In The City Of New York | Protein-free culture medium |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| EP0158277A2 (de) | 1984-04-11 | 1985-10-16 | Hoechst Aktiengesellschaft | Implantierbare Zubereitungen von regulatorischen Peptiden mit gesteuerter Freisetzung und Verfahren zur ihrer Herstellung |
| US4965199A (en) | 1984-04-20 | 1990-10-23 | Genentech, Inc. | Preparation of functional human factor VIII in mammalian cells using methotrexate based selection |
| WO1987000195A1 (en) | 1985-06-28 | 1987-01-15 | Celltech Limited | Animal cell culture |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4970198A (en) | 1985-10-17 | 1990-11-13 | American Cyanamid Company | Antitumor antibiotics (LL-E33288 complex) |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US4927762A (en) | 1986-04-01 | 1990-05-22 | Cell Enterprises, Inc. | Cell culture medium with antioxidant |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5079233A (en) | 1987-01-30 | 1992-01-07 | American Cyanamid Company | N-acyl derivatives of the LL-E33288 antitumor antibiotics, composition and methods for using the same |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5770710A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group |
| US5606040A (en) | 1987-10-30 | 1997-02-25 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US4975278A (en) | 1988-02-26 | 1990-12-04 | Bristol-Myers Company | Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells |
| US5053394A (en) | 1988-09-21 | 1991-10-01 | American Cyanamid Company | Targeted forms of methyltrithio antitumor agents |
| WO1990003430A1 (en) | 1988-09-23 | 1990-04-05 | Cetus Corporation | Cell culture medium for enhanced cell growth, culture longevity and product expression |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5133974A (en) | 1989-05-05 | 1992-07-28 | Kv Pharmaceutical Company | Extended release pharmaceutical formulations |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5416064A (en) | 1989-10-25 | 1995-05-16 | Immunogen, Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| EP0425235A2 (en) | 1989-10-25 | 1991-05-02 | Immunogen Inc | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US6417429B1 (en) | 1989-10-27 | 2002-07-09 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1992000373A1 (en) | 1990-06-29 | 1992-01-09 | Biosource Genetics Corporation | Melanin production by transformed microorganisms |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5122469A (en) | 1990-10-03 | 1992-06-16 | Genentech, Inc. | Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins |
| US5508192A (en) | 1990-11-09 | 1996-04-16 | Board Of Regents, The University Of Texas System | Bacterial host strains for producing proteolytically sensitive polypeptides |
| US5264365A (en) | 1990-11-09 | 1993-11-23 | Board Of Regents, The University Of Texas System | Protease-deficient bacterial strains for production of proteolytically sensitive polypeptides |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| EP0517565A2 (en) | 1991-05-31 | 1992-12-09 | FIDIA S.p.A. | Process for the preparation of microspheres containing biologically active components |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5648237A (en) | 1991-09-19 | 1997-07-15 | Genentech, Inc. | Expression of functional antibody fragments |
| US5362852A (en) | 1991-09-27 | 1994-11-08 | Pfizer Inc. | Modified peptide derivatives conjugated at 2-hydroxyethylamine moieties |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5407686A (en) | 1991-11-27 | 1995-04-18 | Sidmak Laboratories, Inc. | Sustained release composition for oral administration of active ingredient |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| WO1993015722A1 (en) | 1992-02-07 | 1993-08-19 | Syntex (Usa) Inc. | Controlled delivery of pharmaceuticals from preformed porous microparticles |
| WO1993021232A1 (en) | 1992-04-10 | 1993-10-28 | Research Development Foundation | IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS |
| WO1994004690A1 (en) | 1992-08-17 | 1994-03-03 | Genentech, Inc. | Bispecific immunoadhesins |
| WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
| US5654010A (en) | 1992-12-02 | 1997-08-05 | Alkermes, Inc. | Composition for sustained release of human growth hormone |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| WO1994020069A1 (en) | 1993-03-08 | 1994-09-15 | Amgen Inc. | Pulmonary administration of granulocyte colony stimulating factor |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| US6372716B1 (en) | 1994-04-26 | 2002-04-16 | Genetics Institute, Inc. | Formulations for factor IX |
| US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| US5767285A (en) | 1994-06-03 | 1998-06-16 | American Cyanamid Company | Linkers useful for the synthesis of conjugates of methyltrithio antitumor agents |
| US5877296A (en) | 1994-06-03 | 1999-03-02 | American Cyanamid Company | Process for preparing conjugates of methyltrithio antitumor agents |
| WO1996007754A1 (en) | 1994-09-02 | 1996-03-14 | The Scripps Research Institute | Methods for producing antibody libraries using universal or randomized immunoglobulin light chains |
| WO1996007399A1 (en) | 1994-09-09 | 1996-03-14 | Takeda Chemical Industries, Ltd. | Sustained release preparation containing metal salt of a peptide |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| WO1996029998A1 (en) | 1995-03-28 | 1996-10-03 | Fidia Advanced Biopolymers S.R.L. | Nanospheres comprising a biocompatible polysaccharide |
| WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6998253B1 (en) | 1995-04-14 | 2006-02-14 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996040072A2 (en) | 1995-06-07 | 1996-12-19 | Alkermes Controlled Therapeutics, Inc. | Composition for sustained release of human growth hormone |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| WO1997003692A1 (en) | 1995-07-14 | 1997-02-06 | Novo Nordisk A/S | A stabilized pharmaceutical formulation comprising a growth hormone pre-treated with zinc and optionally lysine or calcium ions |
| US6685940B2 (en) | 1995-07-27 | 2004-02-03 | Genentech, Inc. | Protein formulation |
| US5736152A (en) | 1995-10-27 | 1998-04-07 | Atrix Laboratories, Inc. | Non-polymeric sustained release delivery system |
| WO1997017852A1 (de) | 1995-11-15 | 1997-05-22 | Hoechst Schering Agrevo Gmbh | Synergistische herbizide mischungen |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US6027888A (en) | 1996-04-05 | 2000-02-22 | Board Of Regents, The University Of Texas System | Methods for producing soluble, biologically-active disulfide-bond containing eukaryotic proteins in bacterial cells |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US6083715A (en) | 1997-06-09 | 2000-07-04 | Board Of Regents, The University Of Texas System | Methods for producing heterologous disulfide bond-containing polypeptides in bacterial cells |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US20040072290A1 (en) | 1998-04-20 | 2004-04-15 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US7517670B2 (en) | 1998-04-20 | 2009-04-14 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US7332581B2 (en) | 1999-01-15 | 2008-02-19 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7371826B2 (en) | 1999-01-15 | 2008-05-13 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7498289B2 (en) | 1999-02-22 | 2009-03-03 | Celanese International Corporation | Ni catalysts and methods for alkane dehydrogenation |
| US7214775B2 (en) | 1999-04-09 | 2007-05-08 | Kyowa Hakko Kogyo Co., Ltd. | Method of modulating the activity of functional immune molecules |
| US7682610B2 (en) | 1999-04-09 | 2010-03-23 | Kyowa Hakko Kirin Co., Ltd | Method of modulating the activity of functional immune molecules |
| WO2000061739A1 (fr) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle |
| US6566329B1 (en) | 1999-06-28 | 2003-05-20 | Novo Nordisk A/S | Freeze-dried preparation of human growth hormone |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| WO2001029246A1 (fr) | 1999-10-19 | 2001-04-26 | Kyowa Hakko Kogyo Co., Ltd. | Procede de production d'un polypeptide |
