WO2014140904A2 - Antibodies to mica and micb proteins - Google Patents

Antibodies to mica and micb proteins Download PDF

Info

Publication number
WO2014140904A2
WO2014140904A2 PCT/IB2014/001157 IB2014001157W WO2014140904A2 WO 2014140904 A2 WO2014140904 A2 WO 2014140904A2 IB 2014001157 W IB2014001157 W IB 2014001157W WO 2014140904 A2 WO2014140904 A2 WO 2014140904A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
antibody
mica
micb
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2014/001157
Other languages
English (en)
French (fr)
Other versions
WO2014140904A3 (en
Inventor
Ian Wayne Cheney
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novelogics Biotechnology Inc
Original Assignee
Novelogics Biotechnology Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novelogics Biotechnology Inc filed Critical Novelogics Biotechnology Inc
Priority to AU2014229476A priority Critical patent/AU2014229476B2/en
Priority to US14/776,640 priority patent/US10851148B2/en
Priority to JP2015562400A priority patent/JP6518199B6/ja
Priority to EP14762844.0A priority patent/EP2970490A4/en
Priority to CA2906356A priority patent/CA2906356A1/en
Publication of WO2014140904A2 publication Critical patent/WO2014140904A2/en
Publication of WO2014140904A3 publication Critical patent/WO2014140904A3/en
Anticipated expiration legal-status Critical
Priority to US16/928,977 priority patent/US20210040173A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70539MHC-molecules, e.g. HLA-molecules
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present disclosure relates to antibodies, immunogens for generating the antibodies, and methods of using the antibodies for diagnostics and treatments.
  • Oncology immunotherapy is designed to stimulate the body's immune system to fight tumors.
  • Local immunotherapy injects a treatment into an affected area, thereby causing recruitment of immune cells, robust inflammation and consequently tumor shrinkage.
  • Systemic immunotherapy treats the whole body by administering an agent, such as protein interferon alpha, that is also capable of shrinking tumors.
  • Immunotherapy can also be considered non-specific if it improves overall cancer- fighting abilities by stimulating the entire immune system, and it can be considered targeted if the treatment directs the immune system to destroy cancer cells.
  • These therapies although relatively immature, have had success with treatments that introduce antibodies to the human body and which have resulted in the inhibition of cancer cell growth.
  • An example of modern antibody immunotherapy drug is ipilimumab (Yervoy ® ), which targets CTLA4 surface proteins on immune cells, thereby interfering with specific regulatory brakes on the immune system and improving generalized immune attack towards tumor cells.
  • compositions and methods for lowering the levels of circulating soluble MICA (sMICA) and/or soluble MICB (sMICB) proteins which can have therapeutically beneficial effects by limiting the immunosuppressive effects of the sMIC proteins on
  • the composition herein relates to binding agents, particularly antibodies, that are capable of binding specifically to sMICA and/or sMICB but which do not bind specifically to full length MIC protein or forms of MIC protein bound to the cell membrane.
  • the antibodies bind specifically to immunologically hidden or cryptic regions, referred to as cryptic epitopes, of MICA and/or MICB protein, where the cryptic epitopes are revealed when these sMICA and/or sMICB ectodomains are released or shed from cell membranes.
  • the binding agents can have insignificant autoimmune disease inducing activity. In some embodiments, the binding agents can have insignificant antagonistic activity towards binding of MICA and/or MICB to its cognate receptor NKG2D.
  • the binding agents are capable of binding specifically to the alpha-3 domain of MICA and/or MICB protein but which do not bind specifically to full length MIC protein or forms of MIC protein bound to the cell membrane. In some embodiments, the binding agents are capable of binding specifically to a cryptic epitope on the alpha-3 domain of MICA and/or MICB protein, where the cryptic epitope to which the antibody binds is within the alpha-3 domain defined by
  • the binding agents are capable of binding specifically to a cryptic epitope on the alpha-3 domain of MICA, where the cryptic epitope is within an amino acid sequence selected from:
  • amino acid positions are defined with respect to the mature, processed MICA protein of the MICA*001 allele.
  • the binding agents are capable of binding specifically to a cryptic epitope on the alpha-3 domain of MICB, where the cryptic epitope is within an amino acid sequence selected from:
  • amino acid positions are defined with respect to the mature, processed MICB protein of the MICB*001 allele.
  • the binding agents are capable of binding specifically to an epitope within a sequence defined by:
  • X A1 is selected from R and C;
  • X A3 is selected from E and K; and
  • X A4 is selected from A and V;
  • X B5 is selected from V and L;
  • the binding agents comprise antibodies, where the antibodies can be polyclonal, monoclonal, chimeric, humanized, or fully human antibodies. In some embodiments, the binding agents can comprise fragments of the antibodies or single chain antibodies. In some
  • the antibodies can be bispecific or multispecific antibodies.
  • the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the complementarity determining regions (CDRs) in the light chain variable region amino acid sequence of SEQ ID NO:23 and the heavy chain variable region amino acid sequence of SEQ ID NO:27.
  • CDRs complementarity determining regions
  • the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence RASKSVSTSGYSYMH (SEQ ID NO:83); CDR L2 comprising an amino acid sequence RASNLES (SEQ ID NO:84); CDR L3 comprising an amino acid sequence QHSRELPLT (SEQ ID NO:85); CDR HI comprising an amino acid sequence DYSVH (SEQ ID NO:89), GYTFTDY (SEQ ID NO:95), or GYTFTDYSVH (SEQ ID NO:99); CDR H2 comprising an amino acid sequence
  • WINTETGEPTYADDFKG SEQ ID NO:90
  • NTETG SEQ ID NO:96
  • WINTETGEP SEQ ID NO: 100
  • CDR H3 comprising an amino acid sequence AGGNAFAY
  • the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs in the light chain variable region amino acid sequence of SEQ ID NO:31 and the heavy chain variable region amino acid sequence of SEQ ID NO:35. In some embodiments, the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence
  • RS SKSLLQ SNGNTFLY (SEQ ID NO:86); CDR L2 comprising an amino acid sequence RMSNLAS (SEQ ID NO:87); CDR L3 comprising an amino acid sequence MQHLEYPFT (SEQ ID NO:88); CDR HI comprising an amino acid sequence NYGMN (SEQ ID NO:92), GYTFTNY (SEQ ID NO:97), or GYTFTNYGMN (SEQ ID NO: 101); CDR H2 comprising an amino acid sequence
  • WINTNTGEPTYAEEFKG (SEQ ID NO:93), NTNTG (SEQ ID NO:98), or WINTNTGEP (SEQ ID NO: 102); and CDR H3 comprising an amino acid sequence SGGSSPFAY (SEQ ID NO:94).
  • the antibody comprises a light chain variable region VL comprising an amino acid sequence of SEQ ID NO:23 and a heavy chain variable region VH comprising an amino acid sequence of SEQ ID NO:27.
  • the antibody comprises a light chain variable region VL comprising an amino acid sequence of SEQ ID NO:31 and a heavy chain variable region VH comprising an amino acid sequence of SEQ ID NO:35.
  • the present disclosure provides immunogens for preparing the antibodies that bind specifically to sMICA and/or sMICB, particularly to cryptic epitopes in the alpha-3 domain.
  • the immunogens can be coupled to carriers and prepared as compositions with appropriate adjuvants for preparing the binding agents of the disclosure.
  • the present disclosure provides methods of screening for antibodies that bind specifically to a cryptic epitope in the alpha-3 domain, as well as methods of preparing the antibodies.
  • the binding agents of the disclosure can be applied to various diagnostic and therapeutic uses.
  • the binding agents such as the antibodies of the disclosure, can be used in diagnostic assays to determine the presence of sMICA and/or sMICB in biological samples, particularly samples obtained from subjects suspected of or diagnosed with a disease or disorder characterized by elevated levels of sMICA and/or sMICB.
  • the binding agents can be used for therapeutic applications.
  • the antibodies can be used in a method to reduce the levels of sMICA and/or sMICB by administering to a subject in need thereof an effective amount of the antibody agents of the disclosure.
  • the antibody agents can be used to treat a subject afflicted with a disease or disorder characterized by elevated levels of a sMIC protein.
  • the binding agents disclosed herein can be administered in a therapeutically effective amount to a subject suffering from a disease or disorder characterized by elevated levels of sMICA and/or sMICB.
  • the therapeutic methods can be used to treat a variety of disorders that are associated with elevated levels of sMICA and/or sMICB, such as a MIC + tumor or a MIC + viral infection.
  • the MIC + tumor comprises an epithelial cell tumor or a hematologic malignancy.
  • the tumors can comprise various types of epithelial tumors including, but not limited to, lung, breast, gastric, colon, ovarian, renal cell, prostate carcinomas, hepatocellular carcinomas, and melanoma.
  • the MIC + hematologic malignancy can be selected from Acute Lymphoblastic Leukemia (ALL), Acute Myelogenous Leukemia (AML), Chronic Lymphocytic
  • CLL Chronic Myelogenous Leukemia
  • Acute Monocytic Leukemia Acute Monocytic Leukemia
  • lymphomas such as Hodgkin's lymphoma, and Non-Hodgkin's lymphoma; and Multiple Myelomas.
  • the therapeutic antibodies can also be applied to certain viral infections, such as Respiratory Syncytial Virus (RSV) and Human Immunodeficiency Virus 1 (HIV-1) infections.
  • RSV Respiratory Syncytial Virus
  • HAV-1 Human Immunodeficiency Virus 1
  • the therapeutic application can be used in combination with other therapeutic agents used to treat the particular disorder associated with elevated sMIC + levels, including combinations with chemotherapeutic agents; biologic agents, such as other therapeutic antibodies; and cancer vaccines, as further described in the detailed description that follow.
  • FIG. 1A and FIG. IB depict an exemplary amino acid sequence corresponding to a complete human MICA polypeptide (Allele *001 : NCBI accession number NP 000238.1) (SEQ ID NO: l), and an exemplary amino acid sequence corresponding to a complete human MICB polypeptide (Allele *001 : UniProtKB accession number Q29980.1) (SEQ ID NO:2), respectively.
  • FIG. 1C and FIG. ID depict the amino acid sequence of the extracellular alpha-3 domain of MICA protein of the MICA*001 allele, amino acid residues 205-297 (SEQ ID NO:3); and the amino acid sequence of the extracellular alpha-3 domain of MICB protein of the MICB*001 allele, amino acid residues 205-297 (SEQ ID NO:4), respectively.
  • Amino acid numbering is based on the unprocessed MICA and MICB proteins. Amino acid numbering based on the processed, mature MICA*001 and MICB*001 corresponds to amino acid residues 182 to 274 for MICA and amino acid residues 182 to 274 for MICB.
  • FIG. 2 depicts an exemplary nucleotide sequence corresponding to the human MICA cDNA (Allele *001 : NCBI accession no. NM 000247.2) (SEQ ID NO:5). The coding region is underlined.
  • FIG. 3 depicts an exemplary nucleotide sequence corresponding to human MICB cDNA (Allele *001 : GenBank accession no. X91625.1) (SEQ ID NO:6). The coding region is underlined.
  • FIG. 4 depicts exemplary amino acid sequences of putative soluble MICA polypeptides (A - SEQ ID NO:7; B - SEQ ID NO:8; C - SEQ ID NO:9; D - SEQ ID NO: 10; E - SEQ ID NO: 1 1 ; F - SEQ ID NO: 12; G - SEQ ID NO: 13; H - SEQ ID NO: 14).
  • FIG. 5 depicts exemplary amino acid sequences of putative soluble MICB polypeptides (A - SEQ ID NO: 15; B - SEQ ID NO: 16; C - SEQ ID NO: 17; D - SEQ ID NO: 18; E - SEQ ID NO: 19; F - SEQ ID NO:20; G - SEQ ID NO:21).
  • FIG. 6 depicts the amino acid and nucleotide sequences of the light chain variable region and heavy chain variable region of antibody IF5.
  • a - Amino acid sequence of the light chain variable region of antibody IF5 including the signal sequence (italics), variable region (bold, underlined) and part of the constant region (unmarked) (SEQ ID NO:22).
  • C Nucleotide sequence encoding the signal sequence and light chain variable region depicted in A above (SEQ ID NO:24).
  • D Nucleotide sequence encoding only the light chain variable region of antibody IF5 (SEQ ID NO:25).
  • E Amino acid sequence of the heavy chain variable region of antibody IF5, including the signal sequence (italics), variable region (bold, underlined) and part of the constant region (unmarked) (SEQ ID NO:26).
  • F Amino acid sequence of the heavy chain variable region only, with CDRs delineated based on Kabat indicated (SEQ ID NO:27).
  • G Nucleotide sequence encoding the signal sequence and light chain variable region depicted in E above (SEQ ID NO:28).
  • H Nucleotide sequence encoding only the heavy chain variable region of antibody IF5 (SEQ ID NO:29).
  • FIG. 7 depicts the amino acid and nucleotide sequences of the light chain variable region and heavy chain variable region of antibody 8C7.
  • a - Amino acid sequence of the light chain variable region of antibody 8C7 including the signal sequence (italics), variable region (bold, underlined) and part of the constant region (unmarked) (SEQ ID NO:30).
  • C Nucleotide sequence encoding the signal sequence and the light chain variable region depicted in A above (SEQ ID NO:32).
  • FIG. 8 depicts the amino acid sequences of human variable heavy chain consensus frameworks and human variable light chain consensus frameworks: human VH subgroup I consensus framework minus Kabat CDRs (SEQ ID NO: 103); human VH subgroup II consensus framework minus Kabat CDRs (SEQ ID NO: 104); human VH subgroup III consensus framework minus Kabat CDRs (SEQ ID NO: 105); human VH subgroup VII consensus framework minus Kabat CDRs (SEQ ID NO: 106); human VL subgroup I consensus framework minus Kabat CDRs (SEQ ID NO: 107); human VL subgroup II consensus framework minus Kabat CDRs (SEQ ID NO: 108); human VL subgroup III consensus framework minus Kabat CDRs (SEQ ID NO: 109); and human VL subgroup IV consensus framework minus Kabat CDRs (SEQ ID NO: 1 10).
  • FIG. 9 shows results of FACS analysis of antibody binding to heat-treated HCTl 16 colon carcinoma cells, which express MIC proteins on the cell surface.
  • A Positive control using antibody (IgG 2 isotype) that binds to an alpha-3 subdomain.
  • B Positive control using antibody that binds to alpha- 1 + alpha-2 subdomains (IgGi isotype).
  • C Binding of antibody clone 1F5.
  • D Binding of antibody clone 8C7.
  • a and B show that control antibodies which bind to alpha-3 or alpha 1+2 subdomains also bind to heat-treated HCTl 16 colon carcinoma cells (peak near 10 2 Yellow Fluorescence axis).
  • C shows that 1F5 does not bind heat-treated HCTl 16 colon carcinoma cells (unbound antibody peak near 10 1 Yellow Fluorescence axis).
  • D shows that antibody 8C7 does not bind heat- treated HCTl 16 colon carcinoma cells (unbound antibody peak near 10 1 Yellow Fluorescence axis).
  • the present disclosure provides binding agents, particularly antibodies, that specifically recognize soluble forms of MHC class I chain-related gene A protein (MICA) and/or MHC class I chain- related gene B protein (MICB), use of such binding agents to treat diseases characterized by presence of elevated levels of soluble MICA (sMICA) and/or soluble MICB (sMICB), and use as diagnostic reagents for detecting the presence of soluble MIC proteins.
  • MICA MHC class I chain-related gene A protein
  • MICB MHC class I chain-related gene B protein
  • the amino acid may be in either the L- or D- configuration about a-carbon (C a ).
  • C a a-carbon
  • “Ala” designates alanine without specifying the configuration about the a-carbon
  • "D-Ala” and "L-Ala” designate D-alanine and L-alanine, respectively.
  • upper case letters designate amino acids in the L-configuration about the ⁇ -carbon
  • lower case letters designate amino acids in the D-configuration about the a-carbon.
  • A designates L-alanine and "a” designates D-alanine.
  • polypeptide and peptide sequences are presented as a string of one-letter or three-letter abbreviations (or mixtures thereof), the sequences are presented in the N— >C direction in accordance with common convention.
  • nucleosides are conventional and are as follows: adenosine (A); guanosine (G); cytidine (C); thymidine (T); and uridine (U).
  • A adenosine
  • G guanosine
  • C cytidine
  • T thymidine
  • U uridine
  • nucleosides may be either ribonucleosides or 2'-deoxyribonucleosides.
  • the nucleosides may be specified as being either ribonucleosides or 2'-deoxyribonucleosides on an individual basis or on an aggregate basis.
  • the one-letter abbreviation is preceded by either a “d” or an "r,” where "d” indicates the nucleoside is a 2'-deoxyribonucleoside and “r” indicates the nucleoside is a ribonucleoside.
  • “dA” designates 2'-deoxyriboadenosine
  • “rA” designates riboadenosine.
  • the particular nucleic acid or polynucleotide is identified as being either an RNA molecule or a DNA molecule.
  • Nucleotides are abbreviated by adding a "p” to represent each phosphate, as well as whether the phosphates are attached to the 3 '-position or the 5 '-position of the sugar.
  • 5 '-nucleotides are abbreviated as “pN”
  • 3'- nucleotides are abbreviated as "Np,” where "N” represents A, G, C, T or U.
  • antibody is used in the broadest sense and refers to an
  • immunoglobulin or fragment thereof encompasses any such polypeptide comprising an antigen- binding fragment or region of an antibody.
  • the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as myriad immunoglobulin variable region genes.
  • Light chains are classified as either kappa or lambda.
  • Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
  • Immunoglobulin classes may also be further classified into subclasses, including IgG subclasses IgGi, IgG 2 , IgG 3 , and IgG 4 ; and IgA subclasses IgA ! and IgA 2 .
  • the term includes, but is not limited to, polyclonal, monoclonal, monospecific, multispecific (e.g., bispecific antibodies), natural, humanized, human, chimeric, synthetic, recombinant, hybrid, mutated, grafted, antibody fragments (e.g., a portion of a full-length antibody, generally the antigen binding or variable region thereof, e.g., Fab, Fab', F(ab')2, and Fv fragments), and in vitro generated antibodies so long as they exhibit the desired biological activity.
  • the term also includes single chain antibodies, e.g., single chain Fv (sFv or scFv) antibodies, in which a variable heavy and a variable light chain are joined together (directly or through a peptide linker) to form a continuous polypeptide.
  • sFv or scFv single chain Fv antibodies
  • isolated refers to a change from a natural state, that is, changed and/or removed from its original environment.
  • a polynucleotide or polypeptide e.g., antibody
  • an “isolated antibody” is one which has been separated and/or recovered from a component of its natural
  • purified antibody refers to an antibody preparation in which the antibody is at least 80% or greater, at least 85% or greater, at least 90% or greater, at least 95% or greater by weight as compared to other contaminants (e.g., other proteins) in the preparation, such as by determination using SDS-PAGE under reducing or nonreducing conditions.
  • extracellular domain and "ectodomain” are used interchangeably when used in reference to a membrane bound protein and refer to the portion of the protein that is exposed on the extracellular side of a lipid bilayer of a cell.
  • the extracellular domain of MICA is from amino acid residue at about 24 to about 299 of an unprocessed full length MICA protein, where the amino acid numbering is based on the MICA protein of the MICA*001 allele.
  • the extracellular domain of MICB is from amino acid residue at about 24 to about 299 of an unprocessed full length MICB protein, where the amino acid numbering is based on the MICB protein of the MICB*001 allele.
  • polypeptide region defining the extracellular domain of MICA and MICB is approximate and, in some embodiments, may extend to about amino acid residue 307.
  • An exemplary unprocessed full length MICA protein of the MICA*001 allele is presented in FIG. 1A (SEQ ID NO: 1)
  • an exemplary unprocessed full length MICB protein of the MICB*001 allele is presented in FIG. IB (SEQ ID NO:2).
  • the term "binds specifically" in the context of any binding agent refers to a binding agent that binds specifically to an antigen or epitope, such as with a high affinity, and does not significantly bind other unrelated antigens or epitopes.
  • the term “functional” refers to a form of a molecule which possesses either the native biological activity of the naturally existing molecule of its type, or any specific desired activity, for example as judged by its ability to bind to ligand molecules.
  • “functional" polypeptides include an antibody binding specifically to an antigen through its antigen-binding region.
  • NKG2D is also referred to as killer cell lectin-like receptor, subfamily C, member 4, or as KLRC4.
  • NKG2D and "NKG2D receptor” includes variants, isoforms, and species homologs of human NKG2D receptor (see, e.g., the isoforms described in Diefenbach et al., 2002, Nat Immunol. 3(12): 1142-9).
  • NKG2D is a type II transmembrane protein with an extracellular C-type (i.e., Ca 2+ -binding) lectin-like domain but lacking the Ca 2+ binding site.
  • any activity attributed herein to NKG2D e.g., cell activation, recognition by antibodies, etc., can also refer to NKG2D-including complexes such as NKG2D-DAP10 or NKG2D-DAP12 heterodimers.
  • NKG2D-bearing immune effector cell for example an NK cell
  • stressed or diseased cells expressing a NKG2D ligand such as MICA or MICB
  • MICA MHC class I chain-related gene A protein
  • HLA class I protein the MICA protein does not associate with ⁇ 2 microglobulin.
  • MICA expression is stress induced, and MICA acts as a ligand for natural killer cell (NK) receptor NKG2D.
  • NK natural killer cell
  • MICA protein comprises three extracellular Ig-like domains, i.e., alpha- 1, alpha-2 and alpha-3, a transmembrane domain, and an intracellular domain.
  • the protein is expressed in cells of the gastric epithelium, endothelial cells and fibroblasts and in the cytoplasm of keratinocytes and monocytes.
  • Exemplary sequences of MICA are available as NCBI accession nos. NP_000238.1 (allele MICA*001), presented in FIG. 1A (SEQ ID NO: l) of the present disclosure, and NP 001 170990.1 (allele MICA*008.01).
  • Other exemplary MICA sequences can be found in U.S. patent publication 201 1031 1561, incorporated herein by reference.
  • MICB refers to MHC class I chain-related gene B protein (MICB), including variants, isoforms, and species homologs of human MICB. Unlike HLA class I protein, the MICB protein does not associate with ⁇ 2 microglobulin. MICB expression is stress induced, and MICB acts as a ligand for natural killer cell (NK) receptor NKG2D. MICB has about 84% sequence identity to MICA. MICB protein comprises three extracellular Ig-like domains, i.e., alpha- 1, alpha-2 and alpha-3, a transmembrane domain, and an intracellular domain.
  • NK natural killer cell
  • the protein is expressed in the gastric epithelium, endothelial cells and fibroblasts and in the cytoplasm of keratinocytes and monocytes.
  • An exemplary sequence of MICB is available as UniProtKB accession number Q29980.1, which is presented in FIG. IB (SEQ ID NO:2) of the present disclosure.
  • Other exemplary MICB sequences can be found in U.S. patent publication 201 10311561, incorporated herein by reference.
  • soluble MICA refers to a MICA protein containing the alpha- 1 , alpha-2, and alpha-3 domains but which is not attached or tethered to a cell and thus exists extracellularly. Generally, soluble MICA lacks the transmembrane domain. In some embodiments, the sMICA is functional in binding to the NKG2D receptor. As used herein, sMICA encompasses forms released from cells by proteolysis, which forms can be variable because of non- specificity of the proteolytic process. Exemplary sMICA comprises a polypeptide containing amino acid residues from about 24 to about 297 of the unprocessed full length MICA presented in FIG. 1A (SEQ ID NO: l).
  • soluble MICB refers to a MICB protein containing the alpha- 1 , alpha-2, and alpha-3 domains of the MICB protein but which is not attached or tethered to a cell and thus exists extracellularly. Generally, soluble MICB lacks the transmembrane domain.
  • sMICB encompasses forms released from cells by proteolysis, which forms can be variable because of non-specificity of the proteolytic process.
  • Exemplary sMICB comprises a polypeptide of amino acid residues from about 24 to about 297 of the unprocessed full length MICB presented in FIG. IB (SEQ ID NO:2).
  • Exemplary amino acid sequences of putative soluble MICA proteins are also presented in FIG. 5 (SEQ ID NOs: 15-21).
  • the term "shedding" or “shed” in reference to a NKG2D ligand refers to release of a soluble extracellular domain fragment of a NKG2D ligand from the cell surface of a cell that expresses the NKG2D ligand. Such shedding may be caused by proteolytic cleavage of cell surface NKG2D ligand resulting in release of an extracellular domain fragment from the cell surface.
  • the soluble extracellular domain or fragment thereof may be encoded by an alternate transcript.
  • full length MIC refers to a MIC protein containing the alpha- 1, alpha- 2, and alpha-3 domains; the transmembrane domain; and the intracellular domain.
