WO2014138670A1 - Ptd-smad7 therapeutics - Google Patents
Ptd-smad7 therapeutics Download PDFInfo
- Publication number
- WO2014138670A1 WO2014138670A1 PCT/US2014/022052 US2014022052W WO2014138670A1 WO 2014138670 A1 WO2014138670 A1 WO 2014138670A1 US 2014022052 W US2014022052 W US 2014022052W WO 2014138670 A1 WO2014138670 A1 WO 2014138670A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- smad7
- protein
- nucleic acid
- tat
- human
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/162—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/02—Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/23—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a GST-tag
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16311—Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16311—Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
- C12N2740/16322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
Definitions
- Oral mucositis a severe oral ulceration, is a common adverse effect of a large dose of radiation for bone marrow transplant or craniofacial radiotherapy for cancer. Severe oral mucositis could require feeding tubes, management of severe pain, and prematurely halting radiotherapy. Excessive inflammation and epithelial ablation are key features of oral mucositis.
- Palifermin a KGF (human keratinocyte growth factor) recombinant protein
- KGF human keratinocyte growth factor
- Palifermin reduced severe oral mucositis incidence from 67% and 69% to 51% and 54%, respectively.
- Other oral mucositis drugs in clinical trials or pre-clinical studies include growth factors, agents for
- inflammation, tissue formation, and tissue remodeling are dynamic processes that involve interactions among the epidermis, leukocytes, extracellular matrix (ECM), and dermal fibroblasts.
- ECM extracellular matrix
- dermal fibroblasts In response to skin injury, blood clots, infiltrated inflammatory cells and other cell types in the wound release multiple cytokines and chemokines. These cytokines initiate fibroblast proliferation and synthesis of ECM that fill the wound deficit and lead to wound closure.
- keratinocytes at the wound edge begin to proliferate and migrate to cover the wound surface.
- new stroma Underneath the re-epithelialized epidermis, new stroma, called granulation tissue, begins to fill the wound space, which contains provisional ECM, inflammatory cells, fibroblasts, and blood vessels.
- the process of wound closure is completed. Later on, the wound gradually returns to normal strength and texture through tissue remodeling.
- TGF- ⁇ transforming growth factor ⁇
- TGFPRI and TGF ⁇ RII TGF- ⁇ type I and type II receptors
- Phosphorylated Smad2 and Smad3 bind a co-Smad, Smad4, to form heteromeric Smad complexes and translocate into the nucleus to regulate transcription of TGF- ⁇ target genes.
- TGF- ⁇ signaling has been reported to exert both positive and negative effects on wound healing (Wang et al, J Inves tig Dermatol Symp Proc 1 1 : 112-117, 2006).
- Smad3 deficient mice in which TGF- ⁇ signaling is partially abrogated, exhibit accelerated wound healing (Ashcroft et al, Nat Cell Biol 1 :260-266, 1999).
- the introduction of exogenous Smad3 to wound sites to enhance TGF- ⁇ signaling also accelerated wound healing in a rabbit dermal ulcer model (Sumiyoshi et al, J Invest Dermatol 123:229-236, 2004).
- Smad7 gene transfer to the lens epithelium and stroma prevented injury-induced epithelial-mesenchymal transition of lens epithelial cells and suggests a potential role of Smad7 in prevention of capsular fibrosis (Saika et al, Lab Invest 84: 1259-1270, 2004).
- adenoviral vector delivery of Smad7 to balloon injury in rat carotid arteries resulted in reduced vascular healing (Mallawaarachchi et al. , Arterioscler Thromb Vase Biol 25: 1383-1387, 2005).
- Smad7 may not always be explained by its role in TGF- ⁇ signaling.
- Smad7 has also been shown to interact with components of the Wnt/p-catenin (Han et al., Dev Cell Biol 1 1 :301-312, 2006) and the TNFp/NF- ⁇ (Hong et al, Nat Immunol 8:504-513, 2007) families.
- the present technology provides a nucleic acid molecule comprising a codon-optimized human Smad7 cDNA nucleotide sequence.