| US20020164328A1 (en) | 2000-10-06 | 2002-11-07 | Toyohide Shinkawa | Process for purifying antibody |
| US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
| US20030115614A1 (en) | 2000-10-06 | 2003-06-19 | Yutaka Kanda | Antibody composition-producing cell |
| US7064191B2 (en) | 2000-10-06 | 2006-06-20 | Kyowa Hakko Kogyo Co., Ltd. | Process for purifying antibody |
| US6740747B2 (en) | 2001-04-20 | 2004-05-25 | Azad Kaushik | Bovine VDJ cassette, BF1H1, suitable for antigenization |
| US7196185B2 (en) | 2001-04-20 | 2007-03-27 | Azad Kumar Kaushik | Bovine germline D-genes and their application |
| WO2002088172A2 (en) | 2001-04-30 | 2002-11-07 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| US6441163B1 (en) | 2001-05-31 | 2002-08-27 | Immunogen, Inc. | Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US20040132140A1 (en) | 2002-04-09 | 2004-07-08 | Kyowa Hakko Kogyo Co., Ltd. | Production process for antibody composition |
| US20040109865A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Antibody composition-containing medicament |
| US7749753B2 (en) | 2002-04-09 | 2010-07-06 | Kyowa Hakko Kirin Co., Ltd | Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost |
| WO2003085119A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa |
| WO2003084570A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM |
| US20040110282A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| WO2004009664A2 (en) | 2002-07-19 | 2004-01-29 | Omeros Corporation | Biodegradable triblock copolymers, synthesis methods therefor, and hydrogels and biomaterials made there from |
| EP1391213A1 (en) | 2002-08-21 | 2004-02-25 | Boehringer Ingelheim International GmbH | Compositions and methods for treating cancer using maytansinoid CD44 antibody immunoconjugates and chemotherapeutic agents |
| US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| WO2005035586A1 (ja) | 2003-10-08 | 2005-04-21 | Kyowa Hakko Kogyo Co., Ltd. | 融合蛋白質組成物 |
| WO2005035778A1 (ja) | 2003-10-09 | 2005-04-21 | Kyowa Hakko Kogyo Co., Ltd. | α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法 |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2005053742A1 (ja) | 2003-12-04 | 2005-06-16 | Kyowa Hakko Kogyo Co., Ltd. | 抗体組成物を含有する医薬 |
| WO2005087201A1 (en) | 2004-03-18 | 2005-09-22 | Octoplus Technologies B.V. | Hydrogel microspheres with improved release profile |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| WO2010054007A1 (en) | 2008-11-07 | 2010-05-14 | Fabrus Llc | Combinatorial antibody libraries and uses thereof |
| WO2011056997A1 (en) | 2009-11-04 | 2011-05-12 | Fabrus Llc | Methods for affinity maturation-based antibody optimization |
Non-Patent Citations (259)
| Title |
|---|
| "Applications Handbook and Catalog", 2003, pages: 467 - 498 |
| "Remington's Pharmaceutical Science", 1980 |
| "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY |
| ALMAGRO; FRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633 |
| ANGAL ET AL., MOL. IMMUNOL., vol. 30, 1993, pages 105 - 8 |
| ARIE ET AL., MOL. MICROBIOL., vol. 39, 2001, pages 199 - 210 |
| ARNDT ET AL., J MOL BIOL., vol. 7, no. 312, 2001, pages 221 - 228 |
| AUSUBEL ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1994 |
| BACA ET AL., BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684 |
| BAKER M; JONES TD.: "The identification and removal of immunogenicity in therapeutic proteins", CURR. OPIN. DRUG DISCOVERY DEV. 2007, vol. 10, no. 2, 2007, pages 219 - 227, XP009109828 |
| BALDWIN ET AL., LANCET, 15 March 1986 (1986-03-15), pages 603 - 05 |
| BARBAS ET AL., PROC NAT. ACAD. SCI. USA, vol. 91, 1994, pages 3809 - 3813 |
| BARBAS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 7978 - 7982 |
| BARBAS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4457 - 4461 |
| BARNES ET AL., ANAL. BIOCHEM., vol. 102, 1980, pages 255 |
| BASS ET AL., PROTEINS, vol. 8, 1990, pages 309 - 314 |
| BEAUCAGE; CARUTHERS, TETRAHEDRON LETTERS, vol. 22, 1981, pages 1859 - 1862 |
| BERENS ET AL., INT. IMMUNOL., vol. 9, 1997, pages 189 - 199 |
| BIOCHEM., vol. 11, 1972, pages 1726 |