  • Unprocessed full length MIC protein refers to a MIC protein that has not been processed following translation while a “full length mature MIC protein” or “full length processed MIC protein” refers to the processed form of the MIC protein, for example a MIC protein having a leader peptide removed.
  • the full length unprocessed and the full length mature processed proteins can vary in length due to the existence of polymorphisms.
  • the total unprocessed length (containing a leader sequence) can range from about 332 to about 388 amino acids for MICA and, in some embodiments, is about 383 amino acids for MICB.
  • the unprocessed full length MIC protein can vary from about 332 to about 388 amino acids.
  • a processed MIC protein (with leader sequences removed) can range from about 309 to about 365 amino acids for MICA and about 360 amino acids for MICB.
  • Exemplary unprocessed full length MIC proteins are set forth in FIG. 1A (SEQ ID NO: 1) for MICA and FIG. IB (SEQ ID NO:2) for MICB.
  • FIG. 1A SEQ ID NO: 1A
  • FIG. IB SEQ ID NO:2
  • Other exemplary full length MICA and MICB sequences can be found in U.S. patent publication 201 1031 1561 and International patent publication WO20131 17647, incorporated herein by reference.
  • membrane bound form in the context of a protein or polypeptide refers to the protein or polypeptide containing the extracellular domain or portions thereof attached to at least the transmembrane domain or other membrane attachment domain.
  • a membrane bound form may or may not include the intracellular domain.
  • alpha- 1 domain of a MIC protein refers to amino terminal proximal Ig-like region (i.e., G-like domain) on the extracellular domain of MICA and MICB proteins (see, e.g., Frigoul and Lefranc, 2005, Recent Res Devel Human Genet. 3:95- 145;
  • An exemplary alpha- 1 domain of MICA contains amino acid residues from about 24 to about 108 of unprocessed MICA protein of the MICA*001 allele.
  • An exemplary alpha- 1 domain of MICB contains amino acid residues from about 24 to about 108 of unprocessed MICB protein of the MICB *001 allele.
  • alpha-2 domain of a MIC protein refers to the second Ig-like region (i.e., G-like domain) on the extracellular domain of MICA and MICB proteins (see, e.g., Frigoul and Lefranc, 2005, Recent Res Devel Human Genet. 3:95-145, incorporated herein by reference).
  • An exemplary alpha-2 domain of MICA contains amino acid residues from about 109 to about 201 of unprocessed MICA protein of the MICA*001 allele.
  • An exemplary alpha-2 domain of MICB protein contains amino acid residues from about 109 to about 201 of unprocessed MICB protein of the MICB *001 allele.
  • alpha-3 domain of a MIC protein refers to the transmembrane proximal region, also referred to as the C-like region on the extracellular domain of MICA and MICB proteins (see, e.g., Frigoul and Lefranc, 2005, Recent Res Devel Human Genet. 3:95- 145, incorporated herein by reference).
  • the alpha-3 domain contains the disulfide bond formed between two cysteine residues in the alpha-3 domain.
  • An exemplary alpha-3 domain of MICA contains amino acid residues from about 205 to about 296 or from about 205 to about 297 of unprocessed MICA protein of the MICA*001 allele.
  • An exemplary alpha-3 domain of MICB protein contains amino acid residues from about 205 to about 296 or from about 205 to about 297 of unprocessed MICB protein of the MICB*001 allele.
  • the term "insignificant autoimmune disease inducing” refers to the lack of a pathological autoimmune reaction inducing activity.
  • the term "antigen” refers to a substance, such as a particular peptide or protein, which can bind to a specific antibody.
  • epitopes refers to that portion of an antigen capable of being recognized and specifically bound by a particular antibody.
  • antigen is a polypeptide
  • epitopes can be formed from contiguous amino acids and/or noncontiguous amino acids juxtaposed by tertiary folding of a protein.
  • Linear epitope is an epitope formed from contiguous amino acids on the linear sequence of amino acids. A linear epitope is typically retained upon protein denaturing.
  • Conformational or structural epitope is an epitope composed of amino acid residues that are not contiguous and thus comprised of separated parts of the linear sequence of amino acids that are brought into proximity to one another by folding of the molecule, such as through secondary, tertiary, and/or quaternary structures.
  • a conformational or structural epitope is typically lost upon protein denaturation.
  • an epitope can comprise at least 3, and more usually, at least 5 or 8- 10 amino acids in a unique spatial conformation.
  • an epitope as used herein encompasses a defined epitope in which an antibody binds only portions of the defined epitope.
  • mapping and characterizing the location of epitopes on proteins including solving the crystal structure of an antibody-antigen complex, competition assays, gene fragment expression assays, mutation assays, and synthetic peptide -based assays, as described, for example, in Using Antibodies: A Laboratory Manual, Chapter 11, Harlow and Lane, eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1999).
  • cryptic epitope refers to an epitope that is not exposed for recognition by a binding agent within a native structure, but is capable of being recognized when there is a disruption of the native structure that exposes the cryptic epitope.
  • a cryptic epitope refers to a protein sequence that is not exposed for recognition within a native protein, but is capable of being recognized by a binding agent when there is a disruption of the native protein structure or when the epitope is separate from the native protein. Sequences that are not exposed or are only partially exposed in the native structure are potential cryptic epitopes.
  • Candidate cryptic epitopes can also be identified, for example, by examining the three-dimensional structure of a native protein.
  • structural disruptions capable of exposing cryptic epitopes include denaturation and proteolysis. Separation of the cryptic epitope from the native protein can occur by proteolysis, synthesis of a protein fragment containing the epitope, or release of an extracellular portion of the native protein from a membrane, such as a cell surface membrane.
  • polymorphic refers to the occurrence of two or more forms of a gene or portion thereof.
  • a portion of a gene of which there are at least two different forms, i.e., two different nucleotide sequences, is referred to as a "polymorphic region of a gene".
  • a polymorphic region can be a single nucleotide, the identity of which differs in different alleles.
  • a polymorphic region can also be several nucleotides long.
  • a polymorphic protein refers to occurrence of two or more forms of the protein due to polymorphisms in the encoding gene sequence.
  • allele refers to the specific gene sequence at a locus, which is the position occupied by a segment of a specific sequence of base pairs along a gene sequence of DNA.
  • protein denotes a polymer of at least two amino acids covalently linked by an amide bond, regardless of length or post-translational modification (e.g., glycosylation, phosphorylation, lipidation, myristilation, ubiquitination, etc.). Included within this definition are D- and L-amino acids, and mixtures of D- and L-amino acids.
  • the polypeptide sequences are displayed herein in the conventional N-terminal to C-terminal orientation.
  • polynucleotide and “nucleic acid” are used interchangeably herein and refer to two or more nucleosides that are covalently linked together.
  • the polynucleotide may be wholly comprised ribonucleosides (i.e., an R A), wholly comprised of 2' deoxyribonucleotides (i.e., a DNA) or mixtures of ribo- and 2' deoxyribonucleosides.
  • the nucleosides will typically be linked together by sugar-phosphate linkages (sugar-phosphate backbone), but the polynucleotides may include one or more non-standard linkages.
  • Non-limiting example of such non-standard linkages include phosphoramidates, phosphorothioates, and amides (see, e.g., Eckstein, F., Oligonucleotides and Analogues: A Practical Approach, Oxford University Press (1992)).
  • operably linked refers to a situation in which two or more polynucleotide sequences are positioned to permit their ordinary functionality.
  • a promoter is operably linked to a coding sequence if it is capable of controlling the expression of the sequence.
  • Other control sequences such as enhancers, ribosome binding or entry sites, termination signals, polyadenylation sequences, and signal sequences are also operably linked to permit their proper function in transcription or translation.
  • amino acid position and “amino acid residue” are used
  • the amino acid residue can be represented as "XN", where X represents the amino acid and the N represents its position in the polypeptide chain.
  • X represents the amino acid
  • N represents its position in the polypeptide chain.
  • Y represents the replacement or substitute amino acid.
  • the first number referenced describes the position where the polypeptide or peptide begins (i.e., amino end) and the second referenced number describes where the polypeptide or peptide ends (i.e., carboxy end).
  • a peptide from amino acid position 190 to 196 of a processed full length MICA refers to a peptide in which its amino end is at position 190 and its carboxy end is at position 196 of the processed full length MICA protein.
  • polyclonal antibody refers to a composition of different antibody molecules which is capable of binding to or reacting with several different specific antigenic
  • a polyclonal antibody can also be considered to be a "cocktail of monoclonal antibodies.”
  • the polyclonal antibodies may be of any origin, e.g., chimeric, humanized, or fully human.
  • the term "monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Each monoclonal antibody is directed against a single determinant on the antigen. Monoclonal antibodies are highly specific. For example, the monoclonal antibodies to be used in accordance with the present disclosure can be made by the hybridoma method described by Kohler et al., 1975, Nature 256:495-7, or can be made by recombinant DNA methods. The monoclonal antibodies may also be isolated, e.g., from phage antibody libraries.
  • chimeric antibody refers to an antibody made up of components from at least two different sources.
  • a chimeric antibody can comprise a portion of an antibody derived from a first species fused to another molecule, e.g., a portion of an antibody derived from a second species.
  • a chimeric antibody comprises a portion of an antibody derived from a non-human animal, e.g., mouse or rat, fused to a portion of an antibody derived from a human.
  • a chimeric antibody comprises all or a portion of a variable region of an antibody derived from a non-human animal fused to a constant region of an antibody derived from a human.
  • humanized antibody refers to an antibody that comprises a donor antibody binding specificity, e.g., the CDR regions of a donor antibody, such as a mouse monoclonal antibody, grafted onto human framework sequences.
  • a "humanized antibody” typically binds to the same epitope as the donor antibody.
  • the term "fully human antibody” or “human antibody” refers to an antibody that comprises human immunoglobulin protein sequences only.
  • a fully human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell.
  • antibody fragment refers to a portion of a full length antibody, generally the antigen binding or variable domain thereof.
  • antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies; single-chain antibodies; and multispecific antibodies formed from antibody fragments that bind two or more different antigens.
  • antibody fragments containing increased binding stoichiometries or variable valencies include triabodies, trivalent antibodies and trimerbodies, tetrabodies, tandAbs ® , di-diabodies and (sc(Fv)2) 2 molecules, and all can be used as binding agents to bind with high affinity and avidity to soluble antigens (see, e.g., Cuesta et al., 2010, Trends Biotech. 28:355-62).
  • the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding.
  • the term “diabodies” refers to small antibody fragments with two antigen-binding sites, which comprise a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (VH - VL).
  • VH heavy chain variable domain
  • VL light chain variable domain
  • the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
  • an antigen binding domain refers to the region or part of the antigen binding molecule that specifically binds to and complementary to part or all of an antigen.
  • an antigen binding domain may only bind to a particular part of the antigen (e.g., an epitope), particularly where the antigen is large.
  • An antigen binding domain may comprise one or more antibody variable regions, particularly an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH), and particularly the complementarity determining regions (CDRs) on each of the VH and VL chains.
  • variable region and “variable domain” are used interchangeably to refer to the polypeptide region that differ extensively in sequence between antibodies and confers the binding and specificity characteristics of each particular antibody.
  • the variable region in the heavy chain of an antibody is referred to as "VH” while the variable region in the light chain of an antibody is referred to as "VL”.
  • the major variability in sequence is generally localized in three regions of the variable domain, denoted as “hypervariable regions” or “CDRs” in each of the VL region and VH region, and forms the antigen binding site.
  • CDRs hypervariable regions
  • the more conserved portions of the variable domains are referred to as the framework region.
  • CDR complementarity-determining region
  • the CDRs are also described as
  • CDR HI or HI CDR H2 or H2; and CDR H3 or H3
  • CDR LI or LI three in the VL
  • CDR L2 or L2 CDR L3 or L3
  • the CDR domains have been delineated using various approaches, and it is to be understood that CDRs defined by the different approaches are to be encompassed herein.
  • the "Kabat” approach for defining CDRs uses sequence variability and is the most commonly used (Kabat et al., 1991, "Sequences of Proteins of Immunological Interest, 5 th Ed.” NIH 1 :688-96).
  • CDRs defined by “AbM” are a compromise between the Kabat and Chothia, and is delineated using Oxford Molecular AbM antibody modeling software (see, Martin et al., 1989, Proc. Natl Acad Sci USA. 86:9268; see also, world wide web www.bioinf-org.uk/abs).
  • the "Contact” CDR delineations are based on analysis of known antibody-antigen crystal structures (see, e.g., MacCallum et al., 1996, J. Mol. Biol. 262, 732-45).
  • the CDRs delineated by these methods typically include overlapping or subsets of amino acid residues when compared to each other. Generally, the residues defining the CDRs using each of the approaches are noted in the following:
  • Kabat supra, also defined a numbering system for variable domain sequences that is applicable to any antibody.
  • One of skill in the art can assign this system of "Kabat numbering" to any variable domain sequence. Accordingly, unless otherwise specified, references to the number of specific amino acid residues in an antibody or antigen binding fragment are according to the Kabat numbering system.
  • the sequences relevant to variable regions and CDRs e.g., SEQ ID NOS: 23, 26, 31, 35, and 83-102 are not numbered according to Kabat numbering system, but one of ordinary skill in the art will recognize that such sequences can be converted to the Kabat numbering system.
  • variable region refers to amino acid residues that are part of the variable region but are not part of the CDRs (e.g., using the Kabat, Chothia or AbM definition).
  • the variable region of an antibody generally contains four FR regions: FR1, FR2, FR3 and FR4. Accordingly, the FR regions in a VL region appear in the following sequence: FR L 1-CDR LI- FR L 2-CDR L2-FR L 3-CDR L3-FR L 4, while the FR regions in a VH region appear in the following sequence: FR1 H -CDR H1-FR H 2-CDR H2-FR H 3-CDR H3-FR H 4.
  • human consensus framework refers to a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroups sequences is a subgroup presented in Kabat et al., supra.
  • the subgroup is subgroup kappa described in Kabat et al., supra.
  • for the VH the subgroup is subgroup III described in Kabat et al., supra.
  • the term “constant region” or “constant domain” refers to a region of an immunoglobulin light chain or heavy chain that is distinct from the variable region.
  • the constant domain of the heavy chain generally comprises at least one of: a CHI domain, a Hinge (e.g., upper, middle, and/or lower hinge region), a CH2 domain, and a CH3 domain.
  • an antibody described herein may comprise a polypeptide comprising a CHI domain; a polypeptide comprising a CHI domain, at least a portion of a Hinge domain, and a CH2 domain; a polypeptide comprising a CHI domain and a CH3 domain; a polypeptide comprising a CHI domain, at least a portion of a Hinge domain, and a CH3 domain, or a polypeptide comprising a CHI domain, at least a portion of a Hinge domain, a CH2 domain, and a CH3 domain.
  • a polypeptide comprises a polypeptide chain comprising a CH3 domain.
  • the constant domain of a light chain is referred to a CL, and in some embodiments, can be a kappa or lambda constant region. However, it will be understood by one of ordinary skill in the art that these constant domains (e.g., the heavy chain or light chain) may be modified such that they vary in amino acid sequence from the naturally occurring immunoglobulin molecule.
  • the term "Fc region” or “Fc portion” refers to the C terminal region of an immunoglobulin heavy chain.
  • the Fc region can be a native- sequence Fc region or a non-naturally occurring variant Fc region.
  • the Fc region of an immunoglobulin comprises constant domains CH2 and CH3.
  • the human IgG heavy chain Fc region can be defined to extend from an amino acid residue at position C226 or from P230 to the carboxy terminus thereof.
  • the "CH2 domain" of a human IgG Fc region also denoted as "Cy2" usually extends from about amino acid residue 231 to about amino acid residue 340.
  • N-linked carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule.
  • the CH3 domain" of a human IgG Fc region comprises residues C-terminal to the CH2 domain, e.g., from about amino acid residue 341 to about amino acid residue 447 of the Fc region.
  • a "functional Fc region” possesses an "effector function" of a native sequence Fc region.
  • Exemplary Fc "effector functions” include, among others, Clq binding; complement dependent cytotoxicity (CDC); Fc receptor binding; antibody dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell-surface receptors (e.g., LT receptor); etc.
  • Such effector functions generally require the Fc region to be combined with a binding domain (e.g., an antibody variable domain) and can be assessed using various assays known in the art.
  • binding affinity refers to strength of the sum total of noncovalent interactions between a ligand and its binding partner.
  • binding affinity is the intrinsic affinity reflecting a one-to-one interaction between the ligand and binding partner.
  • the affinity is generally expressed in terms of equilibrium association (K A ) or dissociation constants (K D ), which are in turn reciprocal ratios of dissociation ⁇ k 0 g) and association rate constants (k on ).
  • percent (%) sequence identity and “percentage sequence homology” are used interchangeably herein to refer to comparisons among polynucleotides or polypeptides, and are determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise gaps as compared to the reference sequence for optimal alignment of the two sequences.
  • the percentage may be calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • the percentage may be calculated by determining the number of positions at which either the identical nucleic acid base or amino acid residue occurs in both sequences or a nucleic acid base or amino acid residue is aligned with a gap to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, 1981, Adv Appl Math. 2:482, by the homology alignment algorithm of Needleman and Wunsch, 1970, J Mol Biol.
  • BLAST and BLAST 2.0, FASTDB, or ALIGN algorithms which are publically available (e.g., NCBI: National Center for Biotechnology Information).
  • NCBI National Center for Biotechnology Information
  • Those skilled in the art can determine appropriate parameters for aligning sequences.
  • the BLASTN program for nucleotide sequences
  • W wordlength
  • E expectation
  • amino acid substitution refers to the replacement of one amino acid in a polypeptide with another amino acid.
  • a “conservative amino acid substitution” refers to the interchangeability of residues having similar side chains, and thus typically involves substitution of the amino acid in the polypeptide with amino acids within the same or similar defined class of amino acids.
  • an amino acid with an aliphatic side chain may be substituted with another aliphatic amino acid, e.g., alanine, valine, leucine, isoleucine, and methionine; an amino acid with hydroxyl side chain is substituted with another amino acid with a hydroxyl side chain, e.g., serine and threonine; an amino acid having aromatic side chains is substituted with another amino acid having an aromatic side chain, e.g., phenylalanine, tyrosine, tryptophan, and histidine; an amino acid with a basic side chain is substituted with another amino acid with a basis side chain, e.g., lysine, arginine, and histidine; an amino acid with an acidic side chain is substituted with another amino acid with an acidic side chain, e.g., aspartic acid or glutamic acid; and a hydrophobic or hydrophilic amino acid is replaced with another hydrophobic or hydro
  • amino acid insertion refers to the incorporation of at least one amino acid into a predetermined amino acid sequence.
  • An insertion can consist of the insertion of one or two amino acid residues; however, larger insertions of about three to about five, or up to about ten or more amino acid residues are contemplated herein.
  • amino acid deletion refers to the removal of one or more amino acid residues from a predetermined amino acid sequence.
  • a deletion can consist of the removal of one or two amino acid residues; however, larger deletions of about three to about five, or up to about ten or more amino acid residues are contemplated herein.
  • immunological response refers to a moiety, which optionally can be administered to a subject, which induces an immunological response.
  • sequence refers to a sequence of a nucleic acid or polypeptide which comprises a part of a longer sequence of a nucleic acid or polypeptide, respectively.
  • adjuvant refers to any substance that assists or modifies the immunological action of a composition, including but not limited to adjuvants that increase or diversify the immune response to an antigen.
  • fusion protein and "fusion polypeptide” refer to a polypeptide comprising amino acid sequences derived from two or more heterologous polypeptides.
  • the polypeptides forming the fusion protein are typically linked C-terminus to N-terminus, although they can also be linked C-terminus to C-terminus, N-terminus to N-terminus, or N-terminus to C-terminus.
  • the polypeptides of the fusion protein can be in any order.
  • the term “candidate” in the context of screening refers to an antibody that is being considered or tested for desired properties, for example binding to defined epitopes.
  • the term “identifying” refers to investigating for the presence or absence of a property. The process may include measuring or detecting various properties, including the binding or lack of binding to an epitope.
  • biological sample refers to any biological material taken from a patient or subject. Such samples include tissue samples and fluid samples.
  • a "fluid sample” includes, among others, a sample of a patient's blood, plasma, serum, urine, cerebrospinal fluid, lymph, synovial fluid, bile, semen, and saliva.
  • a sample can also include a biopsy sample, whole cells, or lysates of cells.
  • the term “subject” refers to a mammal, including, but not limited to humans, non-human primates, and non-primates, such as goats, horses, and cows. In some embodiments, the terms “subject” and “patient” are used interchangeably herein in reference to a human subject.
  • abnormal refers to a level or condition which is statistically different from the level or condition observed in organisms not suffering from such a disease or disorder and may be characterized as either an excess amount, intensity or duration of signal or a deficient amount, intensity or duration of signal.
  • the abnormality may be realized as an abnormality in cell function, viability or differentiation state.
  • An abnormal interaction level may also be greater or less than the normal level, and may impair the normal performance or function of the organism.
  • the term "elevated" in the context of a disease or disorder refers to above normal levels of a substance or molecule, such as a disease marker or indicator, that has a statistically significant correlation with the occurrence of the disease or disorder.
  • the levels can be compared to appropriate controls, e.g., healthy subjects without the disease, to determine the levels that signal presence of the disease.
  • cancer and “cancerous” refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth.
  • cancers include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancers.
  • proliferative disorder and “proliferative disease” refer to disorders associated with abnormal cell proliferation such as cancer.
  • tumor and “neoplasm” refer to any mass of tissue that result from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous) including pre-cancerous lesions.