- the codon-optimized human Smad7 nucleotide sequence may include one or more codons for arginine optimized for expression in one or more of bacteria or yeast, including one or more codons for serine optimized for expression in one or more of bacteria or yeast, and/or including one or more codons for histidine optimized for expression in one or more of bacteria or yeast.
- the codon-optimized human Smad7 nucleotide sequence may include 28 serine codons, 6 histidine codons, and 9 arginine codons optimized for expression in one or more of bacteria or yeast. In some embodiments, the
- codon-optimized human Smad7 nucleotide sequence may be selected from the group consisting of SEQ ID Os: 9, 10, 11, 21, 23-41. In some embodiments, the
- codon-optimized human Smad7 nucleotide sequence may have about 65 to 75 percent homology to human Smad7 cDNA, may comprise a nucleotide sequence encoding an N-terminal fragment SMAD7, may comprise a nucleotide sequence encoding a C-terminal fragment of SMAD7, may comprise nucleotides encoding amino acids 2-258 of the human Smad7 protein, may comprise nucleotides encoding amino acids 259-426 of the human Smad7 protein, or may comprise nucleotides encoding amino acids 204-258 of the human Smad7 protein.
- any of the foregoing may further comprise a nucleotide sequence encoding a protein transduction domain, such as Tat.
- any of the foregoing may also further comprise a nucleotide sequence encoding one or more of an epitope tag or a purification tag, such as V5,
- any of the foregoing may be isolated and/or purified.
- any one of the foregoing may also encode a polypeptide having one or more biological activities selected from the group consisting of reducing or eliminating phosphorylation of Smad2, reducing or eliminating nuclear translocation of the NF- ⁇ p50 subunit, increasing cell proliferation, reducing apoptosis, reducing radiation-induced DNA damage, reducing inflammation, reducing angiogenesis, promoting healing in oral mucositis, promoting wound healing, and treating auto-immune disease.
- compositions comprising the nucleic acid molecules above and one or more pharmaceutically acceptable excipients are provided.
- expression vectors comprising the nucleic acid molecules above operably linked to a promoter are provided, as are host cells comprising such expression vectors, and pharmaceutical compositions comprising such vectors and host cells with one or more pharmaceutically acceptable excipients.
- a protein molecule comprising a human Smad7 protein having leucine at position 216 is provided.
- the human Smad7 protein may be truncated at the C-terminal, or truncated at the N-terminal.
- the truncated human Smad7 protein may include about 50% of the full-length Smad7 sequence, or may include about 13% of the full-length Smad7 sequence.
- the human Smad7 protein may comprise or consist of amino acids 2-258, amino acids 204-258, or amino acids 259-426 of the human Smad7 protein.
- the protein molecule may have one or more biological activities selected from the group consisting of reducing or eliminating phosphorylation of Smad2, reducing or eliminating nuclear translocation of the F- ⁇ p50 subunit, increasing cell proliferation, reducing apoptosis, reducing radiation-induced DNA damage, reducing inflammation, reducing angiogenesis, promoting healing in oral mucositis, promoting wound healing, and treating auto-immune disease.
- any of the foregoing may further comprise a protein transduction domain, such as Tat.
- any of the foregoing may also further comprise one or more of an epitope tag or a purification tag, such as V5,
- a pharmaceutical composition comprising any of the foregoing, a protein molecule, and one or more pharmaceutically acceptable excipients is provided. [0013] In another aspect, a method is provided for treating or preventing an
- inflammatory condition in a subject comprising providing to the subject a therapeutically effective amount of the pharmaceutical composition described above.
- the inflammatory condition may be one or more of a chronic wound, skin inflammation, psoriasis, or an autoimmune disease.
- the composition may reduce inflammation through inhibition of TGF- ⁇ and NF- ⁇ signaling.
- a method for preventing or treating a disease or disorder in a subject comprising one or more of increasing one or more of cell proliferation or cell migration, or preventing one or more of apoptosis or DNA damage in the subject comprising providing to the subject a therapeutically effective amount of the pharmaceutical composition as described above, wherein one or more of increasing one or more of cell proliferation or cell migration, or preventing one or more of apoptosis or DNA damage is useful in preventing or treating the disease or disorder.