| BOTHMANN; PLUCKTHUN, J. BIOL. CHEM., vol. 275, 2000, pages 17100 - 17105 |
| BRADLEY ET AL., NATURE, vol. 309, 1984, pages 255 - 258 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| BRINSTE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 4438 - 4442 |
| BRODEUR ET AL.: "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER, INC., pages: 51 - 63 |
| BRUGGEMANN ET AL., YEAR IN IMMUNO., vol. 7, 1993, pages 33 |
| BRUGGEMANN, M. ET AL., EXP. MED., vol. 166, 1987, pages 1351 - 1361 |
| CAPECCHI ET AL., TRENDS GENET., vol. 5, 1989, pages 70 - 76 |
| CAPECCHI ET AL.: "Current Communications in Molecular Biology", 1989, COLD SPRING HARBOR PRESS, pages: 45 - 52 |
| CAPECCHI, SCIENCE, vol. 244, 1989, pages 1288 - 1292 |
| CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34 |
| CARLSSON ET AL., BIOCHEM. J., vol. 173, 1978, pages 723 - 737 |
| CARTER ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 163 - 167 |
| CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CHARI ET AL., CANCER RESEARCH, vol. 52, 1992, pages 127 - 131 |
| CHARLTON: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 245 - 254 |
| CHATAL: "Monoclonal Antibodies in Immunoscintigraphy", 1989, CRC PRESS |
| CHEN ET AL., J BIO CHEM, vol. 274, 1999, pages 19601 - 19605 |
| CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 |
| CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CLELAND: "Vaccine Design: The Subunit and Adjuvant Approach", 1995, PLENUM PRESS, article "Design and Production of Single Immunization Vaccines Using Polylactide Polyglycolide Microsphere Systems", pages: 439 - 462 |
| CLYNES ET AL., PROC. NAT 'IACAD. SCI. USA, vol. 95, 1998, pages 652 - 656 |
| CLYNES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656 |
| CORTIVO ET AL., BIOMATERIALS, vol. 12, 1991, pages 727 - 730 |
| CRAGG, M. S. ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052 |
| CRAGG, M. S; M. J. GLENNIE, BLOOD, vol. 103, 2004, pages 27382743 |
| CREIGHTON, PROTEINS, 1984 |
| CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| DAERON, ANNU. REV. IMMUNOL., vol. 15, 1997, pages 203 - 234 |
| DAI ET AL., COLLOIDS SURF B BIOINTERFACES, vol. 41, 2005, pages 117 |
| DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 43 - 60 |
| DE HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41 |
| DORONINA ET AL., NATURE BIOTECHNOLOGY, vol. 21, no. 7, 2003, pages 778 - 784 |
| DORONINA, NAT BIOTECHNOL, vol. 21, no. 7, 2003, pages 778 - 784 |
| DRUGS OF THE FUTURE, vol. 25, no. 7, 2000, pages 686 |
| DUNCAN; WINTER, NATURE, vol. 322, 1988, pages 738 - 40 |
| E. SCHRODER; K. LUBKE: "The Peptides", vol. 1, 1965, ACADEMIC PRESS, pages: 76 - 136 |
| EDGAR, NUCLEIC ACIDS RESEARCH, vol. 32, 2004, pages 1792 - 1797 |
| EMBLETON ET AL., NUCL. ACIDS RES., vol. 20, 1992, pages 3831 - 3837 |
| EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 92 |
| EPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 3692 |
| EVANS, NATURE, vol. 292, 1981, pages 154 - 156 |
| FELLOUSE, PROC. NAT. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472 |
| FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472 |
| FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FRAKER ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 80, 1978, pages 49 - 57 |
| FROHMAN ET AL., CELL, vol. 56, 1989, pages 145 - 147 |
| GAZZANO-SANTORO ET AL., IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| GEMGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414 |
| GEOGHEGAN; STROH, BIOCONJUGATE CHEM., vol. 3, 1992, pages 138 - 146 |
| GODING: "Monoclonal Antibodies: Principles and Practice", 1986, ACADEMIC PRESS, pages: 59 - 103 |
| GOSSLER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 9065 - 9069 |
| GRAHAM ET AL., GEN VII'01., vol. 36, 1977, pages 59 |
| GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59 |
| GRAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 3576 - 3580 |
| GRIFFITHS ET AL., EMBO J., vol. 12, 1993, pages 725 - 734 |
| GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 |
| GUSS ET AL., EMBO J., vol. 5, 1986, pages 15671575 |