  • MICA + disease or disorder refers to a disease or disorder displaying elevated levels of MICA protein or portions thereof, such as sMICA, that is correlated with the occurrence of the disease or disorder.
  • MICB + disease or disorder refers to a disease or disorder displaying elevated levels of MICB protein or portions thereof, such as sMICB, that is correlated with the occurrence of the disease or disorder.
  • MIC + epithelial tumor refers to a tumor or neoplasm characterized by elevated levels of a MIC protein or portions thereof, such as sMICA, where the tumor or neoplasm originates from a tissue or cell that is of epithelial origin in accordance with clinical standards known in the art for identifying such disorders.
  • MIC + hematologic malignancy refers to proliferative disorders of cells of the lymphoid or myeloid system characterized by elevated levels of a MIC protein or portions thereof, such as sMICA and sMICB.
  • Lymphoid disorders include acute lymphocytic leukemia and chronic lymphoproliferative disorders (e.g., lymphoma, myeloma, and chronic lymphoid leukemias).
  • Lymphomas include Hodgkin's disease and non-Hodgkin's lymphoma, precursor T-cell
  • leukemia/lymphoma follicular lymphoma, diffuse large B-cell lymphoma, mantle cell lymphoma, MALT lymphoma, Burkitt's lymphoma, B-cell chronic lymphocytic leukemia/lymphoma, peripheral T- cell lymphoma -not-otherwise-specified, and mycosis fungoides.
  • Chronic lymphoid leukemias include T cell chronic lymphoid leukemias and B cell chronic lymphoid leukemias.
  • Myeloid disorders include chronic myeloid disorders and acute myeloid leukemia.
  • Chronic myeloid disorders include chronic myeloproliferative disorders and myelodysplastic syndrome.
  • Chronic myeloproliferative disorders include angiogenic myeloid metaplasia, essential thrombocythemia, chronic myelogenous leukemia, polycythemia vera, and atypical myeloproliferative disorders.
  • Atypical myeloproliferative disorders include atypical CML, chronic neutrophilic leukemia, mast cell disease, and chronic eosinophilic leukemia.
  • MIC + viral infection refers to a viral infection characterized by elevated levels of a MIC protein or portions thereof, such as sMICA and sMICB.
  • treatment refers to a process that is intended to produce a beneficial change in the condition of a mammal, e.g., a human, often referred to as a patient.
  • a beneficial change can, for example, include one or more of restoration of function; reduction of symptoms;
  • a "therapy", “treatment”, or “treatable” is meant the therapy achieves a desired pharmacologic and/or physiologic effect on the disease or disorder.
  • the effect may be prophylactic in terms of completely or partially preventing the disease/disorder or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for the disease/disorder and/or adverse effect attributable to the disease/disorder.
  • the term includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; or (c) relieving the disease, i.e., causing remission or regression of the disease.
  • the therapeutic agent may be administered before, during or after the onset of the disease or disorder.
  • the treatment of an ongoing disease, where the treatment stabilizes or reduces the undesirable clinical symptoms of the patient, is of particular interest. Such treatment is desirably performed prior to complete loss of function in the affected tissues.
  • the term "therapeutically effective dose” or “therapeutically effective amount” refers to that quantity of a compound, including a biologic compound, or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a mammal in need thereof.
  • a pharmaceutical composition comprising an antibody, the term
  • terapéuticaally effective amount/dose refers to the amount/dose of the antibody or pharmaceutical composition thereof that is sufficient to produce an effective response upon administration to a mammal.
  • the term "pharmaceutically acceptable” refers to compounds or compositions which is generally safe, non-toxic and neither biologically nor otherwise undesirable, and includes a compound or composition that is acceptable for human pharmaceutical and veterinary use.
  • the compound or composition may be approved or approvable by a regulatory agency or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.
  • the term "pharmaceutically acceptable excipient, carrier or adjuvant” refers to an excipient, carrier or adjuvant that can be administered to a subject, together with at least one therapeutic agent (e.g., an antibody of the present disclosure), and which does not destroy the pharmacological activity thereof and is generally safe, nontoxic and neither biologically nor otherwise undesirable when administered in doses sufficient to deliver a therapeutic amount of the agent.
  • at least one therapeutic agent e.g., an antibody of the present disclosure
  • the term “monotherapy” refers to a treatment regimen based on the delivery of one therapeutically effective compound, whether administered as a single dose or several doses over time.
  • a combination therapy refers to a therapeutic regimen that involves the provision of at least two distinct therapies to achieve an indicated therapeutic effect.
  • a combination therapy may involve the administration of two or more distinct active ingredients, for example, an antibody and a chemotherapeutic agent, or an antibody directed to a first target and a second antibody directed to a second target.
  • a combination therapy may involve the administration of an antibody and/or one or more other therapeutic agents, alone or together with the delivery of another treatment, such as radiation therapy and/or surgery.
  • the active ingredients may be administered as part of the same composition or as different compositions.
  • the compositions comprising the different active ingredients may be administered at the same or different times, by the same or different routes, using the same of different dosing regimens, all as the particular context requires and as determined by the attending physician or attending caregiver.
  • immune stimulating agent or “immuno-activating agent” refers to an agent, such as a compound or composition, which enhances an immune response, e.g., as compared to the immune response in the absence of the immune stimulating agent.
  • the term "vaccine” refers to a compound or composition which can be administered to humans or to animals in order to induce an immune system response; this immune system response can result in production of antibodies or result in the activation of certain cells, in particular antigen-presenting cells and immune system effector cells, such as T lymphocytes and B lymphocytes.
  • the vaccine composition can be a composition for prophylactic purposes and/or for therapeutic purposes.
  • a “cancer vaccine” refers to a compound or composition which elicits an immune response against a cancer. The immune response can be against a broad spectrum of cancers or against a specific cancer.
  • the present disclosure provides binding agents, particularly antibodies, that bind specifically to soluble forms of MHC class I chain-related gene A protein (MICA) and/or MHC class I chain-related gene B protein (MICB).
  • MICA and MICB proteins are members of the MHC Class I -related chain (MIC) family and the related UL- 16 binding proteins (Leelayuwat et al., 1994, Immunogenetics 40:339-51 ; Bahram, 1994, Proc Natl Acad Sci USA. 91 :6259-63; Fodil et al., 1996, Immunogenetics 44:351-7; Groh et al., 1999, Proc Natl Acad Sci USA.
  • MIC ligands act as ligands that bind to C-type lectin-like activating receptor Natural Killer Group 2D (NKG2D) on immune effector cells, including NK, NKT and both ⁇ and ⁇ CD8 + T cells.
  • NKT2D Natural Killer Group 2D
  • Homology analyses indicate that MIC ligands are highly conserved in most mammals, with the exception of the rodent family, and are weakly related to MHC class I proteins.
  • the highly related MICA and MICB glycoproteins are about 84% identical at the amino acid sequence level (Bahram et AL., 1994, Proc Natl Acad Sci USA.
  • MICA and MICB proteins are stress-induced and are similar to MHC class I molecules; however, they do not associate with beta-2-microglobulin or bind peptides.
  • MIC proteins are expressed normally at low levels in the gut epithelium, on keratinocytes, monocytes and endothelial cells, but are induced to higher levels in stressed, transformed or some virally- infected cells (Groh et al., 1999, Proc Natl Acad Sci USA.
  • the NKG2D receptor functions as a co-stimulatory molecule along with DAP 10 to impart the ligand binding signal to the interior of the cell via the phosphatidylinositol kinase (PI3K) pathway.
  • PI3K phosphatidylinositol kinase
  • NKG2D ligands have been reported in many types of tumors and is thought to be the result of gene expression arising from stimulation of heat shock promoter elements as well as the intracellular detection of DNA damage resulting from either environmental insult or the increasing level of genomic instability associated with cancer.
  • the extracellular domain comprising alpha- 1, -2 and -3 domains is frequently shed into the blood by the action of proteases and results in the down-modulation (receptor internalization) of its intended receptor, NKG2D, on effector immune cells (see, e.g., Groh et al., 2002, Nature 419:734-8).
  • MICA glycoproteins are produced intracellularly that are not routinely destined to become cell surface membrane-bound, but instead are incorporated within exosomes and released outside the cell where interaction with NKG2D receptors on immune cells occurs (Ashiru et al., 2010, Cancer Res. 70:481-9). Studies suggest that these tumor- derived soluble MICA and MICB ligands (sMICA and sMICB) shed from the surface of tumor cells function like decoy molecules and lead to down-modulation of the NKG2D receptor on immune effector cells such as NK, NKT and various CD8 + T cells.
  • sMICA and sMICB tumor- derived soluble MICA and MICB ligands
  • sMICA and sMICB require the participation of protein disulfide isomerase ERp5, which appear to form transitory mixed disulphide complexes to enable proteolytic cleavage of the membrane bound MICA and MICB (Kaiser et al., 2007, Nature 447(7143):482-6).
  • ERp5 protein disulfide isomerase
  • sMICA and sMICB leads to the unusual situation where the effectors of the innate defense system, whose natural role is to seek and destroy transformed cells, are shut down by the immunosuppressive actions of these decoy MIC ligand molecules. Through this mechanism, tumor cells are capable of hiding from the immune system and can continue to grow unabated.
  • NKG2D ligand expression and shedding promote proliferation of normally rare, immunosuppressive NKG2D + CD4 + T cells in cancer patients, and is directly correlated with serum concentration of sMICA, thereby enabling NKG2D costimulation of T cell proliferation (see, e.g., Groh et al., 2006, Nat Immunol. 7:755-62).
  • sMICA and sMICB soluble MIC immune decoy molecules
  • sMICA and/or sMICB soluble MIC immune decoy molecules
  • sMICA and sMICB The involvement of sMICA and sMICB in viral infection comes from observations indicating that Respiratory Syncytial Virus (RSV) infections in respiratory epithelial cells led to the upregulation of cell surface expression of MICA and circulating levels of sMICA (Zdrenghea et al., 2012, Eur Respir J. 39:712-20). In this instance, higher levels of sMICA may impair clearance of the virus and potentially aid in prolonging the infection.
  • NK cells are known to play key cytotoxicity roles in the response of the immune system to RSV infections just as they function in detection of transformed cells in the proposed immunosurveillance system.
  • NK cell function via sMIC-induced down- modulation of NKG2D receptors on effector immune cells could either represent a viral response for avoiding immune detection or a cellular safety mechanism for reducing cytolysis of uninfected bystander cells once antiviral gamma interferon is released during the infection of the cell.
  • a cellular safety mechanism for reducing cytolysis of uninfected bystander cells once antiviral gamma interferon is released during the infection of the cell Considering the delicate balance between development of an adequate immune response to the virus and the consequential loss of NK cell function known to occur in RSV infections, it can be surmised that excessive sMICA will not be helpful in the desired overall antiviral response.
  • Efforts to reduce the levels of sMICA during these RSV infections are therefore warranted especially in the very young and in the elderly patient where prolonged viral infections frequently result in serious damage to the lining of the respiratory tract and even death as a result of difficult-to-treat secondary bacterial infections.
  • Release of soluble NKG2D ligands has also been described in viral infections of humans with Human Immunodeficiency Virus type l(HIV-l) (Nolting et al., 2010, Virology 406: 12-20) or with Hepatitis B Virus (HBV) that result in the onset of hepatocellular carcinoma (HCC).
  • HCC Hepatitis B Virus
  • Reducing the levels of soluble NKG2D ligands in HIV-1 infections by the binding agents and methods outlined in this disclosure may serve to improve the cytotoxic functionality of NK cells by increasing NKG2D cell-surface levels and thereby imparting an overall improvement in immunosurveillance and NK control of HIV-1 infections.
  • Kumar et al., 2012, PLOS One 7: 1-6 E44743 found a significant elevation of sMICA in HBV-induced HCC cases.
  • HBV + HCC patients who had elevated levels of sMICA had significantly worse survivability than those with normal levels, presumably because higher sMICA levels would cause inactivation of the immune surveillance system against HBV-infected cells.
  • reduction in circulating sMIC ligands would be consistent with improved immune reactivity towards chronic viral infections.
  • MICA and MICB and cognate receptor NKG2D have been targets for development of therapeutics for treating various diseases associated with MICA and MICB, such as cancers and autoimmune diseases.
  • patent publication WO 98/019167 describes cell stress regulated human MIC Class 1 gene and treatment of certain disease states including GVHD and cancers.
  • Patent publications WO 03/089616, US20050233391, US20100316650; and US Patent No. 7,771,718 describe soluble MIC polypeptides as markers for diagnosis, prognosis, and treatment of cancer and autoimmune diseases or conditions.
  • Patent publications WO 2008/036981 and U.S. Patent No. 7,959,916 describe methods of treating MICA-related disorders through use of anti-MICA antibodies and modulation of ERp5 (protein disulfide isomerase) activity, such as by ERp5 antibodies or by modulating ERp5 expression.
  • U.S. Patent No. 8,182,809 also describes methods for treating cancer by inhibiting MIC shedding (e.g., formation of soluble MICA) by use of an anti-MICA antibody.
  • the present disclosure provides binding agents, particularly antibodies, directed to epitopes on the extracellular (i.e., ectodomain) of MICA and/or MICB, where the epitopes become available for binding when the extracellular domain is separated from the intact MIC protein.
  • the antibodies should discriminate shed sMICA and/or sMICB proteins from intact or cell-bound MICA and/or MICB proteins.
  • the binding agents will be specific for the soluble forms of the MIC proteins, it can be used as a therapeutic approach to neutralizing and/or instigating clearance of sMICA and/or sMICB, thereby mitigating the detrimental effects of, e.g., immunosuppressive properties, of sMICA and/or sMICB released from cells in certain types of diseases, including among others, cancers and viral infections.
  • the binding agents herein are directed to antibodies that bind specifically to an extracellular domain of MICA but do not bind specifically to full length MICA or the extracellular domain of membrane bound form of MICA. In some embodiments, the binding agents herein are directed to antibodies that bind specifically to an extracellular domain of MICB but do not bind specifically to full length MICB or extracellular domain of membrane-bound form of MICB.
  • An exemplary full length MICA protein is presented in FIG. 1A (SEQ ID NO: l), with the extracellular domain of MICA being represented by amino acid residues from about 24 to about 297, and up to residue 307, of the sequence in FIG. 1A.
  • An exemplary full length MICB protein is presented in FIG. IB (SEQ ID NO:2), with the extracellular domain of MICB being represented by amino acid residues from about 24 to about 297, and up to residue 307 of the sequence in FIG. IB.
  • the antibodies herein comprise isolated antibodies.
  • the antibody binds specifically to a soluble form of MICA (sMICA), where the antibody does not bind specifically to the naturally occurring full length MICA or extracellular domain of a membrane -bound form of MICA.
  • sMICA soluble form of MICA
  • the antibody binds specifically to a soluble form of MICB (sMICB), where the antibody does not bind specifically to naturally occurring full length MICB or extracellular domain of membrane -bound form of MICB.
  • sMICB soluble form of MICB
  • the soluble forms of MICA and/or MICB are truncated proteins that lack the transmembrane domain and cytoplasmic tail but retain the three extra-cellular domains: alpha- 1, alpha-2 and alpha-3 domains.
  • the soluble forms of the MIC protein which can be found in various types of tumors, can have variable carboxy terminal ends owing to the process by which the soluble forms are generated. Without being bound by theory, the naturally occurring soluble forms appear to result from the actions of a disulfide isomerase, endoplasmic reticulum protein 5, also referred to as ERp5, PDIA6 or P5, which forms a complex with the MICA or MICB protein and reduces the disulfide bond in the alpha-3 domain.
  • the soluble MIC protein is released after proteolytic cleavage near the cell membrane.
  • proteolytic recognition sites see, e.g., Wang et al., 2009, Biochem Biophys Res Comm. 387:476-81) but instead occur in a random fashion within the alpha-3 domain sequence upstream of the transmembrane section and downstream of the reported conserved ERp5 binding site at N238-T243 of MICA or homologous sequence in MICB.
  • the present disclosure has identified a number of epitopes on the alpha-3 domain, and specifically at the section of the alpha-3 domain that is in close proximity to the cellular membrane, that are exposed by the proteolytic processing of the MIC protein and to which antibodies can bind to distinguish between soluble forms of MIC protein (or the extracellular domain of the MIC proteins) from the intact or membrane bound forms of MICA and/or MICB. Accordingly, in some embodiments, the antibody binds specifically to the alpha-3 domain of MICA but does not bind specifically to the naturally occurring full length MICA or extracellular domain of a membrane-bound form of MICA.
  • the antibody binds specifically to a cryptic epitope on the alpha-3 domain of MICA, but does not bind specifically to the naturally occurring full length MICA or extracellular domain of a membrane-bound form of MICA. In some embodiments, the antibody binds specifically to the alpha-3 domain of MICB, but does not bind specifically to the naturally occurring full length MICB or extracellular domain of a membrane-bound form of MICB. In some embodiments, the antibody binds specifically to a cryptic epitope on the alpha-3 domain of MICB, but does not bind specifically to the naturally occurring full length MICA or extracellular domain of a membrane-bound form of MICB.
  • the antibody of the present disclosure has insignificant autoimmune disease inducing activity when administered to a subject.
  • antibodies that bind the alpha- 1 or alpha-2 domain or against sections of the alpha-3 domain that may be "recognized" normally by the immune system when the MICA (or MICB) protein is attached to a cell could create a situation where constitutively-expressed MICA, for example in the gut epithelium, could be bound by the inappropriately targeted therapeutic antibodies and hence lead to an unwanted immune response at that site, particularly an autoimmune reaction.
  • the antibody of the present disclosure has insignificant antagonistic activity against binding of MIC protein to its cognate receptor NKG2D.
  • the antibodies herein that bind specifically to the cryptic epitopes on the alpha-3 domain are unlikely to bind MICA and/or MICB present on the cell surface. Hence, the antibodies should have insignificant effect on interaction of the MICA and/or MICB protein with the NKG2D receptor.
  • the alpha-3 domain is located at a region proximal to the transmembrane domain, away from the regions that would typically interact with the receptor.
  • enhancing immune response as contemplated herein also includes one or more of the following: upregulation of T cell, natural killer (NK) cell, natural killer T (NKT) cell, ⁇ T cell, ⁇ T cell, and B cell function.
  • upregulation of one or more of T cell, natural killer (NK) cell, natural killer T (NKT) cell, ⁇ T cell, ⁇ T cell, and B cell function includes enhancement and/or endowment of activity capable of inhibiting cancer progression or inhibiting viral infection.
  • the antibody of the present disclosure binds specifically to undenatured or naturally occurring forms of sMICA and/or sMICB.
  • Therapeutically useful antibodies will bind specifically to the naturally occurring target molecule, in this instance sMICA and sMICB.
  • Such antibodies can be obtained by using polypeptide antigens that contain the cryptic epitopes but also retain the 3-dimensional structure in which the epitope resides.
  • polypeptide immunogens that contain the alpha-3 domain or various substructures (e.g., loops) of the alpha-3 domain and then screening candidate antibodies using the defined cryptic epitopes will allow identification of antibodies with specific binding to undenatured or naturally occurring forms of sMICA and/or sMICB.
  • the cryptic epitopes to which the antibody binds are within the alpha-3 domain of MICA defined by an amino acid sequence from amino acid residues 187 to 296, or 187 to 297, particularly amino acid residues 187 to 274, more particularly amino acid residues 190 to 256 of MICA protein, where the amino acid numbering is based on the processed MICA protein of the MICA*001 allele.
  • An exemplary sequence for the alpha-3 domain on the extracellular region of MICA is presented in FIG. 1C (SEQ ID NO:3).
  • the cryptic epitopes to which the antibody binds are within the alpha-3 domain of MICB defined by an amino acid sequence from amino acid residues 187 to 296, or 187 to 297, particularly amino acid residues 187 to 274, more particularly amino acid residues 190 to 256 of MICB protein, where the amino acid numbering is based on the processed MICB protein of the MICB*001 allele.
  • An exemplary sequence for the alpha-3 domain on the extracellular region of MICB is presented in FIG. ID (SEQ ID NO:4).
  • the sequence alignment can be carried out using BLAST, using default parameters.
  • the cryptic epitopes to which the antibody binds are within a subsequence of the alpha-3 domain, wherein the subsequence is selected from:
  • the cryptic epitope within the alpha-3 domain comprises a sequence region selected from:
  • MICA*001 MICA*002:01, MICA*002:02, MICA*002:03, MICA*002:04, MICA*004, MICA*005, MICA*006, MICA*007:01, MICA*007:02, MICA*007:03, MICA*007:04, MICA*007:05, MICA*007:06, MICA*008:01 :01, MICA*008:01 :02, MICA*008:02, MICA*008:03, MICA*008:04, MICA*008:05, MICA*009:01, MICA*
  • the cryptic epitope within the alpha-3 domain to which the antibody binds comprises a sequence region selected from:
  • MICB MICB
  • IMGT/HLA and IMGT/MHC Sequence databases for the study of the major histocompatibility complex", Nucleic Acids Res. 31 :31 1-314 and the Anthony Nolan Research Institute world wide web site www.anthonynolan.org.uk/HIG/data.html; which are incorporated herein by reference.
  • MICB allelic variants including human MICB allelic variants selected from MICB*001, MICB*002:01 :01, MICB*002:01 :02, MICB*003, MICB*004:01 :01, MICB*004:01 :02, MICB*005:01, MICB*005:02:01, MICB*005:02:02, MICB*005:02:03, MICB*005:02:04, MICB*005:03,
  • MICB*005:04 MICB*005:05, MICB*005:06, MICB*005:07, MICB*005:08, MICB*006, MICB*007, MICB*008, MICB*009N, MICB*010, MICB*01 1, MICB*012, MICB*013, MICB*014, MICB*015, MICB*016, MICB*018, MICB*019, MICB*020, MICB*021N, MICB *022; MICB*023, MICB*024, MICB*025, MICB*026, MICB*027, MICB*028, and MICB*029.
  • the antibody binds specifically to an epitope of MICA defined by the sequence:
  • RSEASEG 196 located on bottom of alpha-3 domain (SEQ ID NO:38);
  • RQDGV 221, located on lower side of alpha-3 domain SEQ ID NO: 39;
  • LPDGN 238, located near the top of alpha-3 domain SEQ ID NO:40
  • RGEEQR 256 located on bottom of alpha-3 domain (SEQ ID NO:42),
  • amino acid positions are defined with respect to the mature, processed MICA protein of the MICA*001 allele.
  • the antibody binds an epitope comprising one or more amino acid residues selected from R190, S 191, E192, A193, S 194, E195, and G196, located at the bottom of the alpha-3 domain, where the amino acid positions are defined with respect to the mature, processed MICA protein of the MICA*001 allele.
  • the epitope comprises 1, 2, 3 or more, or 1, 2, 3, 4 or more of the foregoing amino acid residues in the alpha-3 domain.
  • the antibody binds an epitope comprising one or more amino acid residues selected from R217, Q218, D219, G220, and V221, located on the lower side of the alpha-3 domain, where the amino acid positions are defined with respect to the mature, processed MICA protein of the MICA*001 allele.
  • the epitope comprises 1, 2, 3 or more, or 1, 2, 3, 4 or more of the foregoing amino acid residues in the alpha-3 domain.