| GUYER ET AL., IMMUNOL., vol. 117, 1976, pages 587 |
| GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587 |
| HAM ET AL., METH. ENZ., vol. 58, 1979, pages 44 |
| HAMMER ET AL., J. ANIMAL. SCI., vol. 63, 1986, pages 269 |
| HAMMER ET AL., NATURE, vol. 315, 1985, pages 680 |
| HAMMERLING ET AL.: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER, pages: 563 - 681 |
| HARA ET AL., MICROBIAL DRUG RESISTANCE, vol. 2, 1996, pages 63 - 72 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS |
| HARRIS, BIOCHEM. SOC. TRANSACTIONS, vol. 23, 1995, pages 1035 - 1038 |
| HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896 |
| HELLSTROM, I ET AL., PROC. NAT 'IACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502 |
| HELLSTROM, I. ET AL., PROC. NAT'! ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063 |
| HINMAN ET AL., CANCER RES., vol. 53, 1993, pages 3336 - 3342 |
| HINMAN ET AL., CANCER RESEARCH, vol. 53, 1993, pages 3336 - 3342 |
| HOGREFE ET AL., GENE, vol. 128, 1993, pages 119 - 126 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOLLINGER, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM ET AL., NUCL. ACIDS RES., vol. 19, 1991, pages 4133 - 4137 |
| HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 178, 2001, HUMAN PRESS, pages: 1 - 37 |
| HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388 |
| HORA ET AL., BIO/TECHNOLOGY, vol. 8, 1990, pages 755 - 758 |
| HOSSEINI ET AL., INT. IMMUNOL., vol. 16, 2004, pages 843 - 852 |
| HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134 |
| HURLE; GROSS, CURR. OP. BIOTECH., vol. 5, 1994, pages 428 - 433 |
| HUST ET AL., BMC BIOTECHNOLOGY, vol. 7, 2007, pages 14 |
| HWANG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4030 - 4034 |
| IDUSOGIE ET AL., IMMUNOL., vol. 164, 2000, pages 41784184 |
| IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184 |
| ILLUM ET AL., J. CONTROLLED REL., vol. 29, 1994, pages 133 - 141 |
| J. BIOL. CHEM., vol. 243, 1969, pages 3552 - 3559 |
| JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 9 |
| JAENISCH, SCIENCE, vol. 240, 1988, pages 1468 - 1474 |
| JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258 |
| JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 |
| JANIS KUBY: "Immunology", 1998, W.H. FREEMAN AND COMPANY, pages: 115 - 118 |
| JOHNSON ET AL., NAT. MED., vol. 2, 1996, pages 795 - 799 |
| JONES ET AL., BIOTECHNOL., vol. 9, 1991, pages 88 - 89 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JONES TD; CROMPTON LJ; CARR FJ; BAKER MP., METHODS MOL BIOL., vol. 525, 2009, pages 405 - 23 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTE OF HEALTH |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION 91-3242, pages: 1 - 3 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", vol. 1-3, 1991, NIH PUBLICATION 91-3242 |
| KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242 |
| KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34 |
| KIM ET AL., IMMUNOL., vol. 24, 1994, pages 249 |
| KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249 |
| KINET, ANNU. REV. IMMUNOL, vol. 9, 1991, pages 457 - 92 |
| KIPRIYANOV: "Methods in Molecular Biology", vol. 207, 2003, article "Recombinant Antibodies for Cancer Therapy Methods and Protocols", pages: 3 - 25 |
| KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619 |
| KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260 |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001 |
| KRIEGLER: "Gene Transfer and Expression: A Laboratory Manual", 1990 |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132 |
| LEE ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093 |
| LEFRACE ET AL., NUCL. ACIDS, RES., vol. 37, 2009, pages D1006 - D1012 |
| LEFRANC ET AL., BRIEFINGS IN BIOINFORMATICS, vol. 9, 2008, pages 263 - 275 |
| LEFRANC, NUCLEIC ACIDS RES., vol. 31, 2003, pages 307 - 310 |
| LEUNG ET AL., TECHNIQUE, vol. 1, 1989, pages 11 - 15 |
| LEWIS: "Biodegradable Polymers as Drug Delivery Systems", 1990, MARCEL DEKKER, article "Controlled release of bioactive agents from lactide/glycolide polymer", pages: 1 - 41 |
| LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215 |
| LINDMARK ET AL., J. IMMUNOL. METH., vol. 62, 1983, pages 1 - 13 |
| LIU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 8618 - 8623 |
| LODE ET AL., CANCER RES., vol. 58, 1998, pages 2928 |
| LODE ET AL., CANCER RESEARCH, vol. 58, 1998, pages 2925 - 2928 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| MANDLER ET AL., BIOCONJUGATE CHEM., vol. 13, 2002, pages 786 - 791 |
| MANDLER ET AL., BIOORGANIC & MED. CHEM. LETTERS, vol. 10, 2000, pages 1025 - 1028 |
| MANDLER ET AL., JOUR. OF THE NAT. CANCER INST., vol. 92, no. 19, 2000, pages 1573 - 1581 |
| MANSOUR ET AL., NATURE, vol. 336, 1988, pages 348 - 352 |
| MAO ET AL., NAT BIOTECH, vol. 28, 2010, pages 1195 - 1202 |
| MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MARKS ET AL., BIOTECHNOL., vol. 10, 1992, pages 779 - 783 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1992, pages 581 - 597 |
| MARKS; BRADBURY: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 161 - 175 |
| MARSTON ET AL., METH. ENZ., vol. 182, 1990, pages 264 - 275 |
| MARTIN ET AL.: "Bioinformatics Tools for Antibody Engineering in Handbook of Therapeutic Antibodies", 2007, WILEY-VCH, pages: 104 - 107 |
| MATHER ET AL.: "Annals N.Y. Acad. Sci.", vol. 383, 1982, pages: 44 - 68 |
| MATHER ET AL.: "Annals NI'.Acad. Sci.", vol. 383, 1982, pages: 44 - 68 |
| MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251 |
| MATSUDA ET AL., NATURE, vol. 3, 1993, pages 88 - 94 |
| MCCAFFERTY ET AL., NATURE, vol. 348, pages 552 - 554 |
| MILSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 - 82 |
| MOREL ET AL., MOLEC. IMMUNOL., vol. 25, no. 1, 1988, pages 7 - 15 |
| MORIMOTO ET AL., JOURNAL OF BIOCHEMICAL AND BIOPHYSICAL METHODS, vol. 24, 1992, pages 107 - 117 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
| MORRISON, NATURE, vol. 368, 1994, pages 812 - 813 |
| MOSBACH ET AL., NATURE, vol. 302, 1983, pages 543 - 545 |
| MUNSON ET AL., ANAL. BIOCHEM., vol. 107, 1980, pages 220 |
| NEUBERGER, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826 |
| NICULESCU-DUVAZ; SPRINGER, ADV. DRG DEL. REV., vol. 26, 1997, pages 151 - 172 |
| NJONGMETA ET AL., VACCINE, vol. 30, 2012, pages 1624 - 1635 |
| OKAZAKI ET AL., J. MOL. BIOL., vol. 336, 2004, pages 1239 - 1249 |
| ORLANDI ET AL., PROC. NATL. ACAD. SCI. (USA, vol. 86, 1989, pages 3833 - 3837 |
| ORUM ET AL., NUCLEIC ACIDS RES., vol. 21, 1993, pages 4491 - 4498 |
| OSBOURN ET AL., METHODS, vol. 36, 2005, pages 61 - 68 |
| PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498 |
| PALVA ET AL., GENE, vol. 22, 1983, pages 229 - 235 |
| PEARSON; REANIER, J. CHROM., vol. 255, 1983, pages 137 - 149 |
| PETKOVA, S. B. ET AL., INT 'I IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769 |
| PETTIT ET AL., ANTI-CANCER DRUG DESIGN, vol. 13, 1998, pages 243 - 277 |
| PETTIT ET AL., ANTIMICROB. AGENTS CHEMOTHER, vol. 42, 1998, pages 2961 - 2965 |
| PETTIT ET AL., J. AM. CHEM. SOC., vol. 111, 1989, pages 5463 - 5465 |
| PETTIT ET AL., J. CHEM. SOC. PERKIN TRANS., vol. 1, no. 5, 1996, pages 859 - 863 |
| PETTIT, G. R. ET AL., SYNTHESIS, 1996, pages 719 - 725 |
| PLUCKTHUN, IMMUNOL. REVS, vol. 130, 1992, pages 151 |
| PLUCKTHUN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315 |
| PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 |
| PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596 |
| PROBA; PLUCKTHUN, GENE, vol. 159, 1995, pages 203 |
| QUEEN ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033 |
| R. LANGER ET AL., CHEM. TECH., vol. 12, 1982, pages 98 |
| RAMM; PLUCKTHUN, J. BIOL. CHEM., vol. 275, 2000, pages 17106 - 17113 |
| RAVETCH; KINET, ANNU. REV. IMMUNOL, vol. 9, 1991, pages 457 - 92 |
| RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545 |
| ROBERTSON ET AL., NATURE, vol. 322, 1986, pages 445 - 448 |
| ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618 |
| ROWLAND ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 21, 1986, pages 183 - 87 |
| SAINI ET AL., EUR.J.LMMUNOL., vol. 29, 1999, pages 2420 - 2426 |