  • the antibody binds an epitope comprising one or more amino acid residues selected from Q251/R251, G252, E253, E254, Q255, and R256, located on the bottom of the alpha-3 domain, where the amino acid positions are defined with respect to the mature, processed MICA protein of the MICA*001 allele.
  • the epitope comprises 1, 2, 3 or more, or 1, 2, 3, 4 or more of the foregoing amino acid residues in the alpha-3 domain.
  • the antibody binds an epitope comprising one or more amino acid residues selected from L234, P235, D236, G237, and N238, located near the top of the alpha-3 domain, where the amino acid positions are defined with respect to the mature, processed MICA protein of the MICA*001 allele.
  • the epitope comprises 1, 2, 3 or more, or 1, 2, 3, 4 or more of the foregoing amino acid residues in the alpha-3 domain.
  • the antibody binds specifically to an epitope defined by:
  • RGEEQR 256 located on the bottom of the alpha-3 domain (SEQ ID NO:42), where the amino acid residue numbering is in reference to the mature, processed MICA protein of the MICA*001 allele. This epitope is found in, but not limited to, MICA alleles *005; *008:01 :01;
  • the antibody binds specifically to an epitope of MICB defined by the sequence:
  • amino acid positions are defined with respect to the mature, processed MICB protein of the MICB*001 allele.
  • the antibody binds an epitope comprising one or more amino acid residues selected from C190, S 191, E192, V193, S 194, E195, and G196, located on the bottom of the alpha-3 domain, where the amino acid positions are defined with respect to the mature, processed MICB protein of the MICB*001 allele.
  • the epitope comprises 1, 2, 3 or more, or 1, 2, 3, 4 or more of the foregoing amino acid residues in the alpha-3 domain.
  • the antibody binds an epitope comprising one or more amino acid residues selected from R217, Q218, D219, G220, and V221, located on the lower side of the alpha-3 domain, where the amino acid positions are defined with respect to the mature, processed MICB protein of the MICB*001 allele.
  • the epitope comprises 1, 2, 3 or more, or 1, 2, 3, 4 or more of the foregoing amino acid residues in the alpha-3 domain.
  • the antibody binds an epitope comprising one or more amino acid residues selected from R250, Q251, G252, E253, E254, Q255, and R256, located on the bottom of the alpha-3 domain, where the amino acid positions are defined with respect to the mature, processed MICB protein of the MICB*001 allele.
  • the epitope comprises 1, 2, 3 or more, or 1, 2, 3, 4 or more of the foregoing amino acid residues in the alpha-3 domain.
  • the antibody binds an epitope comprising one or more amino acid residues selected from L234, P235, D236, G237, and N238, located near the top of the alpha-3 domain, where the amino acid positions are defined with respect to the mature, processed MICB protein of the MICB*001 allele.
  • the epitope comprises 1, 2, 3 or more, or 1, 2, 3, 4 or more of the foregoing amino acid residues in the alpha-3 domain.
  • the epitope of the alpha-3 domain to which the antibody binds is within the amino acid sequence defined by:
  • X A1 is selected from R and C;
  • X A3 is selected from E and K; and
  • X A4 is selected from A and V;
  • X B5 is selected from V and L;
  • X D1 is selected from C or R;
  • X D2 is selected from Q, R, and E; and
  • X D7 is selected from R, S, and K; or
  • the antibody binds specifically to an epitope of the alpha-3 domain within an amino acid sequence defined above. In some embodiments, the antibody binds specifically to an epitope within the amino acid sequence:
  • X A1 is selected from R and C; X A3 is selected from E and K; and X A4 is selected from A and V.
  • the antibody binds specifically to an epitope within the amino acid sequence:
  • X B5 is selected from V and L.
  • the antibody binds specifically to an epitope within the amino acid sequence:
  • the antibody binds specifically to an epitope within the amino acid sequence:
  • any of the epitopes may contain an additional 1, 2, 3, 4, or 5 amino acids at the amino terminal and/or carboxy terminal end, where the additional amino acids can be those found on the naturally occurring MICA or MICB amino acid sequence surrounding the described defined region or the defined amino acid sequence.
  • additional cryptic epitopes can be identified by examining the alpha-3 domain in the X-ray crystal structure of the extracellular domains of MICA or MICB (see, e.g., Li et al., 1999, Immunity 10:577-84; Li et al., 2001, Nature Immunol. 2(5):443-51 ; Holmes et al., 2002, J Immunol. 169: 1395-400; and Protein Data Bank (PDB) X-ray crystal structures 1HYR for MICA and 1 JE6 for MICB).
  • PDB Protein Data Bank
  • sMICA and sMICB freed/shed MIC protein
  • These amino acid sequence motifs can be determined from secondary structural predictions (e.g., Chou and Fasman, 1978, Ann Rev Biochem. 47:251-76) as well as from close inspection of the 3-dimensional X- ray crystal structure(s), and more specifically by assessing the combination of primary sequence, surface accessibility, and ⁇ -turn characteristic that are consistent with potential B-cell epitopes.
  • various prediction methods that can be used to identify these cryptic epitopes from 3D structures include, among others, those described in Haste et al., 2006, Protein Sci. 15:2558-67; Kringelum et al., 2012, PLOS Computational Biol. 8(12):el002829; Kuroda et al., 2012, Protein Eng Des Sel. 25(10):507-521 ; and Soga et al., 2010, Protein Eng Des Sel. 23(6):441-8; all publications incorporated herein by reference.
  • a cryptic epitope specifically excluded from scope of a cryptic epitope is the alpha-3 domain region defined by amino acid residues 224 to 232, as well as any other specific region defined in WO20131 17647, incorporated herein by reference.
  • Specific antibodies excluded from the scope of the present disclosure include monoclonal antibodies designated as 9C10, 12A10, 19E9, 18 E8, 10F3, 15F9, 6E4, 20C6, 10A7, 16A8, and 14B4, particularly antibodies 15F9, 16A8 and 14B4, as well as antibodies with the corresponding CDR sequences as described in
  • the primary epitope of 15F9 includes residues R6, N8, E97, H99, El 00, D 101, Nl 02, S103, Tl 04, R105, El 15, L178, R179 and R180.
  • the primary epitope of 16A8 includes residues W230, D232, T227, Q228, Q229, S224, H225 and D226 of MICA.
  • the primary epitope of 14B4 includes T227, Q228, Q229, and thus overlaps with 16A8.
  • This sequence defines a region in the MIC proteins that interacts with the disulfide isomerase ERp5 and is believed required for proteolytic processing of membrane bound MIC to produce soluble MIC proteins.
  • Antibodies that bind specifically to the NGTYQT (SEQ ID NO:51) epitope inhibits the interaction of MIC protein and ERp5, thereby inhibiting the production of soluble MIC proteins (see, e.g., U.S. Patent No. 8,182,809).
  • the epitope In order for the antibody to bind, the epitope must be exposed to the solution environment in the membrane bound MIC protein, and thus not considered a cryptic epitope as described herein.
  • monoclonal antibodies designated 2C10, 6D4, 6G6, and 3H5 are also excluded from the scope of the present disclosure.
  • Monoclonal antibodies 2C10, 6D4, 6G6 and 3H5 were generated using cells expressing full length MICA protein as an immunogen.
  • SR99, SRI 04 and SRI 16 monoclonal antibodies designated as SR99, SRI 04 and SRI 16, as well as antibodies with the corresponding CDR sequences, as described in Hue et al, 2003, J Immunol. 171 : 1909- 1917 and Hue S, et al., 2004, Immunity 21 :367-377.
  • the SR99, SRI 04 and SRI 16 antibodies were selected for binding to MICA protein expressed on surface of cells, and therefore a selection that should not identify antibodies that bind cryptic epitopes, including the cryptic epitopes specifically described herein.
  • the isolated antibody with the relevant properties can be polyclonal, monoclonal, non-human, chimeric, humanized, or fully human antibody.
  • the antibody can be monospecific (i.e., binds to single epitope - monovalent) or multi-specific (i.e., binds to more than a single epitope - multivalent), including bispecific and trispecific antibodies (see, e.g., Sharkey et al., 2010, Cancer Biother Radiopharm. 25(1): 1-12); U.S. patent publication 20080069820; incorporated herein by reference).
  • the antibody can be a single chain antibody or diabodies, which are small bivalent and bispecific antibody fragments.
  • the antibody can comprise a non-human antibody, such as prepared from goat, horse, cow, chicken, camel, llamas, rabbit, rat, or mouse, or a chimeric or humanized antibody based on the non-human antibody.
  • K A equilibrium association constant or the ratio of association rate constant OK /dissociation rate constant k 0 g
  • the binding agent has a K A of at least about 1 x 10 7 M " 1 or higher, at least about 1 x 10 8 M 4 or higher, at least about 1 x 10 9 M 4 or higher, at least about 1 x 10 10 M 4 or higher, at least about 1 x 10 11 M 4 or higher, or at least about 1 x 10 12 M 4 or higher.
  • the antibody has a K A of the antibody 1F5 or antibody 8C7 described herein.
  • the antibody has a K A of about 1 xlO 9 M 4 to about 1 x 10 10 M 4 or higher (e.g., affinity of antibody 1F5).
  • the antibody has a K A or about 1 x 10 8 M 4 to about 1 x 10 9 M 4 or higher (e.g., affinity of antibody 8C7).
  • K D equilibrium dissociation constant or ratio of dissociation rate constant ⁇ /association rate constant k on
  • the binding agent has a K A of about 1 x 10 "7 M or less, about 1 x 10 "8 M or less, about 1 x 10 "9 M or less, about 1 x 10 40 M or less, about 1 x 10 41 M or less, or about 1 x 10 42 M or less.
  • the antibody has a K D of the antibody 1F5 or antibody 8C7 described herein.
  • the antibody has a K D of about 1 x 10 "9 M to about 1 x 10 40 M or less (antibody 1F5).
  • the antibody has a K D of about 5 x 10 "9 M to about 1 x 10 40 M or less (antibody 8C7).
  • the antibody is characterized by a k on association rate constant for the sMICA and/or sMICB protein, or the alpha-3 domain thereof, in the range of about 10 3 to about 10 9 M s " 1 or greater, about 10 4 to about 10 9 M s 4 or greater, about 10 5 to about 10 9 M s 4 or greater, about 10 6 to about 10 9 M s 4 or greater, about 10 7 to about 10 9 M s 4 or greater, about 10 4 to about 10 8 M s 4 or
  • the binding agent has a k on association rate constant of at least about 1 x 10 3 M s 4 or greater, at least about 1 x 10 4 M s 4 or greater, at least about 1 x 10 5 M s 4 or greater, at least about 1 x 10 6 M s 4 or greater, at least about 1 x 10 7 M s 4 or greater, at least about 1 x 10 8 M s 4 or greater, or at least about 1 x 10 9 M s 4 or greater.
  • the antibody has a k on association rate constant for MICA characteristic of the antibody 1F5 or antibody 8C7 described herein.
  • the antibody of the disclosure is characterized by a k of f dissociation rate
  • the binding agent has a ⁇ dissociation rate constant of about 10 "3 s 4 or less, about 10 "4 s 4 or less, about 10 "5 s 4 or less, about 10 "6 s 4 or less, about 10 "7 s 4 or less, about 10 "8 s 4 or less, about 10 "9 s 1 or less or about 10 "10 s or less.
  • the antibody has a k 0 ff dissociation rate constant for MICA characteristic of the antibody 1F5 or antibody 8C7 described herein.
  • the K A or K D as well as the k on and k 0 ff rate constants can be determined by surface plasmon resonance (SPR) screening, such as by analysis with a BIAcoreTM SPR analytical device, as described in Popov et al., 1996, Mol Immunol. 33:493-502; and Karlsson et al., 1991, J Immunol. Methods 145:229-40, incorporated herein by reference.
  • SPR surface plasmon resonance
  • the K A or K D as well as the k on and Aerate constants can be determined by Bio-Layer Interferometry (BLI), which is based on interference pattern of white light reflected from two surfaces (see, e.g., Rich and Myszka, 2007, Anal Biochem. 361 : 1-6; Fransson et al., 2010, J Mol Biol. 398(2):214-31) and commercially available as Octet RED96 (ForteBio, Menlo Park, CA, USA).
  • BBI Bio-Layer Interferometry
  • Other methods for determining affinity and kinetic parameters include equilibrium dialysis and globulin precipitation (see, e.g., Azimzadeh et al., 1990, J Mol Recognit. 3(3): 108-16).
  • the antibody comprises the antigen binding characteristics of antibody 1F5 or antibody 8C7, described herein and in the Examples. These antibodies bind specifically to the alpha-3 domain of MICA but do not bind to membrane bound MICA expressed in cells. Accordingly, in some embodiments, the antibody comprises a CDR LI, CDR L2, and CDR L3 in the light chain variable region amino acid sequence comprising:
  • the antibody comprises a CDR LI, CDR L2, and CDR L3 in the light chain variable region amino acid sequence comprising:
  • the amino acid position/boundary delineating the CDR regions of an antibody can vary, depending on the context and the various definitions known in the art. Some positions within the variable regions can be viewed as hybrid CDRs in that the positions can be within a CDR region under one set of criteria while being deemed to be outside a CDR region under a different set of criteria.
  • the CDRs in the foregoing variable light and variable heavy chains can be delineated using the Kabat, Chothia, or AbM schemes, as described herein, in particular based on the Kabat numbering system.
  • exemplary CDRs are represented in Table I.
  • the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs in the light chain variable region of amino acid sequence of SEQ ID NO:23 and the heavy chain variable region of amino acid sequence of SEQ ID NO:27. In some embodiments, the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence
  • RASKSVSTSGYSYMH (SEQ ID NO:83); CDR L2 comprising an amino acid sequence RASNLES (SEQ ID NO:84); CDR L3 comprising an amino acid sequence QHSRELPLT (SEQ ID NO:85); CDR HI comprising an amino acid sequence DYSVH (SEQ ID NO:89), GYTFTDY (SEQ ID NO:95) or GYTFTDYSVH (SEQ ID NO:99); CDR H2 comprising an amino acid sequence
  • WINTETGEPTYADDFKG SEQ ID NO: 90
  • NTETG SEQ ID NO: 96
  • WINTETGEP SEQ ID NO: 100
  • CDR H3 comprising an amino acid sequence AGGNAFAY
  • the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs in the light chain variable region of amino acid sequence of SEQ ID NO: 31 and the heavy chain variable region of amino acid sequence of SEQ ID NO:35. In some embodiments, the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence
  • RS SKSLLQ SNGNTFLY (SEQ ID NO:86); CDR L2 comprising an amino acid sequence RMSNLAS (SEQ ID NO:87); CDR L3 comprising an amino acid sequence MQHLEYPFT (SEQ ID NO:88); CDR HI comprising an amino acid sequence NYGMN (SEQ ID NO:92), GYTFTNY (SEQ ID NO:97) or GYTFTNYGMN (SEQ ID NO: 101); CDR H2 comprising an amino acid sequence
  • WINTNTGEPTYAEEFKG (SEQ ID NO:93), NTNTG (SEQ ID NO:98) or WINTNTGEP (SEQ ID NO: 102); and CDR H3 comprising an amino acid sequence SGGSSPFAY (SEQ ID NO:94).
  • the antibody comprises a CDR LI comprising an amino acid sequence RASKSVSTSGYSYMH (SEQ ID NO:83); a CDR L2 comprising an amino acid sequence RASNLES (SEQ ID NO:84); a CDR L3 comprising an amino acid sequence QHSRELPLT (SEQ ID NO:85); a CDR HI comprising an amino acid sequence DYSVH (SEQ ID NO:89), GYTFTDY (SEQ ID NO:95) or GYTFTDYSVH (SEQ ID NO:99); a CDR H2 comprising an amino acid sequence
  • WINTETGEPTYADDFKG SEQ ID NO:90
  • NTETG SEQ ID NO:96
  • WINTETGEP SEQ ID NO: 100
  • CDR H3 comprising an amino acid sequence AGGNAFAY
  • the antibody comprises a CDR LI comprising an amino acid sequence RASKSVSTSGYSYMH (SEQ ID NO:83); a CDR L2 comprising an amino acid sequence RASNLES (SEQ ID NO:84); a CDR L3 comprising an amino acid sequence QHSRELPLT (SEQ ID NO:85); a CDR HI comprising an amino acid sequence DYSVH (SEQ ID NO:89); a CDR H2 comprising an amino acid sequence WINTETGEPTYADDFKG (SEQ ID NO:90); and a CDR H3 comprising an amino acid sequence AGGNAFAY (SEQ ID NO:91).
  • the antibody comprises a CDR LI comprising an amino acid sequence RS SKSLLQ SNGNTFLY (SEQ ID NO:86); a CDR L2 comprising an amino acid sequence RMSNLAS (SEQ ID NO:87); a CDR L3 comprising an amino acid sequence MQHLEYPFT (SEQ ID NO:88); a CDR HI comprising an amino acid sequence NYGMN (SEQ ID NO:92), GYTFTNY (SEQ ID NO:97), or GYTFTNYGMN (SEQ ID NO: 101); a CDR H2 comprising an amino acid sequence
  • WINTNTGEPTYAEEFKG (SEQ ID NO:93), NTNTG (SEQ ID NO:98), or WINTNTGEP (SEQ ID NO: 102); and a CDR H3 comprising an amino acid sequence SGGSSPFAY (SEQ ID NO:94).
  • the antibody comprises a CDR LI comprising an amino acid sequence RS SKSLLQ SNGNTFLY (SEQ ID NO:86); a CDR L2 comprising an amino acid sequence RMSNLAS (SEQ ID NO:87); a CDR L3 comprising an amino acid sequence MQHLEYPFT (SEQ ID NO:88); a CDR HI comprising an amino acid sequence NYGMN (SEQ ID NO:92); a CDR H2 comprising an amino acid sequence WINTNTGEPTYAEEFKG (SEQ ID NO:93); and a CDR H3 comprising an amino acid sequence SGGSSPFAY (SEQ ID NO:94).
  • the CDR sequence may have one or more amino acid substitutions, deletions, and/or insertions, provided the antibody retains the relevant functional properties, e.g., of binding specifically to the alpha 3 domain, or the cryptic epitopes thereof, of MICA and/or MICB.
  • the CDR sequence has at least 1, 2, 3, 4, 5 or more amino acid substitutions, deletions, and/or insertions.
  • the substitution comprises a conservative substitution.
  • the antibody comprises a light chain variable region VL having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:23.
  • the antibody comprises a light chain variable region VL having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:31.
  • the antibody comprises a heavy chain variable region VH having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:27.
  • the antibody comprises a heavy chain variable region VH having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:35.
  • the antibody comprises a light chain variable region VL having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:23, and a heavy chain variable region VH having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:27.
  • the antibody comprises a light chain variable region VL having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:31, and a heavy chain variable region VH having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence SEQ ID NO:35.
  • the antibody with the defined level of amino acid sequence identity to the light chain variable region has one or more amino acid substitutions, deletions and/or insertions as compared to the VL reference sequence of SEQ ID NO:23 or SEQ ID NO:31.
  • the antibody comprises 1, 2, 3, 4, 5 or more amino acid substitutions, deletions, and/or insertions as compared to the light chain variable region reference sequence.
  • the substitutions comprise conservative amino acid substitutions.
  • the conservative substitutions are present on the framework regions (non-CDR regions: FR L 1, FR L 2, FR L 3 and FR L 4) of the light chain variable region reference sequence.
  • the antibody with the defined level of amino acid sequence identity to the heavy chain variable region has one or more amino acid substitutions, deletions and/or insertions as compared to the VH reference sequence of SEQ ID NO:27 or SEQ ID NO:35.
  • the antibody comprises 1, 2, 3, 4, 5 or more amino acid substitutions, deletions, and/or insertions as compared to the heavy chain variable region reference sequence.
  • the substitutions comprise conservative amino acid substitutions.
  • the conservative substitutions are present on the framework regions (non-CDR regions: FR H 1, FR H 2, FR H 3 and FR H 4) of the heavy chain variable region reference sequence.
  • the antibody comprises a light chain variable region VL comprising an amino acid sequence of SEQ ID NO:23 and a heavy chain variable region VH comprising an amino acid sequence of SEQ ID NO:27.
  • the antibody comprises a light chain variable region VL comprising an amino acid sequence of SEQ ID NO:31 and a heavy chain variable region VH comprising an amino acid sequence of SEQ ID NO:35.
  • the antibody with any of the specified antigen binding domains can comprise any suitable framework variable region sequence, provided the functional properties of the antigen binding domain in binding to sMICA and/or sMICB, or the alpha-3 domain thereof, are maintained.
  • the framework sequences are those of rodent variable light chain and heavy chain framework sequences, in particular mouse framework sequences.
  • the framework sequences of the antibody are those of a human heavy chain consensus framework sequence.
  • VH consensus framework sequences include: human VH subgroup I consensus framework (SEQ ID NO: 103); human VH subgroup II consensus framework (SEQ ID NO: 104); human VH subgroup III consensus framework (SEQ ID NO: 105); and human VH subgroup VII consensus framework (SEQ ID NO: 106) (FIG. 8).
  • the framework sequences of the antibody comprise a human ⁇ light chain consensus framework sequence.
  • VL consensus framework sequences include: human VL kappa subgroup I consensus framework (SEQ ID NO: 107); human VL kappa subgroup II consensus framework (SEQ ID NO: 108); human VL kappa subgroup III consensus framework (SEQ ID NO: 109); and human VL kappa subgroup IV consensus framework (SEQ ID NO: 1 10) (FIG. 8).
  • the antibody with any of the specified antigen binding domains can have a constant domain on the light chain and/or the heavy chain of any origin.
  • the constant domain can be that of rodent, primate, or other mammals.
  • the constant domain is of human origin.
  • the antibody with any of the specified antigen binding domains above can have a human constant region, for example, a human light chain constant region CL and/or a human heavy chain constant region.
  • the human light chain constant region CL comprises a human kappa or human lambda constant region.
  • the human heavy chain constant region comprises at least one or all of the following: a human CHI, human Hinge, human CH2 and human CH3 domain.
  • the heavy chain constant region comprises an Fc portion, where the Fc portion is a human IgGi, IgG 2 , IgG 3 , IgG 4 or IgM isotype.
  • the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence RASKSVSTSGYSYMH (SEQ ID NO:83); CDR L2 comprising an amino acid sequence RASNLES (SEQ ID NO: 84); CDR L3 comprising an amino acid sequence QHSRELPLT (SEQ ID NO:85); CDR HI comprising an amino acid sequence DYSVH (SEQ ID NO:89), GYTFTDY (SEQ ID NO:95), or GYTFTDYSVH (SEQ ID NO:99); CDR H2 comprising an amino acid sequence WINTETGEPTYADDFKG (SEQ ID NO: 90), NTETG (SEQ ID NO: 96), or WINTETGEP (SEQ ID NO: 100); and CDR H3 comprising an amino acid sequence AGGNAFAY (SEQ ID NO:91); and a human light chain constant region of human kappa or lambda; and/or a human heavy chain
  • the antibody can comprise human framework sequences in the variable regions.
  • the heavy chain constant region comprises an Fc portion, where the Fc portion is a human IgGi, IgG 2 , IgG 3 , IgG 4 or IgM isotype.
  • the antibody comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence RSSKSLLQSNGNTFLY (SEQ ID NO:86); CDR L2 comprising an amino acid sequence RMSNLAS (SEQ ID NO:87); CDR L3 comprising an amino acid sequence MQHLEYPFT (SEQ ID NO: 88); CDR HI comprising an amino acid sequence NYGMN (SEQ ID NO:92), GYTFTNY (SEQ ID NO:97) or GYTFTNYGMN (SEQ ID NO: 101); CDR H2 comprising an amino acid sequence WINTNTGEPTYAEEFKG (SEQ ID NO:93), NTNTG (SEQ ID NO:98) or WINTNTGEP (SEQ ID NO: 102); and CDR H3 comprising an amino acid sequence SGGSSPFAY (SEQ ID NO:94); and a human light chain constant region (CL) of human kappa or lambda; and/or
  • the antibody can comprise human framework sequences in the variable regions.
  • the heavy chain constant region comprises an Fc portion, where the Fc portion is a human IgGi, IgG 2 , IgG 3 , IgG 4 or IgM isotype.
  • the antibody comprises a light chain variable region VL comprising an amino acid sequence of SEQ ID NO:23; a heavy chain variable region VH comprising an amino acid sequence of SEQ ID NO:27; a human light chain constant (CL) region of human kappa or lambda; and a human heavy chain constant region, in particular a human heavy chain constant region comprising human CHI, human Hinge, human CH2 and human CH3 domain.
  • the heavy chain constant region comprises an Fc portion, where the Fc portion is a human IgGi, IgG 2 , IgG 3 , IgG 4 or IgM isotype.
  • the antibody comprises a light chain variable region VL comprising an amino acid sequence of SEQ ID NO:31 ; a heavy chain variable region VH comprising an amino acid sequence of SEQ ID NO:35; a human light chain constant region (CL) of human kappa or lambda, and a human heavy chain constant region, in particular a human heavy chain constant region comprising human CHI, human Hinge, human CH2 and human CH3 domain.
  • the heavy chain constant region comprises an Fc portion, where the Fc portion is a human IgGi, IgG 2 , IgG 3 , IgG 4 or IgM isotype.
  • the antibody of the disclosure comprises an antibody or antigen binding fragment which competes for binding to sMICA and/or sMICB, or the alpha-3 domain thereof, with an antibody comprising the antigen binding domain of antibody 1F5, or an antibody comprising the antigen binding domain of antibody 8C7.
  • the antibody of the disclosure competes for binding to MICA and/or MICB with an antibody comprising: the VL region of SEQ ID NO:23 and a VH region of SEQ ID NO:27.
  • the antibody of the disclosure competes for binding to sMICA and/or sMICB, or the alpha-3 domain thereof, with an antibody comprising: the VL region of SEQ ID NO: 31 and a VH region of SEQ ID NO:35.
  • Competition between antibodies can be determined by an assay in which the antibody of interest or candidate antibody inhibits specific binding of a reference antibody to a common antigen, e.g., alpha-3 domain of MICA or the cryptic epitopes in the alpha-3 domain.
  • RIA solid phase direct or indirect radioimmunoassay
  • EIA solid phase direct or indirect enzyme immunoassay
  • sandwich competition assay solid phase direct biotin-avidin EIA
  • solid phase direct labeled assay solid phase direct labeled sandwich assay
  • the antibody presented herein is cross-reactive with sMICA and sMICB proteins, and in particular, cross-reactive with the alpha-3 domain of the sMICA and the alpha-3 domain of the sMICB protein. That is, in some embodiments, the antibody is capable of binding specifically to the sMICA protein and to the sMICB protein. As noted above, these antibodies do not bind specifically to full length MICA and full length MICB, or the extracellular domain of membrane bound form of MICA and membrane bound form of MICB.
  • the cross-reactive antibody binds to a common epitope (e.g., cryptic epitope) on the MICA and MICB proteins.
  • a common epitope e.g., cryptic epitope
  • Exemplary epitopes common between MICA and MICB includes: 217 RQDGV 221 , located on the lower side of alpha-3 domain of MICA and MICB (SEQ IDNO:39 and SEQ ID NO:44); 234 LPDGN 238, located near the top of the alpha-3 domain of MICA and MICB (SEQ ID NO:40 and SEQ ID NO:45); and the sequence common between 251 QGEEQR 256 of MICA (SEQ ID NO:41) and 250 RQGEEQR 256 of MICB (SEQ ID NO:46), located on the bottom of the alpha-3 domain.
  • the antibody comprises a multimeric antibody containing three or more binding sites, for example an IgM isotype or a synthetically generated multimeric antibody.
  • IgM antibodies generally have four, five or six units of bivalent binding units, i.e., two heavy chains and two light chains assembled into a tetramer, pentamer and/or hexamer.
  • the IgM antibody may or may not have a J chain. Expression of IgM without a J chain forms predominantly hexamers while expression of IgM with J chains forms predominantly pentamers.
  • the multimeric antibodies would promote efficient binding to sMICA and/or sMICB due in part to high avidity resulting from the higher number of antigen binding sites.
  • IgM antibodies can be obtained by isolating IgM antibodies from immunized animals, by isolating monoclonal antibody producing cell lines (e.g., hybridoma cell lines, etc.) expressing IgM isotype antibody, or transfection/transformation of appropriate cell lines (e.g., CHO, COS, 3T3, PC12, BHK, Vero, C6 glioma, and HeLa) with nucleic acids encoding an IgM antibody or IgM variable heavy and variable light chains, with or without J chains (see, e.g., Azuma et al., 2007, Clin Cancer Res. 13:2745-50; Mader et al., 2013, Advances in Biosci Biotech. 4:38-43; U.S. Patent No.
  • an initially isolated IgG antibody can be class switched to the IgM isotype by expression in appropriate cells lines.
  • Kunert et al., 2004, AIDS Res Hum Retroviruses, 20:755-62 and Wolbank et al., 2003, J Virol. 77:4095-103 describe switching of IgG monoclonal antibodies to IgM isotype.
  • multimeric antibodies can be generated using single chain antibodies or antibody fragments produced as multimeric antibodies (see, e.g., Power et al., 2003, Methods Mol Biol. 207:335-50; Gail et al., 1999, FEBS Lett. 453(l-2): 164-8).
  • the IgM or single chain multimeric antibodies can be purified by techniques known in the art, such as gel filtration chromatography, ion exchange chromatography (e.g., hydroxyapatite), and affinity chromatography (see, e.g., Valasek et al., 201 1, BioProcess Int'l. 9(1 1):28-37; Gagnon et al., 2008, BioPharm Int'l. S26-S36).
  • the multimeric antibodies can comprise 50% or more hexamer, 60% or more pentamer, or particularly 80% or more pentamer or hexamer IgM molecule.
  • the IgM or multimeric antibody comprises an antibody binding domain described above, including the various combinations of the CDRs or variable regions of antibody 1F5 or 8C7.
  • the binding agent can be a fragment of the antibody of the present disclosure, including portions of the full length antibody, and includes the antigen binding or variable region.
  • Exemplary antibody fragments include Fab, Fab', F(ab')2 and Fv fragments.
  • Proteolytic digestion with papain produces two identical antigen binding fragments, the Fab' fragment, each with a single antigen binding site.
  • Proteolytic digestion with pepsin yields an F(ab')2 fragment that has two antigen binding fragments which are capable of cross-linking antigen, and a residual pFc' fragment.
  • Other types of fragments can include diabodies, linear antibodies, single-chain antibodies, and multispecific antibodies formed from antibody fragments.
  • the antibody fragments are functional in that they retain the desired binding properties, e.g., specific binding to cryptic epitopes in the alpha-3 domain of MICA and/or MICB.
  • the antibodies herein can be labeled with a variety of labels, including reporter molecules and detectable labels, such as fluorophores, bioluminescent moieties, luminescent moieties, enzymes, radiolabels, and prosthetic groups.
  • labels include reporter molecules and detectable labels, such as fluorophores, bioluminescent moieties, luminescent moieties, enzymes, radiolabels, and prosthetic groups.
  • exemplary enzymes include, among others, horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, and acetylcholinesterase.
  • Exemplary prosthetic groups include, among others, streptavidin/biotin and digoxigenin.
  • Exemplary fluorophores include, among others, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, Texas Red and phycoerythrin.
  • Exemplary luminescent label includes luminal.
  • Exemplary bioluminescent labels include luciferase, luciferin, and aequorin.
  • Exemplary radiolabels include, among others, 125 I, 131 1, 35 S, 211 At, 90 Y, 186 Re, 188 Re, 14 C, 225 Ac, 212 Bi, 227 Ac, 194 0s, 223 Ra, 149 Tb, and 3 H.
  • the antibody of the disclosure can be conjugated to an effector moiety.
  • the effector moiety includes, among others, antineoplastic agents, drugs, toxins, biologically active proteins, other antibody or antibody fragments, synthetic or naturally occurring polymers, nucleic acids (e.g., DNA and RNA), chelated metals, and nanoparticles.
  • the anti-sMICA or anti-sMICB antibodies can be conjugated to an effector moiety, such as a cytotoxic agent, a radionuclide or drug moiety to modify a given biological response.
  • the effector moiety can be a protein or polypeptide, such as, for example and without limitation, a toxin (e.g., abrin, ricin A, Pseudomonas exotoxin, or Diphtheria toxin), a thrombotic agent or an anti-angiogenic agent (e.g., angiostatin or endostatin), or a biological response modifier such as a cytokine or growth factor (e.g., interleukin-I (IL-I), interleukin-2 (IL-2), interleukin-6 (IL-6), granulocyte macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), or nerve growth factor (NGF)).
  • a toxin e.g., abrin, ricin A, Pseudomonas exotoxin, or Diphtheria toxin
  • a thrombotic agent or an anti-angiogenic agent e.
  • the effector moieties can be cytotoxins or cytotoxic agents.
  • cytotoxins and cytotoxic agents include taxol, chlorambucil, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, teniposide, vincristine, vinblastine, colchicine, doxorubicin, daunorubicin, dihydroxyanthracenedione, mitoxantrone, mithramycin, actinomycin D, I- melphalan, puromycin, and analogs or homologs thereof.
  • the antibodies of the present disclosure can be attached to polyethylene glycol (PEG) moieties.
  • the antibody is an antibody fragment.
  • the PEG moieties can be attached through any available amino acid side-chain or terminal amino acid functional group located in the antibody or antibody fragment, for example any free amino, imino, thiol, hydroxyl or carboxyl group. Such amino acids can occur naturally in the antibody or antibody fragment or can be engineered into the antibody or fragment using recombinant DNA methods. Multiple sites can be used to attach two or more PEG molecules.
  • PEG moieties can be covalently linked through a thiol group of at least one cysteine residue located in the antibody or fragment.
  • thiol selective derivatives such as maleimides and cysteine derivatives
  • thiol selective derivatives such as maleimides and cysteine derivatives
  • the antibodies can be prepared as a pharmaceutical composition for treating a disease or disorder associated with elevated levels of MIC protein, as further described below.
  • pharmaceutical compositions comprising an isolated antibody, including a combination of two or more antibodies, that bind specifically to a cryptic epitope of MICA and/or MICB protein, particularly a cryptic epitope of the alpha-3 domain; and a pharmaceutically acceptable excipient, carrier, or vehicle that are compatible with the antibody preparations.
  • Therapeutic formulations of the antibodies can be prepared for storage as lyophilized formulations or as aqueous solutions by mixing the antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers typically employed in the art (all of which are referred to herein as "carriers"), including, for example, buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives (see, e.g., Remington: The Science and Practice of Pharmacy, 19th Ed., Volumes 1 and 2, Pharmaceutical Press (2012); and Formulation and Process Development Strategies for Manufacturing Biopharmaceuticals, Jameel, F. and Hershenson, S. eds. Wiley (2010); incorporated herein by reference). Such additives are nontoxic to the recipients at the dosages and concentrations employed.
  • Buffering agents help to maintain the pH in the range which approximates physiological conditions.
  • Suitable buffering agents for use with the binding agents of the present disclosure include both organic and inorganic acids and salts thereof such as citrate buffers, succinate buffers, tartrate buffers, fumarate buffers, gluconate buffers, oxalate buffers, lactate buffers, and acetate buffers.
  • phosphate buffers histidine buffers and trimethylamine salts such as Tris can be used.
  • the carrier comprises a preservative to retard microbial growth, and can be present in amounts ranging from 0.2%- 1 % (w/v).
  • Suitable preservatives for use with antibody preparations include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben,
  • octadecyldimethylbenzyl ammonium chloride e.g., benzalkonium halides (e.g., chloride, bromide, and iodide), hexamethonium chloride, and alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
  • the carrier comprises isotonicifiers, sometimes referred to as "stabilizers" to ensure isotonicity of liquid compositions, examples of which include polyhydric sugar alcohols, for example trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.
  • Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive that solubilizes the therapeutic agent or helps prevent denaturation or adherence to the container wall.
  • Exemplary stabilizers can be polyhydric sugar alcohols (enumerated above); amino acids such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2- phenylalanine, glutamic acid, threonine, etc.; organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myo-inositol, galactitol, glycerol and the like, including cyclitols such as inositol; polyethylene glycol; amino acid polymers; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, monothioglycerol and sodium thio sulfate; low mole
  • stabilizers can be present in the range from 0.1 to 10,000 weight per part of weight active protein.
  • Non-ionic surfactants or detergents sometimes referred to as "wetting agents" can be added to help solubilize the therapeutic agent and protect the therapeutic protein against agitation-induced aggregation, which also permits the formulation to be exposed to surface shear stress without causing denaturation of the protein.
  • Suitable non-ionic surfactants include polysorbates (20, 80, etc.), poloxamers (184, 188, etc.), pluronic polyols, and polyoxyethylene sorbitan mono ethers (TWEEN ® -20, TWEEN ® - 80, etc.).
  • non-ionic surfactants can be present in a range of about 0.05 mg/mL to about 1.0 mg/mL, for example about 0.07 mg/mL to about 0.2 mg/mL.
  • Additional miscellaneous excipients include bulking agents (e.g., starch), chelating agents (e.g., EDTA), antioxidants (e.g., ascorbic acid, methionine, vitamin E), and cosolvents.
  • bulking agents e.g., starch
  • chelating agents e.g., EDTA
  • antioxidants e.g., ascorbic acid, methionine, vitamin E
  • cosolvents e.g., ascorbic acid, methionine, vitamin E
  • Sterile injectable solutions of can be prepared by incorporating the antibody in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization, such as by microfiltration.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above and known in the art.
  • the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the antibodies can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, poly(orthoesters), and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art (see, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York (1978)).
  • compositions will use standard conventional techniques applicable to antibody therapeutics (see, e.g., Wang et al., 2007, J Pharm Sci. 96(1): 1-26; Remington: The Science and Practice of Pharmacy, 19th Ed., Volumes 1 and 2, Pharmaceutical Press (2012); and Formulation and Process Development Strategies for Manufacturing Biopharmaceuticals, Jameel and Hershenson, eds., Wiley (2010)).
  • the binding agents of the present disclosure can be prepared by various techniques available to the skilled artisan.
  • the preparation of polyclonal antibodies can employ conventional procedures well- known to those skilled in the art, for example, Green et al., "Production of Polyclonal Antisera,” in: Immunochemical Protocols, Manson, ed., Humana Press (1992); Coligan et al., "Production of Polyclonal Antisera in Rabbits, Rats Mice and Hamsters," in: Current Protocols in Immunology, John Wiley & Sons, Inc. (1992), which are hereby incorporated herein by reference.
  • Monoclonal antibodies are most frequently generated in mice by administration of the "antigen” and subsequent isolation of B-cells that make antibodies.
  • the B-cells are then immortalized by fusion to another, stable cell type of the same species of the B-cell to create a "hybridoma".
  • An individual B-cell makes one specific antibody (i.e., is clonally monospecific) which is defined by its primary amino acid sequence and its underlying gene sequence. Also, the terms
  • heterohybridoma and heteromyeloma refer to lymphocyte cell lines immortalized by fusion of lymphocytes and myelomas from two different species.
  • Monoclonal antibodies can be isolated and purified from hybridoma cultures by a variety of well-established techniques. Such isolation techniques include affinity chromatography with Protein-A Sepharose, size-exclusion chromatography, and ion- exchange chromatography (see, e.g., Coligan, et al., supra, sections 2.7.1-2.7.12 and sections 2.9.1-2.9.3; Barnes, et al., Purification of Immunoglobulin G (IgG), in Methods Mol. Biol., Vol. 10, pages 79- 104, Humana Press (1992)).
  • An exemplary method for preparing antibodies is described in the Examples.
  • the generation of monoclonal antibodies can be achieved using immunogens derived from DNA, peptides, or proteins.
  • Hybridomas are generated by immunizing an animal, which can be for example, a mouse or rabbit, or any animal that will give a suitable antibody response.
  • immunization is performed by introducing into the animal an antigen- encoding nucleic acid, or a protein antigen, such as MICA/MICB or a fragment thereof (e.g., alpha-3 domain), or a nucleic acid encoding MICA/MICB or an immunogenic fragment thereof.
  • MICA/MICB protein antigen
  • a fragment thereof e.g., alpha-3 domain
  • a peptide corresponding to an epitope of an antigen conjugated to a carrier such as keyhole limpet hemocyanin may elicit a stronger antibody response than either the peptide alone or the epitope when part of the native protein on which it is found.
  • a carrier such as keyhole limpet hemocyanin
  • Chimeric antibodies which are antibodies having variable sequences derived from a non- human immunoglobulin, such as rat or mouse antibody, and in some embodiments, human immunoglobulin constant regions, typically chosen from a human immunoglobulin template, can also be prepared by conventional techniques.
  • One method is to clone the non-human genes encoding the variable regions and the human genes encoding the constant regions and recombine them using recombinant techniques to form a chimeric gene. Expression in appropriate cells produces an mRNA encoding the chimeric protein.
  • An alternative process is to use homologous recombination, where a rodent or mouse hybridoma cell line is transfected with a human constant region gene flanked by sequences homologous to the corresponding rodent immunoglobulin constant region gene. At a low frequency the transfected DNA will recombine with the rodent gene resulting in the insertion of the human immunoglobulin constant region gene sequence.
  • Various methods for producing chimeric antibodies are described in Morrison et al., 1984, Proc Natl Acad Sci USA.
  • the antibodies herein can be prepared as humanized antibodies, which are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other target-binding sub domains of antibodies) which contain minimal sequences derived from non- human immunoglobulin.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence.
  • the humanized antibody can also comprise at least a portion or all of an immunoglobulin constant region, typically that of a human immunoglobulin consensus sequence.
  • Methods of antibody humanization are known in the art, and are described in, for example, Riechmann et at, 1988, Nature 332:323-7; U.S. Patent No. 5,225,539; U.S. Patent No. 5,530, 101 ; U.S. Patent No. 5,585,089; U.S. Patent No. 5,565,332; U.S. Patent No. U.S. Patent No. 5,693,761 ; U.S. Patent No. 5,693,762; and U.S. Patent No.
  • Fully human antibodies can be generated using transgenic or trans-chromosomic animals carrying parts of the human immune system rather than the host animal system.
  • transgenic and trans-chromosomic animals include mice referred to as HuMAb mice and KM mice.
  • the HuMAb mouseTM (Medarex, Inc.) contains human immunoglobulin gene miniloci that encode un-rearranged human heavy (mu and gamma) and kappa light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous mu and kappa chain loci (see, e.g., Lonberg et al., 1994, Nature 368(6474):856-9).
  • mice exhibit reduced expression of mouse IgM or kappa, and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG kappa monoclonal antibodies (Lonberg, N., 1994, Handbook of Experimental Pharmacology 1 13:49- 101 ; Lonberg, N. and Huszar, D., 1995, Intern Rev Immunol . 13:65-93; and Harding, F. and Lonberg, N., 1995, Ann NY Acad Sci.
  • HuMAb mice The preparation and use of HuMAb mice, and the genomic modifications carried by such mice, are further described in Tuaillon et al., 1994, J Immunol. 152:2912-20; Taylor et al., 1994, International Immunology 6:579-91 ; Fishwild et al., 1996, Nature Biotech. 14:845-51 ; U.S. Patent No. 5,545,806; U.S. Patent No. U.S. Patent No. 5,569,825; U.S. Patent No. 5,625, 126; U.S. Patent No.
  • human antibodies that specifically bind to the epitopes can be raised using a mouse that carries human immunoglobulin sequences on transgenes and trans-chromosomes, such as a mouse that carries a human heavy chain transgene and a human light chain trans-chromosome, as described in WO 02/043478.
  • a rabbit system expressing human immunoglobulin genes that can be used to generate fully human antibodies (Rader et al., 2000, J Biol Chem.
  • Fully human monoclonal antibodies can be prepared using phage display methods for screening libraries of human immunoglobulin genes.
  • phage display methods for isolating human antibodies are established in the art, and are described in, for example, Human
  • Single chain antibodies which are fusion proteins of the variable heavy chains and variable light chains of immunoglobulins, can be prepared by phage display methods, where the antigen binding domain is expressed as a single polypeptide and screened for specific binding activity.
  • the single chain antibody can be prepared by cloning the heavy and light chains from a cell, typically a hybridoma cell line expressing a desired antibody.
  • a linker peptide typically from 10 to 25 amino acids in length is used to link the heavy and light chains.
  • the linker can be glycine, serine, and/or threonine rich to impart flexibility and solubility to the single chain antibody.
  • Antibody fragments are also well known in the art (see, e.g., Antibodies: A Laboratory Manual, Harlow and Lane, eds., Cold Spring Harbor Laboratory, New York (1988), incorporated herein by reference).
  • Antibody fragments can be prepared by proteolytic hydrolysis of the antibody or by expression in E. coli. of DNA encoding the fragment.
  • Antibody fragments can be obtained by pepsin or papain digestion of whole antibodies.
  • antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab')2.
  • This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab' monovalent fragments.
  • a thiol reducing agent and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab' monovalent fragments.
  • an enzymatic cleavage using pepsin produces two monovalent Fab' fragments and an Fc fragment directly.
  • the isolated antibody can be further purified as measurable by: (1) weight of protein as determined using the Lowry method; (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning-cup sequencer; or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain.
  • chromatography e.g., affinity chromatography: Protein A, peptide epitope, etc; ion exchange chromatography; molecular sieve chromatograph; etc.
  • high performance liquid chromatography differential solubility, and the like (see, e.g., Fisher, Laboratory Techniques, In Biochemistry And Molecular Biology, Work and Burdon, eds., Elsevier (1980); Antibodies: A Laboratory Manual, Greenfield, E.A., ed., Cold Spring Harbor Laboratory Press, New York (2012)).
  • the purified antibody can be 85% or greater, 90% or greater, 95% or greater, or at least 99% by weight as determined by the foregoing methods.
  • polynucleotides that encode the antibodies or antigen binding regions of the present disclosure.
  • the polynucleotides are isolated polynucleotides.
  • the polynucleotides may be operatively linked to one or more heterologous control sequences that control gene expression to create a recombinant polynucleotide capable of expressing the polypeptide of interest.
  • Expression constructs containing a heterologous polynucleotide encoding the relevant polypeptide or protein can be introduced into appropriate host cells to express the corresponding polypeptide.
  • the polynucleotide encodes a light chain variable region VL having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:23.
  • the polynucleotide encodes a heavy chain variable region VH having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:27.
  • the polynucleotide encodes a light chain variable region VL having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:31.
  • the polynucleotide encodes a heavy chain variable region VH having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or greater sequence identity to the amino acid sequence of SEQ ID NO:35.
  • the polynucleotide encodes a light chain variable region VL comprising the amino acid sequence of SEQ ID NO:23. In some embodiments, the polynucleotide encodes a heavy chain variable region VH comprising the amino acid sequence of SEQ ID NO:27. In some embodiments, the polynucleotide encodes a light chain variable region VL comprising the amino acid sequence of SEQ ID NO: 31. In some embodiments, the polynucleotide encodes a heavy chain variable region VH comprising the amino acid sequence of SEQ ID NO:35.
  • the polynucleotide encodes one or more CDRs selected from: a CDR LI comprising an amino acid sequence of SEQ ID NO:83; CDR L2 comprising an amino acid sequence SEQ ID NO:84; CDR L3 comprising an amino acid sequence of SEQ ID NO:85; CDR HI comprising an amino acid sequence of SEQ ID NO:89; CDR HI comprising an amino acid sequence of SEQ ID NO:95; CDR HI comprising an amino acid sequence of SEQ ID NO:99; CDR H2 comprising an amino acid sequence of SEQ ID NO:90; CDR H2 comprising an amino acid sequence of SEQ ID NO:96; CDR H2 comprising an amino acid sequence of SEQ ID NO: 100; and CDR H3 comprising an amino acid sequence of SEQ ID NO:91.
  • the polynucleotide encodes one or more CDRs selected from: a CDR LI comprising an amino acid sequence of SEQ ID NO:86; CDR L2 comprising an amino acid sequence of SEQ ID NO:87; CDR L3 comprising an amino acid sequence of SEQ ID NO:88; CDR HI comprising an amino acid sequence of SEQ ID NO:92; CDR HI comprising an amino acid sequence of SEQ ID NO:97; CDR H 1 comprising an amino acid sequence of SEQ ID NO : 101 ; CDR H2 comprising an amino acid sequence of SEQ ID NO:93; CDR H2 comprising an amino acid sequence of SEQ ID NO:98; CDR H2 comprising an amino acid sequence of SEQ ID NO: 102; and CDR H3 comprising an amino acid sequence of SEQ ID NO:94.
  • the polynucleotide encodes at least 1, 2, 3, 4, 5 or all 6 of the CDRs in the light chain variable region of amino acid sequence of SEQ ID NO:23 and the heavy chain variable region of amino acid sequence of SEQ ID NO:27.
  • the polynucleotide encodes at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence of SEQ ID NO:83; CDR L2 comprising an amino acid sequence of SEQ ID NO:84; CDR L3 comprising an amino acid sequence of SEQ ID NO:85; CDR HI comprising an amino acid sequence of SEQ ID NO:89, SEQ ID NO:95, or SEQ ID NO:99; CDR H2 comprising an amino acid sequence of SEQ ID NO:90, SEQ ID NO:96, or SEQ ID NO: 100; and CDR H3 comprising an amino acid sequence of SEQ ID NO:91.
  • the polynucleotide encodes at least 1, 2, 3, 4, 5 or all 6 of the CDRs in the light chain variable region of amino acid sequence of SEQ ID NO: 31 and the heavy chain variable region of amino acid sequence of SEQ ID NO:35.