| SAINI; KAUSHIK, SCAND. J. IMMUNOL., vol. 55, 2002, pages 140 - 148 |
| SAMBROOK; RUSSELL: "Molecular Cloning: A Laboratory Manual", 2001 |
| SASTRY ET AL., PROC. NATL. ACAD. SCI. (USA, vol. 86, 1989, pages 5728 - 5732 |
| SAWHNEY ET AL., MACROMOLECULES, vol. 26, 1993, pages 581 - 587 |
| SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155 |
| SHALABY ET AL., J. EXP. MED., vol. 175, 1992, pages 217 - 225 |
| SHIELDS ET AL., BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604 |
| SIDHU ET AL., J. MOL. BIOL., vol. 338, no. 2, 2004, pages 299 - 310 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556 |
| SIEBENLIST ET AL., CELL, vol. 20, 1980, pages 269 |
| SIEDEL, G. E., JR.: "Fertilization and Embryonic Development in Vitro", 1981, PLENUM PRESS, article "Critical review of embryo transfer procedures with cattle", pages: 323 |
| SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296 |
| SINHA ET AL., J. CONTROL. RELEASE, vol. 90, 2003, pages 261 |
| SKERRA ET AL., CURR. OPINION IN IMMUNOL., vol. 5, 1993, pages 256 |
| STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 - 253 |
| STUDNICKA ET AL., PROTEIN ENG., vol. 7, no. 6, 1994, pages 805 - 814 |
| SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210 |
| SYRIGOS; EPENETOS, ANTICANCER RESEARCH, vol. 19, 1999, pages 605 - 614 |
| THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506 |
| TIJSSEN: "Overview of principles of hybridization and the strategy of nucleic acid assays", TECHNIQUES IN BIOCHEMISTRY AND MOLECULAR BIOLOGY--HYBRIDIZATION WITH NUCLEIC PROBES, 1993 |
| TOMLINSON ET AL., J. MOL. BIOL., vol. 227, 1992, pages 776 - 798 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
| URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 |
| VAN DEVANTER ET AL., NUCLEIC ACIDS RES., vol. 12, 1984, pages 6159 - 6168 |
| VASWANI; HAMILTON, ANN. ALLERGY, ASTHMA & IMMUNOL., vol. 1, 1998, pages 105 - 115 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098 |
| WAGNER ET AL., THERIOGENOLOGY, vol. 21, 1984, pages 29 |
| WALLACE ET AL., GENE, vol. 16, 1981, pages 21 - 26 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WATERHOUSE ET AL., NUCL. ACIDS RES., vol. 21, 1993, pages 2265 - 2266 |
| WILLIAMS; WINTER, EUR. J. IMMUNOL., vol. 23, 1993, pages 1456 - 1461 |
| WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455 |
| WINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388 |
| WISEMAN ET AL., BLOOD, vol. 99, no. 12, 2002, pages 4336 - 42 |
| WISEMAN ET AL., EUR. JOUR. NUCL. MED., vol. 27, no. 7, 2000, pages 766 - 77 |
| WITZIG ET AL., J. CLIN. ONCOL., vol. 20, no. 10, 2002, pages 2453 - 63 |
| WITZIG ET AL., J. CLIN. ONCOL., vol. 20, no. 15, 2002, pages 3262 - 69 |
| WOYKE ET AL., ANTIMICROB. AGENTS AND CHEMOTHER., vol. 45, no. 12, 2001, pages 3580 - 3584 |
| YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614 |
| YANIV, NATURE, vol. 297, 1982, pages 17 - 18 |
| YASUDA, BIOMED. THER., vol. 27, 1993, pages 1221 - 1223 |
| YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268 |
| YELTON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004 |
| ZHU ET AL., NAT. BIOTECHNOL., vol. 18, 2000, pages 24 |
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10562980B2 (en) | 2012-01-09 | 2020-02-18 | The Scripps Research Institute | Humanized antibodies |
| US10640574B2 (en) | 2013-07-18 | 2020-05-05 | Taurus Biosciences, Llc | Humanized antibodies with ultralong complementary determining regions |
| US12606937B2 (en) | 2013-07-18 | 2026-04-21 | Taurus Biosciences, Llc | Humanized antibodies with ultralong complementary determining regions |
| US11530493B2 (en) | 2013-07-18 | 2022-12-20 | Taurus Biosciences, Llc | Humanized antibodies with ultralong complementary determining regions |
| US10144768B2 (en) | 2015-12-04 | 2018-12-04 | Novartis Ag | Antibody cytokine engrafted compositions and methods of use for immunoregulation |
| US11136366B2 (en) | 2015-12-04 | 2021-10-05 | Novartis Ag | Methods of treating immune related disorders using antibody-cytokine engrafted compositions |