  • the polynucleotide encodes at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence of SEQ ID NO:86; CDR L2 comprising an amino acid sequence of SEQ ID NO:87; CDR L3 comprising an amino acid sequence of SEQ ID NO: 88; CDR HI comprising an amino acid sequence of SEQ ID NO: 92, SEQ ID NO: 97, or SEQ ID NO: 101 ; CDR H2 comprising an amino acid sequence of SEQ ID NO: 93, SEQ ID NO:98, or SEQ ID NO: 102; and CDR H3 comprising an amino acid sequence of SEQ ID NO:94.
  • the polynucleotide has at least about 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity at the nucleotide level to: (a) a reference polynucleotide sequence of SEQ ID NO:25, and encodes the polypeptide of SEQ ID NO:23, or (b) a reference polynucleotide sequence of SEQ ID NO:24, and encodes a polypeptide comprising residues 1 to 132 of SEQ ID NO:22.
  • the polynucleotide has at least about 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity at the nucleotide level to: (a) a reference polynucleotide sequence of SEQ ID NO:29, and encodes the polypeptide of SEQ ID NO:27, or (b) a reference polynucleotide sequence of SEQ ID NO:28, and encodes a polypeptide comprising residues 1 to 136 of SEQ ID NO:26.
  • the polynucleotide has about 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity at the nucleotide level to: (a) a reference polynucleotide sequence of SEQ ID NO:33, and encodes the polypeptide of SEQ ID NO:31, or (b) a reference polynucleotide sequence of SEQ ID NO:32, and encodes a polypeptide comprising residues 1 to 133 of SEQ ID NO:30.
  • the polynucleotide has about 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity at the nucleotide level to: (a) a reference polynucleotide sequence of SEQ ID NO: 37, and encodes the polypeptide of SEQ ID NO:35, or (b) a reference polynucleotide sequence of SEQ ID NO:36, and encodes a polypeptide comprising residues 1 to 137 of SEQ ID NO:34.
  • the polynucleotides herein may be manipulated in a variety of ways to provide for expression of the encoded polypeptide.
  • the polynucleotide is operably linked to control sequences, including among others, transcription promoters, leader sequences, transcription enhancers, ribosome binding or entry sites, termination sequences, and polyadenylation sequences for expression of the polynucleotide and/or corresponding polypeptide.
  • control sequences including among others, transcription promoters, leader sequences, transcription enhancers, ribosome binding or entry sites, termination sequences, and polyadenylation sequences for expression of the polynucleotide and/or corresponding polypeptide.
  • Manipulation of the isolated polynucleotide prior to its insertion into a vector may be desirable or necessary depending on the expression vector.
  • the techniques for modifying polynucleotides and nucleic acid sequences utilizing recombinant DNA methods are well known in the art. Guidance is provided in Sam
  • the polynucleotides can be part of an expression vector, where the vector and polynucleotide includes one or more operably linked control sequences for controlling expression of the polynucleotide and/or expression of the encoded polypeptide.
  • the recombinant expression vector may be any vector (e.g., a plasmid or virus), which can be conveniently subjected to recombinant DNA procedures and can bring about the expression of the polynucleotide sequence.
  • the choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced.
  • the vectors may be linear or closed circular plasmids.
  • Exemplary expression vectors include, among others, vectors based on T7 or T71ac promoters (pACY: Novagen; pET); vectors based on Baculovirus promoters (e.g., pBAC); vectors based on Efl-a and HTLV promoters (e.g., pFUSE2; Invitrogen, CA, USA); vectors based on CMV enhancer and human ferritin light chain gene promoters (e.g., pFUSE: Invitrogen, CA, USA); vectors based on CMV promoters (e.g, pFLAG: Sigma, USA); and vectors based on dihydrofolate reductase promoters (e.g., pEASE: Amgen, USA).
  • Various vectors can be used for transient or stable expression of the polypeptides of interest.
  • the polynucleotide encoding a polypeptide is operatively linked to one or more control sequences for expression of the polypeptide in a host cell.
  • Host cells for use in expressing the polypeptides are well known in the art and include, but are not limited to, bacterial cells, such as E. coli, yeast cells; insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as Chinese Hamster Ovary (CHO), African Green Monkey kidney (COS), baby hamster kidney (BHK), mouse myelomas (e.g., NSO and Sp2/0), and human embryo kidney (HEK); and plant cells. Appropriate culture mediums and growth conditions for the above-described host cells are well known in the art.
  • the host cells and the expression vectors are used to express the polypeptides of interest.
  • the host cells comprising the expression vectors and polynucleotides described herein are cultured in suitable media and under culture conditions appropriate for expression of the encoded polypeptide, for example the polypeptides comprising SEQ ID NO:23, SEQ ID NO:27, SEQ ID NO:31, and/or SEQ ID NO:35.
  • an in vitro expression system can be used with the expression vectors to express the polypeptide.
  • In vitro expression systems include those based on E. coli., rabbit reticulocyte, wheat germ, insect cells, and human cells. Whether expressed in a host cell or in vitro, the expressed polypeptides can be isolated or purified, as further described herein.
  • the MIC polypeptides and the epitopes can be part of immunogens for eliciting the production of antibodies.
  • the present disclosure provides an immunogen for preparing an antibody described herein.
  • the immunogen comprises a peptide within the alpha-3 domain of MICA or MICB protein.
  • the immunogen of an alpha-3 domain can comprise a polypeptide region from amino acid residues 205 to 297 of the full length MICA of the MICA*001 allele, or full length MICB protein of the MICB*001 allele.
  • antibodies that bind specifically to cryptic epitopes can be prepared by affinity techniques using peptides containing epitope sequences.
  • the antibodies can be screened for specific binding using the peptide containing the epitope (e.g., cryptic) sequences.
  • the immunogen comprises a cryptic epitope of the alpha-3 domain of MICA or MICB, for example the cryptic epitope within amino acid residues 187 to 297, particularly amino acid residues 187 to 274, more particularly amino acid residues 190 to 256 of MICA or MICB as described above.
  • polypeptide or peptides are selected that retain the 3-dimensional structure present in the naturally occurring extracellular domain of the MIC protein, for example sMICA and sMICB.
  • the immunogen comprises a peptide within a subsequence of the alpha-3 domain, wherein the subsequence is selected from:
  • amino acid residues 217 to 238 amino acid residues 243 to 256
  • the immunogen comprises a peptide within the alpha-3 domain comprising a sequence selected from:
  • MICA amino acid numbering based on *001 allele
  • IMGT/HLA and IMGT/MHC Sequence databases for the study of the major histocompatibility complex", Nucleic Acids Res. 31 :31 1-314 and the Anthony Nolan Research Institute world wide web site www.anthonynolan.org.uk/HIG/data.html; which are incorporated herein by reference.
  • immunogen comprises a peptide within the alpha-3 domain comprising a sequence selected from:
  • MICB amino acid numbering based on *001 allele
  • IMGT/HLA and IMGT/MHC Sequence databases for the study of the major histocompatibility complex", Nucleic Acids Res. 31 :31 1-314 and the Anthony Nolan Research Institute world wide web site www.anthonynolan.org.uk/HIG/data.html; which are incorporated herein by reference.
  • the immunogen comprises a peptide, where the peptide comprises a sequence:
  • RSEASEG 196 located on bottom of alpha-3 domain (SEQ ID NO:38);
  • the immunogen comprises a peptide, where the peptide comprises a sequence:
  • RGEEQR 256 located on bottom of alpha-3 domain (SEQ ID NO:42),
  • amino acid residue numbering is in reference to the MICA protein of the MICA*001 allele.
  • this epitope is found in, but not limited to, MICA alleles *005, *008:01 :01 ; *008:01 :02; *008:02; *008: 03; *008:04; *008:05; *010:01 ; *010:02; *013; *016; *019; *022; *027; *033; *035; *037; *039; *042; *048; *053; *054; *056; *058; *062; *069; *070; *073; and *076.
  • immunogen comprises a peptide, where the peptide comprises a sequence:
  • amino acid positions are defined with respect to the MICB protein of the MICB*001 allele.
  • the immunogen comprises a peptide, where the peptide comprises an amino acid sequence:
  • X A1 is selected from R and C;
  • X A3 is selected from E and K; and
  • X A4 is selected from A and V;
  • X B5 is selected from V and L;
  • the specific sequences described above can have additional amino acids appended to the amino and/or carboxy terminal ends, where the additional amino acids can be those found on the naturally occurring MICA or MICB amino acid sequence surrounding the defined region or the defined amino acid sequence.
  • the peptide immunogens can have additional 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50 amino acids at the amino terminal and/or carboxy terminal ends of the specific immunogen peptide sequences.
  • an exemplary immunogen for generating antibodies that bind to cryptic epitopes in the alpha-3 domain of MICA comprises a peptide selected from:
  • amino acid numbering is based on the mature, processed MICA protein of the MICA*001 allele.
  • an exemplary immunogen for generating antibodies that bind to cryptic epitopes in the alpha-3 domain of MICB comprises a peptide selected from:
  • amino acid numbering is based on the mature, processed MICB protein of the MICB*001 allele.
  • the immunogen peptides described herein can have additional amino acids appended, where the amino acids are not part of the naturally occurring amino acid sequence present on MICA or MICB, for example, to increase the immunogenicity of the peptides; and/or provide functional groups, such as amino groups, imino groups, cysteine groups, or carboxy groups for coupling the peptide to immunogenic carriers.
  • Other heterologous sequence that can be appended include, among others, purification sequences (e.g., His tag); cleavage sequences (e.g., protease recognition sequences); and epitope tags (e.g., c-myc, GFP, hemagglutinin, etc.).
  • the heterologous sequences can be 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50 or more amino acids at the amino terminal and/or carboxy terminal ends.
  • the peptides containing the cryptic epitopes can be prepared as fusion proteins, such as by chemical synthesis or recombinant techniques. Particularly useful are fusion proteins that increase the immunogenicity of the attached peptide containing the defined epitopes.
  • one or more of the peptides defining the epitopes above can be linked together, such as a head to tail arrangement to produce fusions of the peptides.
  • a linker for example glycine, serine, and/or threonine containing linkers, can be used to connect the peptides to provide some structural flexibility to the fusion constructs.
  • fused peptides can be prepared by chemical synthesis, or prepared by recombinant methods using nucleic acid constructs designed to express the fused peptides, with or without linkers.
  • the peptides can be cyclized to promote its immunogenic properties
  • the peptides can be produced as fusion proteins, where the fusion is to a T cell epitope that can elicit strong humoral response to the peptide epitope.
  • T cell epitopes sometimes referred to as T helper cell (Th) epitopes, comprise sequences of about 15-30 amino acids with common structural features (see, e.g., Cease et al., 1987, Proc Natl Acad Sci USA. 84:4249-53; U.S. Patent No. 5,759,551 and U.S. patent publication 20030027979; all of which are incorporated herein by reference).
  • Some pathogen derived T helper cell epitopes include, among others, FFLLTRILTIPQSLD (SEQ ID NO:62); KKLRRLLYMIYMSGLAVRVHVSKEEQY (SEQ ID NO:63);
  • KKQYIKANSKFIGITEL SEQ ID NO:64
  • KKFNNFTVSFWLRVPKVSASHL SEQ ID NO:65
  • YMSGLAVRVHVSKEE SEQ ID NO:66
  • YDPNYLRTDSDKDRFLQTMVKLFNRIK SEQ ID NO:67
  • GAYARCPNGTRALTVAELRGNAEL SEQ ID NO:68
  • LSEIKGVIVHRLEGV SEQ ID NO:69
  • GILESRGIKARITHVDTESY SEQ ID NO:70
  • WVRDIIDDFTNESSQKT SEQ ID NO:71
  • DVSTIVPYIGPALNHV SEQ ID NO:72
  • the peptides are coupled to a suitable carrier for imparting or increasing the immunogenicity of the peptides.
  • suitable carriers include, among others, tetanus toxoid, diphtheria toxoid, keyhole limpet hemocyanin (KLH), Concholepas concholepas hemocyanin, and cationized bovine serum albumin (cBSA).
  • the immunogen above can be prepared as an immunogen composition, such as with an adjuvant.
  • Suitable adjuvants include, among others, Complete Freund's adjuvant (CFA), which is typically composed of a mineral oil, an emulsifying agent, and killed mycobacteria, such as Mycobacterium tuberculosis. Aqueous antigen solutions are mixed with these components to create a water-in-oil emulsion.
  • the adjuvant is Incomplete Freund's adjuvant (IFA), which is similar to CFA but does not include the bacterial component.
  • MDP muramyl dipeptide
  • MF59 a highly immunogenic, submicron oil-in-water emulsion sub-micron oil-in-water emulsion of a squalene, polyoxyethylene sorbitan monooleate (TweenTM 80) and sorbitan trioleate
  • TweenTM 80 polyoxyethylene sorbitan monooleate
  • AS04 and AS02 which are oil in water emulsions containing MPLTM, a series of 4'-monophosphoryl lipid A species that vary in the extent and position of fatty acid substitution.
  • the antibodies of the present disclosure can be prepared by immunizing an animal with any of the described immunogens under conditions sufficient to elicit an antibody response; and isolating the antibody.
  • the antibodies generated can be screened for the desired binding properties, e.g., binding to sMIC protein but not to a MIC polypeptide comprising an alpha-3 domain and a transmembrane domain (e.g., full length MIC protein), or a membrane bound MICA or MICB.
  • the method of screening for the antibodies of the present disclosure can comprise:
  • transmembrane domain or the membrane bound MICA or MICB.
  • the method of screening for the antibodies of the present disclosure can comprise:
  • the method of screening for the antibodies of the present disclosure can comprise:
  • transmembrane domain or the membrane bound MICA or MICB.
  • the method of screening for the antibodies of the present disclosure can comprise:
  • transmembrane domain or the membrane bound MICA or MICB.
  • the MICA or MICB polypeptide comprising an alpha-3 domain and a transmembrane domain can be a full length MICA or full length MICB protein, respectively, either in its full length unprocessed or processed form.
  • any of the polypeptides described herein, including the specific cryptic peptides can be used for screening the antibodies.
  • the cryptic peptide used for screening can comprise a sequence represented by:
  • the cryptic peptide used for screening can comprise a sequence:
  • RSEASEG 196 located on bottom of alpha-3 domain (SEQ ID NO:38);
  • RQDGV 221, located on lower side of alpha-3 domain SEQ ID NO: 39;
  • LPDGN 238, located near the top of alpha-3 domain SEQ ID NO:40
  • RGEEQR 256 located on bottom of alpha-3 domain (SEQ ID NO:42),
  • amino acid positions are defined with respect to the MICA protein of the MICA*001 allele.
  • the cryptic peptide used for screening can comprise a sequence:
  • amino acid positions are defined with respect to MICB protein of the MICB*001 allele.
  • the peptide use for screening can comprise a sequence:
  • X A1 is selected from R and C;
  • X A3 is selected from E and K; and
  • X A4 is selected from A and V;
  • X B5 is selected from V and L;
  • the candidate antibody is assessed for insignificant autoimmune disease inducing activity. In some embodiments, the candidate antibody is assessed for insignificant antagonistic activity against binding of MIC protein to its cognate receptor NKG2D.
  • Conditions suitable for screening can be those used in conventional screening procedures, for example, incubation of cells or polypeptides with the antibodies in aqueous buffered solutions followed by several washings.
  • the peptide containing the epitopes or MIC protein expressing cells can be immobilized on a solid surface, such as a membrane or plate, which is then contacted with the candidate antibodies.
  • Non- specifically bound antibodies can be washed away with solutions containing non-specific competing agent, such as a suitable blocking agent.
  • Exemplary contacting conditions may comprise incubation on ice or at 4°C for between 30 minutes and 4 hours. Alternatively, carrying out the contacting step at room temperature or 37°C is possible and may be preferable in some cases.
  • blocking agents can be used to reduce non-specific binding, for example, bovine serum albumin, non-ionic detergents (e.g., NP40, Triton XI 00, Tween20, etc.), or other suitable blocking agent (e.g., non-fat milk).
  • non-specific binding for example, bovine serum albumin, non-ionic detergents (e.g., NP40, Triton XI 00, Tween20, etc.), or other suitable blocking agent (e.g., non-fat milk).
  • suitable blocking agent e.g., non-fat milk.
  • the contacting conditions can be varied and adapted by a skilled person depending on the aim of the screening method. For example, if the incubation temperature is increased, for example to room temperature, this may increase the possibility of identifying binders to a different subset of target entities. Such adaptations to the conditions are within the ambit of the skilled person.
  • the specific binding of a candidate antibody to the peptide containing the cryptic epitopes can be determined by surface plasmon resonance (e.g., Biacore system) or Bio-Layer Interferometry (BLI).
  • surface plasmon resonance antibodies can be immobilized on sensor chips and the chip exposed to peptides containing a defined epitope. The binding properties of the antibody to the peptide can be measured directly by the change in the local index of refraction upon interaction of the peptide with the antibody.
  • the peptide can be bound to a sensor chip and the chip exposed to the candidate antibody (see, e.g., Rich, R.L. and Myszka, D.G., 2007, Anal Biochem.
  • the peptide antigen (or antibody) is bound to a biosensor (e.g., fiber optic probe), and the biosensor contacted with a solution containing the antibody (or peptide antigen).
  • a biosensor e.g., fiber optic probe
  • the biosensor tip is illuminated with white light, and the changes in interference pattern measured to detect binding.
  • one or more of other known methods such as ELISA, FACS, or Western blotting can be used in addition to surface plasmon resonance or BLI to determine appropriate antibody binding potentials and antigenic site-specificities of the antibodies.
  • the antibodies of the disclosure can be applied to various diagnostic applications.
  • the antibody can be used to detect the presence and/or levels of sMIC proteins in biological samples, such as those obtained from patients who are suspected of or diagnosed with diseases characterized by elevated MIC protein levels, for example, epithelial cancers, hematologic malignancies, and autoimmune diseases.
  • the method of detecting sMICA can comprise:
  • the method of detecting sMICB can comprise:
  • the antibody can be a cross-reactive antibody that binds specifically to both sMICA and sMICB.
  • the biological sample is from a patient suspected or diagnosed with disease or disorder characterized by elevated sMIC levels
  • the levels of sMICA and/or sMICB detected can be compared to a standard, the standard level being a statistical average of the levels of the sMIC protein in a plurality of subjects without the disease or disorder.
  • the level of sMIC detected is abnormal if there is a statistically significant difference from the standard level.
  • the subject can be examined for sMIC levels over a period of time, including, before diagnosis with a disease or disorder, subsequent to diagnosis of the disease or disorder, prior to treatment with a therapeutic agent, and subsequent to treatment with therapeutic agent.
  • the diagnostic method can be used alone, or in combination with other methods and markers used as a diagnostic for a particular disease or disorder.
  • the biological sample can be any suitable sample taken from a subject for analysis, including cell samples, tissue samples and fluid samples.
  • the fluid sample includes blood, plasma, serum, urine, cerebrospinal fluid, lymph, synovial fluid, bile, semen, saliva, tears, and aqueous or vitreous humor.
  • the tissue sample includes biopsies of organs, solid tumors, preserved tissues, whole cells, and cell lysates.
  • the biological sample can be prepared by methods known in the art which are suitable for the particular sample, and include, among others, disruption by mechanical means, exposure to freezing (e.g., liquid nitrogen), or by exposure to chemicals, such as detergents, acids, or bases prior to reaction with the antibody.
  • Assays for detecting presence and/or levels of sMIC proteins include those typically used in the art, including among others, immunohistochemistry, competitive and sandwich assays, and steric inhibition assays.
  • Detecting the specific binding of the antibody can rely on use of an antibody containing a reporter molecule or a detectable label, for example, a fluorescent label, detectable enzyme, or a detectable conjugate system.
  • specific binding of the antibody can rely on a secondary detection agent, such as another antibody that binds specifically to the primary antibody.
  • the secondary antibody can be labeled with a reporter molecule, a detectable label, or a detectable conjugate.
  • the diagnostic methods herein can be used to detect levels of sMICA and/or sMICB in biological samples of subjects suspected of having a disease or disorder characterized by elevated MIC + levels, which may provide an indicator of the presence of the disease and/or the progression of the disease.
  • the diagnostic methods can be used to detect levels of sMICA and/or sMICB in biological samples of a subject already diagnosed with a disease and/or disorder characterized by elevated MIC + levels, which may provide confirmation of the presence of the disease and/or the progression of the disease. [0279] In some embodiments, the diagnostic methods can be used to detect levels of sMICA and/or sMICB in subjects who have undergone treatment, to determine the efficacy of the therapeutic agent and/or the therapeutic regimen, and/or the likelihood of disease relapse based on the change in levels of sMICA and/or sMICB.
  • sMICA and/or sMICB various diseases are associated with elevated or abnormal levels of sMICA and/or sMICB.
  • MICA and MICB and its interaction with NKG2D-bearing immune effector cells are involved in immunosurveillance of stressed or diseased cells that culminates in the death of the MIC + cells, the presence of soluble MIC proteins downregulates NKG2D receptor levels, enabling MIC + tumors to survive in the face of typically competent immune systems.
  • high levels of sMICA and sMICB have been identified in the blood of cancer patients but not in "normal” individuals, and this has been positively correlated with severity of the cancer staging (Salih et al., 2002, J Immunol.
  • therapeutic antibodies that are designed or selected to bind selectively and specifically to sMICA and/or sMICB when they have been shed or released from the cell (membranes) provides a basis for neutralizing the detrimental effects of sMICA and/ sMICB.
  • An advantage of using an antibody that selectively binds to the shed forms of MIC proteins is that the antibodies are unlikely to bind to MIC proteins expressed on surface of cells, thereby decreasing the likelihood of a pathological autoimmune reaction by improper activation of immune effector cells.
  • the antibody's absence of significant antagonistic activity against binding of MICA and/or MICB expressed on disease cells to NKG2D receptor levels may preserve the immune mediated destruction of MIC expressing tumor cells.
  • the antibodies of the disclosure can be used in a method of reducing the levels of sMICA and/or sMICB in a subject in need of such treatment (i.e., reduction), where the method comprises:
  • the subject to be treated will have elevated levels of sMICA and/or sMICB, where the levels are associated with the presence of a disease or disorder.
  • elevated or its grammatical equivalents, including “higher,” or “greater,” etc., when in reference to the level of a molecule (e.g., sMICA and/or sMICB) that is an indicator of a disease or disorder, refers to the quantity of the molecule that is higher in populations with the disease or disorder in a statistically significant manner as compared to the level of the molecule in a population that does not have the disease (e.g., healthy subjects).
  • the quantity of the sMICA and/or sMICB in the disease population is at least 10% greater than, at least 25% greater than, at least 50% greater than, at least 75% greater than, and/or at least 90% greater than the quantity of the same molecule in the control population that does not have the disease or disorder.
  • a variety of diseases have been identified that have elevated levels of sMICA and/or sMICB. Such diseases include epithelial cell tumors or cancers, and hematologic malignancies. Thus, in some embodiments, the subject to be treated is afflicted with a MIC + tumor or cancer, or a MIC + hematologic malignancy.
  • the MIC + tumor or cancer to be treated can be selected from brain cancer, lymphatic cancer, liver cancer, stomach cancer, testicular cancer, cervical cancer, ovarian cancer, vaginal and vulval cancer, leukemia, melanoma, squamous cell carcinoma, malignant mesothelioma cancer, oral cancer, head and neck cancer, throat cancer, thymus cancer, gastrointestinal stromal tumor (GIST) cancer, nasopharyngeal cancer, esophageal cancer, colon cancer, anal cancer, breast cancer, lung cancer, prostate cancer, penile cancer, bladder cancer, pancreatic cancer, neuroblastoma, glioma, hepatocellular carcinoma, and renal cancer.
  • GIST gastrointestinal stromal tumor
  • the antibodies of the disclosure can be used to treat a subject afflicted with a MIC + tumor or cancer, the method comprising:
  • the MIC + hematologic malignancy to be treated can be selected from Acute Lymphoblastic Leukemia (ALL), Acute Myelogenous Leukemia (AML), Chronic Lymphocytic Leukemia (CLL), Chronic Myelogenous Leukemia (CML), Acute Monocytic Leukemia (AMol), lymphomas (e.g., Hodgkin's lymphoma and Non-Hodgkin's lymphoma), and Multiple Myelomas.
  • ALL Acute Lymphoblastic Leukemia
  • AML Acute Myelogenous Leukemia
  • CLL Chronic Lymphocytic Leukemia
  • CML Chronic Myelogenous Leukemia
  • Acute Monocytic Leukemia e.g., Hodgkin's lymphoma and Non-Hodgkin's lymphoma
  • Multiple Myelomas e.g., Hodgkin's lymphoma and Non-Hodgkin's lympho
  • the antibodies of the disclosure can be used to treat a subject afflicted with a MIC + hematologic malignancy, the method comprising:
  • a method of treating a subject with a viral infection characterized by elevated levels of sMIC + protein can comprise:
  • Exemplary viral infections that display elevated sMIC protein levels include, among others, infections with hepatitis-B virus (HBV), respiratory syncytial virus (RSV), human cytomegalovirus (HCMV), hepatitis c virus (HCV), and human immunodeficiency virus (HIV). Accordingly, in some embodiments, a method of treating a subject infected with a with hepatitis-B virus (HBV), respiratory syncytial virus (RSV), human cytomegalovirus (HCMV) , hepatitis c virus (HCV), or human
  • immunodeficiency virus (HIV: e.g., HIV-1, HIV-2) can comprise:
  • administering to a subject infected with HBV, RSV, HCMV, HCV or HIV-1 a therapeutically effective amount of an antibody of the present disclosure.
  • an exemplary antibody can comprise at least 1, 2, 3, 4, 5 or all 6 of the CDRs in the light chain variable region of amino acid sequence of SEQ ID NO:23 and the heavy chain variable region of amino acid sequence of SEQ ID NO:27.
  • the antibody for use in the therapeutic treatment comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence of SEQ ID NO:83; CDR L2 comprising an amino acid sequence of SEQ ID NO:84; CDR L3 comprising an amino acid sequence of SEQ ID NO:85; CDR HI comprising an amino acid sequence of SEQ ID NO:89, SEQ ID NO:95, or SEQ ID NO:99; CDR H2 comprising an amino acid sequence of SEQ ID NO:90, SEQ ID NO:96, or SEQ ID NO: 100; and CDR H3 comprising an amino acid sequence SEQ ID NO:91.
  • the antibody for use in the therapeutic treatment comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs in the light chain variable region of amino acid sequence of SEQ ID NO: 31 and the heavy chain variable region of amino acid sequence of SEQ ID NO:35.
  • the antibody for use in the therapeutic treatment comprises at least 1, 2, 3, 4, 5 or all 6 of the CDRs selected from: CDR LI comprising an amino acid sequence of SEQ ID NO:86; CDR L2 comprising an amino acid sequence of SEQ ID NO:87; CDR L3 comprising an amino acid sequence of SEQ ID NO:88; CDR HI comprising an amino acid sequence of SEQ ID NO:92, SEQ ID NO:97, or SEQ ID NO: 101 ; CDR H2 comprising an amino acid sequence of SEQ ID NO:93, SEQ ID NO:98, or SEQ ID NO: 102; and CDR H3 comprising an amino acid sequence of SEQ ID NO:94.
  • CDR LI comprising an amino acid sequence of SEQ ID NO:86
  • CDR L2 comprising an amino acid sequence of SEQ ID NO:87
  • CDR L3 comprising an amino acid sequence of SEQ ID NO:88
  • CDR HI comprising an amino acid sequence of SEQ ID NO:92, SEQ ID NO:97, or SEQ ID
  • the antibody for use in the therapeutic treatment comprises a light chain variable region VL comprising an amino acid sequence of SEQ ID NO:23 and a heavy chain variable region VH comprising an amino acid sequence of SEQ ID NO:27.
  • the antibody for use in the therapeutic treatment comprises a light chain variable region VL comprising an amino acid sequence of SEQ ID NO: 31 and a heavy chain variable region VH comprising an amino acid sequence of SEQ ID NO:35.
  • the methods disclosed herein are generally useful for generating immune responses, as prophylactic agents, or immune response-stimulating therapeutics.
  • the methods disclosed herein can be applied to a wide range of mammals, including, among others, humans, non-human primates (e.g., chimpanzees, monkeys, etc.), or non-primates (e.g., horses, cattle, pigs, sheep, deer, elk, goats, dogs, cats, rabbits, rats, and mice).
  • the subject or patient is preferably a human.
  • the human is a pediatric patient.
  • the human is an adult patient.
  • the subject can be an ape (e.g., gorilla, chimpanzee, or orangutan) or a domesticated mammal (e.g., dog, cat, sheep, cow, or horse).
  • compositions described herein can be administered to the host's body where suitable for administration.
  • the antibody can be delivered to, without limitation, the joints, nasal mucosa, blood, lungs, intestines, muscle tissues, skin, or peritoneal cavity of a mammal.
  • a composition can be administered by intravenous, intraperitoneal, intramuscular, subcutaneous, intramuscular, intrarectal, intravaginal, intrathecal, intratracheal, intradermal, or transdermal injection, by oral or nasal administration, by inhalation, or by gradual perfusion over time.
  • an aerosol preparation of a composition can be given to a host by inhalation. The most suitable route for administration in any given case will depend on the particular antibody, the subject, the nature and severity of the disease, and the physical condition of the subject.
  • the dosage administered depends on, among others, the route of administration; the nature of the formulation; the nature of the subject's illness; the subject's size, weight, surface area, age, and sex; other drugs being administered; and the judgment of the attending physician. Suitable dosages can be in the range of 0.0001-100 mg/kg body weight. Wide variations in the dosages administered are to be expected in view of the variety of antibody compositions available and the differing efficiencies of various routes of administration. Variations in these dosage levels can be adjusted using standard empirical routines for optimization as is well understood in the art.
  • the effective dose of an antibody of the disclosure can range from about 0.001 to about 75 mg/kg body weight; 0.005 mg/kg to about 50 mg/kg body weight; about 0.01 mg/kg to about 30 mg/kg body weight; or about 0.01 to 5 mg/kg body weight.
  • the dosages can be about 0.001 mg/kg body weight, about 0.01 mg/kg body weight, about 0.3 mg/kg body weight, about 1 mg/kg body weight, about 3 mg/kg body weight, about 5 mg/kg body weight or about 10 mg/kg body weight, or within the range of 1-10 mg/kg body weight per single (e.g., bolus) administration.
  • Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response, manageable toxicity or side effects, etc.). For example, a single bolus may be administered, several divided doses may be administered over time, or the dose may be proportionally reduced or increased as needed by the therapeutic situation.
  • the duration of treatment with any of the compositions provided herein can be any length of time from as short as one day to indefinitely, as needed.
  • the administration can be a single bolus or the administration repeated, e.g., after one day, two days, three days, five days, one week, two weeks, three weeks, one month, five weeks, six weeks, seven weeks, two months, three months, or more.
  • the repeated administration can be at the same dose or at a different dose.
  • a defined dosage regimen is continued for period of time, for example, 2 weeks to 6 months, from 3 months to 1 or 2 years, from 6 months to 3 or 4 years, from 8 months to 18 months, or the like, as necessary to treat the disease (e.g., eliminate the disease, cause remission, or halt disease progression).
  • the initial treatment can be a defined dosage regimen 2 weeks to 2 months, followed by a maintenance dosage regimen, where the maintenance dosage can be the same or lower dose than the initial treatment, repeated as necessary to treat the disease or disorder, for example, a maintenance treatment of once every two weeks, once a month, once every two months, or once every four months, or on an as needed basis as determined by a physician.
  • the antibodies can be used as monotherapy, and can be administered as a single dose or several doses over time.
  • the antibody can be administered as induction therapy, i.e., the first in a series of therapeutic measures used to treat a disease, followed by maintenance therapy with the antibody.
  • the antibodies can be used in combination with other therapeutic agents suitable for treating the disease or disorder characterized by elevated levels of sMIC protein.
  • the antibody of the disclosure and one or more of the combination therapeutic agent can be administered concurrently (e.g., simultaneously), sequentially, together, or separately.
  • the antibodies of the disclosure are used in combination with
  • chemotherapeutic agents used to treat tumors, cancers or autoimmune diseases.
  • the chemotherapeutic agents can include, among others, cytotoxic agents, anti-metabolite agents (e.g., folate antagonists, purine analogs, pyrimidine analogs, etc.), topoisomerase inhibitors (e.g., camptothecin derivatives,
  • anthracenedione, anthracyclines, epipodophyllotoxins, quinoline alkaloids, etc. anti-microtubule agents (e.g., taxanes, vinca alkaloids), protein synthesis inhibitors (e.g., cephalotaxine, camptothecin derivatives, quinoline alkaloids), alkylating agents (e.g., alkyl sulfonates, ethylenimines, nitrogen mustards, nitrosoureas, platinum derivatives, triazenes, etc.), alkaloids, terpenoids, and kinase inhibitors.
  • anti-microtubule agents e.g., taxanes, vinca alkaloids
  • protein synthesis inhibitors e.g., cephalotaxine, camptothecin derivatives, quinoline alkaloids
  • alkylating agents e.g., alkyl sulfonates, ethylenimines, nitrogen mustards, nitrosour
  • chemotherapeutic agents typically used to treat proliferative disorders include, by way of example and not limitation, afatinib, afuresertib, alectinib, alisertib, alvocidib, amonafide, amuvatinib, axitinib, azacitidine, azathioprine, bafetinib, barasertib, bendamustine, bleomycin, bosutinib, bortezomib, busulfan, cabozantinib, camptothecin, canertinib, capecitabine, cabazitaxel, carboplatin, carmustine, cenisertib, ceritinib, chlorambucil, cisplatin, cladribine, clofarabine, crenolanib, crizotinib, cyclophosphamide, c
  • the antibodies can be used in combination with a biologic drug used to treat tumors, cancers or autoimmune diseases.
  • biologic drugs that can be used in combination with the antibodies herein include, among others, anti-BAFF (e.g., belimumab); anti-CCR4 (e.g., mogamulizumab ); anti-CD 19/CD3 (e.g., blinatumomab); anti-CD20 (e.g., obinutuzumab, rituximab, ibritumomab tiuxetan, ofatumumab, tositumomab); anti-CD22 (e.g., moxetumomab pasudotox); anti- CD30 (e.g., brentuximab vedotin); anti-CD33 (e.g., gemtuzumab); anti-CD37 (e.g., otlertuzumab
  • anti-BAFF e
  • the antibody described herein can be used in combination with therapeutic agents that activate, e.g., stimulate, the immune system.
  • these can comprise agents that positively activate the immune system, or agents that inhibit downregulation of immune activation.
  • the immuno-activating or immune stimulating agents can be small molecule compounds, antibodies, anti- sense compounds, gene therapy, and the like.
  • Various biological targets for therapeutic immune activation agents include, by way of example and not limitation, CTLA-4, KIR (Killer-cell
  • the immune system activating agent includes antibodies or other binding agents directed against the therapeutic targets, for example, anti-CTLA4, anti-PD-1, anti-PD-Ll, anti-PD-L2, anti-CD 137, anti- TGF- ⁇ , anti-TGF- ⁇ 2, anti-TGF- ⁇ 3, and anti-apolipoprotein J (Clusterin).
  • Exemplary immune activating agents include, among others, ipilimumab, tremelimumab (Ribas et al, 2013, J Clin Oncol. 31 :616-22), nivolumab (Wolchok et al., 2013, N Engl J Med. 369: 122-33), BMS-936559 (MDX-1 105: Brahmer et al, 2012, N Engl J Med. 366:2455-65), MEDI4736 (anti-PD-Ll), MPDL3280A (anti-PDL-1), lambrolizumab (Hamid et al., 2013, N Engl J Med.
  • the immune activating agent for use in combination with the antibodies can comprise a cytokine or chemokine that stimulates the immune response.
  • cytokines and chemokines include, among others, IL-2, IL-7, IL-12, IL-15, IL-21, GM-CSF, IFN-a, and CCL-21.
  • the immune stimulating cytokines and chemokines can be used ex vivo to treat immune cells, particularly immune cells obtained from the subject or patient to be treated.
  • the antibody described herein can be used in combination with cancer vaccines, which includes antigen presenting cells (e.g., dendritic cells) activated with cancer vaccines.
  • cancer vaccines include, among others, prostatic acid phosphatase (e.g., Provenge ® ); gp-96-Ig (e.g., HS-410); PANVAC; HER2/neu (e.g., nelipepimut-S, AVX901); DCVax(R)-L; rindopepimut; IMA950 (multi tumor associated peptides); tumor-derived heat shock protein gp96 (Vitespen); surviving peptide (e.g., ISA-51 : US patent publication 201 10091489); EGFRvIII-NY-ESO- 1 (e.g., ADU-623); CD- 133; folate binding protein vaccines E39 and J65; HLA-A2 tumor antigen peptides
  • CDCA1 URLC10, KIF20A, DEPDC1 and MPHOSPH1 ; hyperglocosylated MUC1 (e.g., ONT- 10); poly-ICLC; human telomerase reverse transcriptase (e.g., hTERT, UV1, GV1001); HPV P16 37-63- peptide; HPV-16-E7 (e.g., ADX1 1-001), pNGVL4a-Sig; Herpes Zoster vaccine GSK1437173A; NY- ESO-1 antigen; leukemia-associated antigen WT1 ; bcr-abl p210-b3a2 breakpoint-derived pentapeptide CMLVAXIOO; lung cancer cell with GM-CSF (e.g., GVAX); Wilms tumor gene 1 (WT1) peptide (e.g., OCV-501); human MUC1 antigen (e.g., L-BLP25); MUCl peptide tecemotide; H
  • the cancer vaccine used in combination with the antibodies can be tumor cells or tumor cell lysates, which vaccines include antigen presenting cells (e.g., dendritic cells) activated with tumor cells or tumor cell lysates.
  • antigen presenting cells e.g., dendritic cells
  • Exemplary tumor cells and corresponding tumor cells lysates useful as vaccines include, among others, bladder cancer cells, glioblastoma cells, breast cancer cells, cervical cancer cells, lymphoma cells, kidney cancer cells, leukemic cells, lung cancer cells, melanoma cells, multiple myeloma cells, non-Hodgkin's lymphomas, pancreatic cancer cells, and prostate cancer cells.
  • the antibodies can be used in combination with antiviral drugs used to treat viral infections characterized by presence of elevated sMIC ligands, for example, infections with hepatitis-B virus, respiratory syncytial virus, human cytomegalovirus, hepatitis c virus, and human immunodeficiency virus.
  • Drugs for treating hepatitis-B viral infections include, among others, interferons (e.g., interferon alpha-2b or pegylated interferon), lamivudine, adefovir dipivoxil, entecavir, telbivudine, and tenofovir.
  • Drugs for treating respiratory syncytial virus include, among others, RSV hyperimmune globulin; palivizumab; benzimidazoles BMS-433771, TMC353121 and JNJ-2408068; ribavirin; and antisense phosphorodiamidate morpholino oligomers (see review Olszewska and Openshaw, 2009, Expert Opin Emerg Drugs 14(2): 207-17).
  • Drugs for treating hepatitis C virus include, among others, interferons (e.g., interferon alpha-2b or pegylated interferon), boceprevir, telaprevir, ribavirin, simeprevir, sofosbuvir, daclatasvir, and combinations thereof.
  • Interferons e.g., interferon alpha-2b or pegylated interferon
  • boceprevir e.g., interferon alpha-2b or pegylated interferon
  • telaprevir e.g., telaprevir
  • ribavirin e.g., ribavirin
  • simeprevir e.g., sofosbuvir
  • daclatasvir e.g., sofosbuvir, daclatasvir
  • immunodeficiency virus include, among others, efavirenz, emtricitabine, tenofovir disoproxil fumarate, rilpivirine, cobicistat, lamivudine, zidovudine, abacavir, zalcitabine, stavudine, nevirapine, etravirine, delavirdine, tipranavir, indinavir, saquinavir mesylate, lopinavir, ritonavir, darunavir, atazanavir sulfate, nelfinavir mesylate, maraviroc, raltegravir, enfuvirtide, and combinations thereof.
  • the antibody described herein can be used prior to, concurrently with, or subsequent to the administration of the other therapeutic agent.
  • the antibody of the disclosure and the combination therapeutic agent can be administered successively to the patient on the same day, for example during the same patient visit. Successive administration can occur 1, 2, 3, 4, 5, 6, 7 or 8 hours or more hours apart.
  • the antibody of the disclosure and the combination therapeutic agent can be administered separately, e.g., on different days, for example, the antibody and the combination therapeutic agent can be administered at a 1-day, 2-day or 3-day, one-week, 2-week or monthly intervals.
  • Other treatment regimens for the combination of the antibody of the disclosure and other therapeutic agents will be apparent to the skilled artisan in light of the guidance herein.
  • the present disclosure provides articles of manufacture and kits containing materials useful for practicing the antibodies and methods described herein.
  • the article can comprise a container comprising the antibodies of the present disclosure.
  • Suitable containers include, among others, bottles, vials, bags, and syringes.
  • the containers can be made of various materials, such as plastic or glass.
  • the containers can have a sterile access port, for example, a stopper or membrane for inserting a hypodermic injection needle.
  • the articles can also include at least a second container containing materials to be used in combination with the antibodies, such as sterile water or sterile buffer, for example for reconstituting the compositions for use.
  • the second container or a third container can comprise an additional therapeutic agent, including, a chemotherapeutic agent or biological agent for use in combination with the antibody compositions of the present disclosure.
  • the article comprises a label or package insert that describes the composition used for treating one or more disease conditions.
  • the articles can also include instructions or descriptions of the compositions and instructions for their use on a suitable electronic medium, such as optical discs and static random access memory chips.
  • kits comprising the containers, package inserts, and/or electronic medium. It may further include other materials desirable for commercial distribution and the user, such as other buffers, diluents, filters, needles and syringes.
  • Example 1 Methods Related to Generation of Monoclonal Antibodies to the Alpha-3 Domain of
  • Baculovirus protein expression system was used to generate the appropriate protein glycosylation on expressed MICA.
  • Recombinant alpha-3 domain MICA cDNA (allele 001) corresponding to the GenBank MICA sequence NP 000238.1 (FIG. 1) encoding residues 205 to 297 of the alpha-3 domain of MICA (FIG. 1C: SEQ ID NO:3), which are amino acid residues 182 to 274 of the processed MICA protein (e.g., FIG. 4 - A), was synthetically generated along with convenient restriction enzymes sites for further subcloning into the Baculovirus transfer vector, and then ligated into an appropriate DNA cloning vector.
  • the Baculovirus transfer vector contained a six C-terminal Histidine residue tag for purification.
  • Exemplary MICA peptide immunogens with purification tags and cleavage sites can also be selected from the following, where the MICA sequences are underlined: (a) MEFVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRODGVSLSHDTOO
  • Sf9 cells were infected with recombinant virus in serum- free medium, such as SF-900 (Life Technologies), and the cells harvested at day 4 or 5 after infection.
  • serum-free medium such as SF-900 (Life Technologies)
  • the cells were lysed, centrifuged briefly to collect the supernatant, and then subjected to affinity chromatography using Ni 2+ chelation. Protein recovery was improved by the addition of 8M urea to the sample buffer prior to chromatography. Dialysis against a carbonate buffer was used to remove the urea.
  • the pure protein may also be concentrated by centrifugation filters (Amicon) to achieve a more stable protein preparation.
  • MICB alpha-3 domain from MICB as the recombinant protein to be used in immunization of mice.
  • SEQ ID NO:4 exemplary MICB peptide immunogens with purification tags and cleavage sites can also be selected from the following, where the MICB sequences are underlined:
  • the alpha-3 domain MICA immunogen was prepared in an aqueous solution (about 0.5 mg/ml) and injected five times, over a two- week period, into immunocompetent mice using a RapidPrimeTM method (ImmunoPrecise, British Columbia, Canada). Following immunization, the lymphocytes from the lymph tissue of the immunized mice were removed and the lymphocytes chemically fused with, but not limited to, polyethylene glycol (PEG) or a PEG derivative, to murine SP2/0 myeloma cells for immortalization.
  • PEG polyethylene glycol
  • PEG polyethylene glycol
  • the fused cells were grown in a methylcellulose-containing semi-solid HAT drug-selection medium in order to select clonal B-cell/myeloma fusion hybridoma cells capable of producing antibodies.
  • the primary screening of hybridoma clones involved testing antibody-containing supematants for their ability to bind recombinant antigen (alpha-3 domain of MICA) by ELISA.
  • the primary screen produced 146 hits from a total of 948 (15%) hybridoma clones assayed, while the isotyping assay identified 98/146 clones (67%) for a specific antibody type, equivalent to 10% of the 948 initial clones.
  • a secondary screen used the same antibody- containing supematants to test for their ability to bind recombinant extracellular regions (alpha- 1 , -2 and -3 domains) of MICA or MICB proteins by indirect ELISA, and for their inability to bind MIC proteins on the cell surface of MIC expressing heat-shocked HCT1 16 colon carcinoma cells by flow cytometric analysis.
  • MIC expressing heat-shocked HCT1 16 colon carcinoma cells were heat-treated at 42°C for 60 min and then allowed to recover for 22 hr at 37°C. Upon recovery, a viability test was performed on post-trypsinized cells, and a viability level of 97% was determined.
  • Heat-treated HCT1 16 cells were then prepared for flow cytometry by first blocking briefly with Clear BackTM human Fc receptor blocking reagent (MBL International, MA, USA), and then treating with primary antibody which was selected from one of the following: (a) test hybridoma supernatant; (b) positive control murine antibodies capable of binding either to the alpha- 1 plus alpha-2 MIC subdomains only, or to the alpha-3 MIC subdomain only (BAMOl and BAM03 mABs described above: MBL International, MA, USA), or (c) negative control murine antibodies isotype-matched to the positive control antibodies (IgGi anti-human transferrin antibody and IgG 2a — anti-trout Ig).
  • primary antibody which was selected from one of the following: (a) test hybridoma supernatant; (b) positive control murine antibodies capable of binding either to the alpha- 1 plus alpha-2 MIC subdomains only, or to the alpha-3 MIC subdomain only (BAMOl and BAM03
  • a key component of the technique is the optical biosensor whose tip is immersed in the fluids of the test well and then used to assay interference patterns between waves of light.
  • the ligand monoclonal antibody
  • the analyte biomolecule antigen
  • Binding responses between ligand and analyte were measured and reported in real-time. Both association and dissociation kinetics were monitored and K D values were calculated. This model assumed a 1 : 1 interaction of ligand to analyte.
  • the affinity constant K D for the positive control MICA antibody was about 6.07 x 10 ⁇ 9 M.
  • the negative control MICA antibody that does not bind tightly had a K D of about 9.6 x 10 "6 M.
  • antibody from clone 1F5 had a measured K D of about 7.83 x lO 0 M while the antibody from clone 8C7 had a measured K D of about 6.81 x 10 "09 M.
  • Hybridoma cells were lysed with detergent-containing buffer, and mRNA was isolated by standard procedures.
  • RT-PCR was carried out using 5' RACE (RLM- RACE) and gene specific reverse primers, which amplify mouse immunoglobulin heavy chain (IgGi) and light chain (kappa) variable region sequences.
  • the reaction mixture was separated by gel electrophoresis, and the specific PCR bands were gel-excised.
  • the purified PCR product was cloned into pCR-Blunt II- TOPO vector, and the constructs transformed into E. coli. Twenty three colonies of each chain were picked and PCR screened for the presence of amplified regions prior to sequencing.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Veterinary Medicine (AREA)
  • Virology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Communicable Diseases (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • AIDS & HIV (AREA)
  • Hematology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/IB2014/001157 2013-03-15 2014-03-15 Antibodies to mica and micb proteins Ceased WO2014140904A2 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
AU2014229476A AU2014229476B2 (en) 2013-03-15 2014-03-15 Antibodies to MICA and MICB proteins
US14/776,640 US10851148B2 (en) 2013-03-15 2014-03-15 Antibodies to MICA and MICB proteins
JP2015562400A JP6518199B6 (ja) 2013-03-15 2014-03-15 Micaおよびmicbタンパク質に対する抗体
EP14762844.0A EP2970490A4 (en) 2013-03-15 2014-03-15 Antibodies to mica and micb proteins
CA2906356A CA2906356A1 (en) 2013-03-15 2014-03-15 Antibodies to mica and micb proteins
US16/928,977 US20210040173A1 (en) 2013-03-15 2020-07-14 Antibodies to mica and micb proteins