| US12006354B2 (en) | 2017-05-24 | 2024-06-11 | Novartis Ag | Antibody-IL2 engrafted proteins and methods of use in the treatment of cancer |
| US11930837B2 (en) | 2017-05-24 | 2024-03-19 | Novartis Ag | Antibody-cytokine engrafted proteins and methods of use for immune related disorders |
| US11932673B2 (en) | 2017-07-12 | 2024-03-19 | Maxion Therapeutics Limited | Sodium channel inhibitors |
| WO2019140150A1 (en) | 2018-01-12 | 2019-07-18 | Bristol-Myers Squibb Company | Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer |
| US20210230253A1 (en) * | 2018-06-13 | 2021-07-29 | Crystal Bioscience Inc. | Transgenic chicken that makes antibodies with long cdr-h3s stabilized by multiple disulfide bridges and diversified by gene conversion |
| AU2019284256B2 (en) * | 2018-06-13 | 2025-08-28 | Crystal Bioscience Inc. | Transgenic chicken that makes antibodies with long CDR-H3S stabilized by multiple disulfide bridges and diversified by gene conversion |
| US12428471B2 (en) | 2018-06-13 | 2025-09-30 | Crystal Bioscience Inc. | Transgenic chicken that makes antibodies with long CDR-H3S stabilized by multiple disulfide bridges and diversified by gene conversion |
| EP3813520A4 (en) * | 2018-06-13 | 2022-03-23 | Crystal Bioscience Inc. | TRANSGENIC CHICKEN PRODUCING ANTIBODIES WITH LONG CDR-H3S STABILIZED BY MULTIPLE DISULPHIDE BRIDGES AND DIVERSIFIED BY GENE CONVERSION |
| WO2019241002A1 (en) | 2018-06-13 | 2019-12-19 | Crystal Bioscience Inc. | Transgenic chicken that makes antibodies with long cdr-h3s stabilized by multiple disulfide bridges and diversified by gene conversion |
| WO2021081440A3 (en) * | 2019-10-24 | 2021-05-27 | Minotaur Therapeutics, Inc. | Chimeric cytokine modified antibodies and methods of use thereof |
| WO2021191424A1 (en) * | 2020-03-27 | 2021-09-30 | UCB Biopharma SRL | Autonomous knob domain peptides |
| WO2022232321A1 (en) * | 2021-04-28 | 2022-11-03 | Minotaur Therapeutics, Inc. | Humanized chimeric bovine antibodies and methods of use |
| WO2022241057A1 (en) * | 2021-05-12 | 2022-11-17 | Applied Biomedical Science Institute | Binding polypeptides against sars cov-2 and uses thereof |
| WO2022241058A1 (en) * | 2021-05-12 | 2022-11-17 | Applied Biomedical Science Institute | Methods of screening and expression of disulfide-bonded binding polypeptides |
| WO2023192478A1 (en) | 2022-04-01 | 2023-10-05 | Bristol-Myers Squibb Company | Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2014290361B2 (en) | 2019-04-18 |
| JP6687520B2 (ja) | 2020-04-22 |
| EP3022221A2 (en) | 2016-05-25 |
| JP2023036970A (ja) | 2023-03-14 |
| US20200239599A1 (en) | 2020-07-30 |
| JP2020114245A (ja) | 2020-07-30 |
| CN105814074A (zh) | 2016-07-27 |
| US11530493B2 (en) | 2022-12-20 |
| AU2014290361A1 (en) | 2016-02-11 |
| CN105814074B (zh) | 2020-04-21 |
| CA2918370A1 (en) | 2015-01-22 |
| US20160159928A1 (en) | 2016-06-09 |
| US20230287598A1 (en) | 2023-09-14 |
| JP7680480B2 (ja) | 2025-05-20 |
| US12606937B2 (en) | 2026-04-21 |
| EP3022221B1 (en) | 2021-09-15 |
| JP2016527234A (ja) | 2016-09-08 |
| WO2015010100A3 (en) | 2015-06-25 |
| CN111518199A (zh) | 2020-08-11 |
| US10640574B2 (en) | 2020-05-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12606937B2 (en) | Humanized antibodies with ultralong complementary determining regions | |
| US11390665B2 (en) | Ultralong complementarity determining regions and uses thereof | |
| US10562980B2 (en) | Humanized antibodies | |
| US20160168231A1 (en) | Antibodies with ultralong complementarity determining regions |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14748405 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2918370 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2016527148 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14905765 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014748405 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2014290361 Country of ref document: AU Date of ref document: 20140718 Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14748405 Country of ref document: EP Kind code of ref document: A2 |