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201361801329P 2013-03-15 2013-03-15
US61/801,329 2013-03-15
US201461940372P 2014-02-15 2014-02-15
US61/940,372 2014-02-15

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/776,640 A-371-Of-International US10851148B2 (en) 2013-03-15 2014-03-15 Antibodies to MICA and MICB proteins
US16/928,977 Continuation US20210040173A1 (en) 2013-03-15 2020-07-14 Antibodies to mica and micb proteins

Publications (2)

Publication Number Publication Date
WO2014140904A2 true WO2014140904A2 (en) 2014-09-18
WO2014140904A3 WO2014140904A3 (en) 2014-12-31

Family

ID=51538216

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2014/001157 Ceased WO2014140904A2 (en) 2013-03-15 2014-03-15 Antibodies to mica and micb proteins

Country Status (6)

Country Link
US (2) US10851148B2 (https=)
EP (1) EP2970490A4 (https=)
JP (2) JP6518199B6 (https=)
AU (1) AU2014229476B2 (https=)
CA (1) CA2906356A1 (https=)
WO (1) WO2014140904A2 (https=)

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017096374A1 (en) * 2015-12-04 2017-06-08 Dana-Farber Cancer Institute, Inc. Vaccination with mica/b alpha 3 domain for the treatment of cancer
WO2018141959A1 (en) 2017-02-06 2018-08-09 Innate Pharma Immunomodulatory antibody drug conjugates binding to a human mica polypeptide
US10046047B2 (en) 2015-02-06 2018-08-14 Heat Biologics, Inc. Vector co-expressing vaccine and costimulatory molecules
WO2018081648A3 (en) * 2016-10-29 2019-01-10 Genentech, Inc. ANTI-MIC ANTIBODIES AND METHODS OF USE
CN110088137A (zh) * 2016-10-19 2019-08-02 诺瓦罗技科斯生物科技有限公司 针对mica和micb蛋白的抗体
WO2020035345A1 (en) 2018-08-14 2020-02-20 Innate Pharma Treatment of colorectal cancer by a combination of an anti-mica antibody and an anti-nkg2a antibody
WO2020028428A3 (en) * 2018-07-31 2020-05-07 Pdi Therapeutics, Inc. Anti-mica/b antibodies that block mica/b shedding and methods of use
WO2020127965A1 (en) 2018-12-21 2020-06-25 Onxeo New conjugated nucleic acid molecules and their uses
KR20200115545A (ko) * 2018-01-25 2020-10-07 피디아이 테라퓨틱스, 인크. Mica/b 항체 및 사용 방법
WO2020214957A1 (en) * 2019-04-19 2020-10-22 Tcrcure Biopharma Corp. Anti-pd-1 antibodies and uses thereof
WO2021255223A1 (en) 2020-06-19 2021-12-23 Onxeo New conjugated nucleic acid molecules and their uses
US11548930B2 (en) 2017-04-04 2023-01-10 Heat Biologics, Inc. Intratumoral vaccination
US11666649B2 (en) 2016-10-11 2023-06-06 University Of Miami Vectors and vaccine cells for immunity against Zika virus
WO2023111203A1 (en) 2021-12-16 2023-06-22 Onxeo New conjugated nucleic acid molecules and their uses
EP4017876A4 (en) * 2019-08-23 2023-09-06 Northwestern University MATERIALS AND METHODS FOR ACTIVATING ANTIGEN-SPECIFIC T CELL RESPONSES
US20230296611A1 (en) * 2020-08-10 2023-09-21 Innate Pharma Cell surface mica and micb detection using antibodies
KR20230172384A (ko) * 2022-06-15 2023-12-22 주식회사 셀리드 자연 살해 t 세포의 리간드와 암 항원을 적재한 자연 살해 세포를 포함하는 백신
RU2815101C2 (ru) * 2018-07-31 2024-03-11 Каллинен Майка Корп. Антитела против mica/b, блокирующие шеддинг mica/b, и способы их применения
US11939389B2 (en) 2018-06-13 2024-03-26 Novartis Ag BCMA chimeric antigen receptors and uses thereof
US12214037B2 (en) 2014-07-21 2025-02-04 Novartis Ag Treatment of cancer using humanized anti-BCMA chimeric antigen receptor

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK2257301T3 (da) 2008-03-03 2014-04-28 Univ Miami Immunterapi baseret på allogene cancerceller.
CA2945822A1 (en) * 2014-05-21 2015-11-26 Dana-Farber Cancer Institute, Inc. Methods for treating cancer with anti bip or anti mica antibodies
CN107964041B (zh) * 2016-10-20 2023-08-01 中国科学院广州生物医药与健康研究院 高稳定性和高亲和力的dmic及其制法
CN108204958A (zh) * 2016-12-19 2018-06-26 伊缪泰普有限公司 结合测定
PE20210665A1 (es) 2018-03-23 2021-03-31 Bristol Myers Squibb Co Anticuerpos contra mica y/o micb y sus usos
CN112574311B (zh) * 2020-12-14 2022-03-25 广州康盛生物科技股份有限公司 双mic结合活性的抗体及其应用
WO2022235676A1 (en) * 2021-05-04 2022-11-10 Actinium Pharmaceuticals, Inc. Radioimmunoconjugates directed to nkg2d ligands for the treatment of cancer
JP2025512137A (ja) * 2022-04-08 2025-04-16 ディーツーエム バイオセラピューティクス リミテッド 抗mica/b抗体及びその使用

Family Cites Families (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2275141A1 (en) 1996-10-29 1998-05-07 Thomas Spies Cell stress regulated human mhc class i gene
CA2462790A1 (en) 2001-10-04 2003-04-10 Immunex Corporation Ul16 binding protein 4
AU2003225093A1 (en) 2002-04-22 2003-11-03 Fred Hutchinson Cancer Research Center Soluble mic polypeptides as markers for diagnosis, prognosis and treatment of cancer and autoimmune diseases or conditions
US7666417B2 (en) 2003-04-22 2010-02-23 Fred Hutchinson Cancer Research Center Methods and compositions for treating autoimmune diseases or conditions
WO2005107802A2 (en) 2004-04-30 2005-11-17 Biopheresis Technologies, Llc Method and system to remove soluble tnfr1, tnfr2, and il2 in patients
DE102004042894A1 (de) 2004-08-30 2006-03-02 Eberhard-Karls-Universität Tübingen Verwendung von Blockern der NKG2D-Rezeptor-/NKG2D-Liganden-Interaktion bei Autoimmunerkrankungen
CA2665090A1 (en) 2006-09-22 2008-03-27 Dana-Farber Cancer Institute, Inc. Methods for treating mica-related disorders
CA2685056C (en) 2007-04-23 2015-08-25 Fred Hutchinson Cancer Research Center Negative immunomodulation of immune responses by erp5
US8182809B1 (en) * 2008-09-08 2012-05-22 University Of Washington Methods for treating cancer by inhibiting MIC shedding
WO2010080124A2 (en) 2008-12-18 2010-07-15 Dana-Farber Cancer Institute, Inc. Nkg2d-fc for immunotherapy
US8796420B2 (en) 2009-12-31 2014-08-05 Avidbiotics Corp. Non-natural MIC proteins
TWI408370B (zh) 2011-05-19 2013-09-11 長庚大學 胰臟癌之血清生物檢測標誌及其應用
US8753640B2 (en) * 2011-05-31 2014-06-17 University Of Washington Through Its Center For Commercialization MIC-binding antibodies and methods of use thereof
ES2925654T3 (es) 2011-09-30 2022-10-19 Dana Farber Cancer Inst Inc Péptidos terapéuticos que comprenden anticuerpos que se unen a la secuencia A relacionada con el polipéptido del CMH de clase I (MICA)
EP2812027A1 (en) 2012-02-07 2014-12-17 Innate Pharma Mica binding agents
EP2626994B1 (en) 2012-02-08 2019-04-03 GE Oil & Gas UK Limited Supplying electrical power to subsea equipment
US20160030659A1 (en) 2013-03-15 2016-02-04 Novelogics Biotechnology, Inc. Methods and devices for removal of immunosuppressive ligands

Cited By (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12214037B2 (en) 2014-07-21 2025-02-04 Novartis Ag Treatment of cancer using humanized anti-BCMA chimeric antigen receptor
US10758611B2 (en) 2015-02-06 2020-09-01 Heat Biologics, Inc. Vector co-expressing vaccine and costimulatory molecules
US10046047B2 (en) 2015-02-06 2018-08-14 Heat Biologics, Inc. Vector co-expressing vaccine and costimulatory molecules
US10780161B2 (en) 2015-02-06 2020-09-22 Heat Biologics, Inc. Vector co-expressing vaccine and costimulatory molecules
US10993971B2 (en) 2015-12-04 2021-05-04 Dana-Farber Cancer Institute, Inc. Vaccination with MICA/B alpha 3 domain for the treatment of cancer
JP2022130623A (ja) * 2015-12-04 2022-09-06 デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド がんの治療のためのmica/bアルファ3ドメインによるワクチン接種
WO2017096374A1 (en) * 2015-12-04 2017-06-08 Dana-Farber Cancer Institute, Inc. Vaccination with mica/b alpha 3 domain for the treatment of cancer
JP2018536002A (ja) * 2015-12-04 2018-12-06 デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド がんの治療のためのmica/bアルファ3ドメインによるワクチン接種
US11666649B2 (en) 2016-10-11 2023-06-06 University Of Miami Vectors and vaccine cells for immunity against Zika virus
US11066471B2 (en) 2016-10-19 2021-07-20 Novelogics Biotechnology Inc. Antibodies to MICA and MICB proteins
EP3529280A4 (en) * 2016-10-19 2020-04-22 Novelogics Biotechnology, Inc. ANTIBODIES AGAINST MICA AND MICB PROTEINS
CN110088137A (zh) * 2016-10-19 2019-08-02 诺瓦罗技科斯生物科技有限公司 针对mica和micb蛋白的抗体
CN110267678A (zh) * 2016-10-29 2019-09-20 霍夫曼-拉罗奇有限公司 抗mic抗体和使用方法
WO2018081648A3 (en) * 2016-10-29 2019-01-10 Genentech, Inc. ANTI-MIC ANTIBODIES AND METHODS OF USE
WO2018141959A1 (en) 2017-02-06 2018-08-09 Innate Pharma Immunomodulatory antibody drug conjugates binding to a human mica polypeptide
US11548930B2 (en) 2017-04-04 2023-01-10 Heat Biologics, Inc. Intratumoral vaccination
KR20200115545A (ko) * 2018-01-25 2020-10-07 피디아이 테라퓨틱스, 인크. Mica/b 항체 및 사용 방법
KR102731953B1 (ko) * 2018-01-25 2024-11-20 컬리난 미카 코퍼레이션 Mica/b 항체 및 사용 방법
EP3743109A4 (en) * 2018-01-25 2021-11-10 Cullinan Mica Corp. MICA / B ANTIBODIES AND METHOD OF USE
IL276187B1 (en) * 2018-01-25 2026-02-01 Cullinan Mica Corp Mica/b antibodies and methods of use
US11939389B2 (en) 2018-06-13 2024-03-26 Novartis Ag BCMA chimeric antigen receptors and uses thereof
US11952428B2 (en) 2018-06-13 2024-04-09 Novartis Ag BCMA chimeric antigen receptors and uses thereof
KR20210071947A (ko) * 2018-07-31 2021-06-16 컬리난 미카 코퍼레이션 Mica/b 유출을 차단하는 항-mica/b 항체 및 사용 방법
KR102832008B1 (ko) 2018-07-31 2025-07-10 컬리난 미카 코퍼레이션 Mica/b 유출을 차단하는 항-mica/b 항체 및 사용 방법
IL280487B2 (en) * 2018-07-31 2025-07-01 Cullinan Mica Corp Anti-mica/b antibodies that block mica/b shedding and methods of use
IL280487B1 (en) * 2018-07-31 2025-03-01 Cullinan Mica Corp Anti-MICA/B antibodies that block MICA/B shedding and methods of use
JP2021532774A (ja) * 2018-07-31 2021-12-02 クリナン ミカ コーポレイション Mica/bシェディングをブロックする抗mica/b抗体および使用方法
JP7370376B2 (ja) 2018-07-31 2023-10-27 クリナン ミカ コーポレイション Mica/bシェディングをブロックする抗mica/b抗体および使用方法
US12065493B2 (en) 2018-07-31 2024-08-20 Cullinan Mica Corporation Anti-MICA/B antibodies that block MICA/B shedding and methods of use
JP2024009997A (ja) * 2018-07-31 2024-01-23 クリナン ミカ コーポレイション Mica/bシェディングをブロックする抗mica/b抗体および使用方法
RU2815101C2 (ru) * 2018-07-31 2024-03-11 Каллинен Майка Корп. Антитела против mica/b, блокирующие шеддинг mica/b, и способы их применения
WO2020028428A3 (en) * 2018-07-31 2020-05-07 Pdi Therapeutics, Inc. Anti-mica/b antibodies that block mica/b shedding and methods of use
WO2020035345A1 (en) 2018-08-14 2020-02-20 Innate Pharma Treatment of colorectal cancer by a combination of an anti-mica antibody and an anti-nkg2a antibody
WO2020127965A1 (en) 2018-12-21 2020-06-25 Onxeo New conjugated nucleic acid molecules and their uses
US12404331B2 (en) 2019-04-19 2025-09-02 Tcrcure Biopharma Corp. Anti-PD-1 antibodies and uses thereof
WO2020214957A1 (en) * 2019-04-19 2020-10-22 Tcrcure Biopharma Corp. Anti-pd-1 antibodies and uses thereof
EP4017876A4 (en) * 2019-08-23 2023-09-06 Northwestern University MATERIALS AND METHODS FOR ACTIVATING ANTIGEN-SPECIFIC T CELL RESPONSES
WO2021255223A1 (en) 2020-06-19 2021-12-23 Onxeo New conjugated nucleic acid molecules and their uses
US20230296611A1 (en) * 2020-08-10 2023-09-21 Innate Pharma Cell surface mica and micb detection using antibodies
WO2023111203A1 (en) 2021-12-16 2023-06-22 Onxeo New conjugated nucleic acid molecules and their uses
KR20230172384A (ko) * 2022-06-15 2023-12-22 주식회사 셀리드 자연 살해 t 세포의 리간드와 암 항원을 적재한 자연 살해 세포를 포함하는 백신
KR102783449B1 (ko) * 2022-06-15 2025-03-19 주식회사 셀리드 자연 살해 t 세포의 리간드와 암 항원을 적재한 자연 살해 세포를 포함하는 백신

Also Published As

Publication number Publication date
JP2016512223A (ja) 2016-04-25
AU2014229476A1 (en) 2015-10-01
JP6518199B6 (ja) 2019-06-12
JP2019194180A (ja) 2019-11-07
AU2014229476B2 (en) 2019-07-11
US20160046689A1 (en) 2016-02-18
EP2970490A4 (en) 2017-04-26
JP6518199B2 (ja) 2019-05-22
CA2906356A1 (en) 2014-09-18
US10851148B2 (en) 2020-12-01
US20210040173A1 (en) 2021-02-11
EP2970490A2 (en) 2016-01-20
WO2014140904A3 (en) 2014-12-31

Similar Documents

Publication Publication Date Title
US20210040173A1 (en) Antibodies to mica and micb proteins
US11066471B2 (en) Antibodies to MICA and MICB proteins
US11945873B2 (en) Antitumor antagonists
US20250289880A1 (en) Use of anti-fam19a5 antibodies for treating cancers
US20180154064A1 (en) Methods and devices for removal of immunosuppressive ligands
KR20210015902A (ko) Psma 결합제 및 이의 용도
ES2984950T3 (es) Anticuerpos específicos para CD3 y sus usos
US20180243434A1 (en) Antibodies having specificity to nectin-4 and uses thereof
JP7716623B2 (ja) 排出ポンプ-癌抗原マルチ特異性抗体ならびにそれに関する組成物、試薬、キットおよび方法
KR20230159823A (ko) Cd112r에 대한 항체 및 이의 용도
US20260028405A1 (en) Anti-cd16a antibodies and methods of use thereof
NZ751584B2 (en) Antibodies to mica and micb proteins
NZ751584A (en) Antibodies to mica and micb proteins
RU2811431C2 (ru) Антитело против клаудина 18a2 и его применение
RU2780537C2 (ru) Cd3-специфические антитела и их применение
HK40046552B (zh) 对cd3特异性的抗体及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14762844

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2906356

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 14776640

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015562400

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2014229476

Country of ref document: AU

Date of ref document: 20140315

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014762844

Country of ref document: EP