- the disease or disorder may include one or more of chronic wounds, acute wounds, or mucositis.
- the chronic wounds may include one or more of diabetic ulcers, pressure ulcers, venous ulcers, or oral ulcers
- the acute wounds may include one or more of trauma-induced wounds, surgical wounds, or scarring
- the mucositis may include one or more of radiation- induced mucositis or chemotherapy-induced mucositis
- the mucositis may include one or more of oral mucositis or gut mucositis.
- FIGS. 1A-G provide an illustrative embodiment of data showing that K5.Smad7 mice were resistant to radiation-induced oral mucositis.
- FIG. 1A provides an illustrative embodiment of H&E staining in non-irradiated and irradiated (day 9 after initiation of radiation) wild-type (WT) and K5.Smad7 tongues.
- the vertical lines in the images of tongues from WT mice highlight the ulcer boundary and dotted lines in the images indicate the epithelial-stromal boundary (scale bar, 50 ⁇ ).
- FIG. 1A provides an illustrative embodiment of H&E staining in non-irradiated and irradiated (day 9 after initiation of radiation) wild-type (WT) and K5.Smad7 tongues.
- the vertical lines in the images of tongues from WT mice highlight the ulcer boundary and dotted lines in the images indicate the epithelial-stromal boundary (scale bar, 50 ⁇ ).
- FIG. 1C provides an illustrative embodiment of human ventricular posterior of the tongue (top) and radiation-induced tongue mucositis (bottom) visualized using H&E (left) and CD45 staining (right). The solid line indicates the ulcer boundary, and dotted lines indicate the basement membrane (scale bar, 25 ⁇ ).
- FIGS. 2A-G provide an illustrative embodiment of data showing molecular alterations attenuated by Smad7.
- FIG. 2A provides an illustrative embodiment of immune-staining of NF- ⁇ p50, TGF- ⁇ and pSmad2. Irradiated tongue sections of wild-type (WT) were adjacent to ulcer and sections of K5.Smad7 were from the damaged area. Human samples were from non-irradiated oral mucosa and radiation-induced mucositis. Dotted lines delineate epithelial-stromal boundary. Scale bar, 25 ⁇ for all panels.
- FIG. 2B provides a graphical representation of the quantification of
- FIG. 2E provides an illustrative embodiment of a western analysis of knockdown efficiency of siSmad7-l and siSmad7-2 for Smad7 and for Racl, 72 hours after Smad7 knockdown.
- FIG. 2F provides an illustrative embodiment of western analysis of total and activated (GTP-bound) Racl protein. M: molecular markers.
- FIGS. 3A-H provide an illustrative embodiment of data showing Smad7 increased Racl expression by repressing individual Smad and CtBPl binding to the SBE of the Racl promoter.
- FIG. 3B provides an illustrative embodiment of western analysis of GTP-Rac 1 and total Racl in WT and Smad7 keratinocytes. Smad7 protein levels in WT and Smad7
- FIG. 3C provides an illustrative embodiment of western analysis of Racl protein level after knocking down individual Smad2, Smad3 or Smad4 in human keratinocytes (see FIG. lOC-lOE for Smad knockdown efficiencies).
- FIG. 3D provides an illustrative embodiment of a ChIP assay for Smad-2, -3, -4, and -7 binding to the -1.5 Kb SBE site of the Racl promoter in WT and Smad7 transgenic keratinocytes.
- FIG. 3E provides a graphical representation of the quantification oiRacl luciferase reporter assay in mouse keratinocytes. Scrambled:
- FIG. 3F provides a graphical representation of the
- FIG. 3G provides an illustrative embodiment of images of ChIP assays of CtBPl binding to the SBE-1.5 Kb site of the Racl promoter in WT or K5.Smad7 keratinocytes.
- FIG. 3H provides a graphical representation of ChlP-qPCR quantification of CtBPl binding to the SBE shown in FIG. 3G in WT and Smad7 transgenic keratinocytes.
- n 4.
- Data are presented as mean ⁇ s.d. and two-tail Student's /-test is used to calculate P values for FIGs. 3A, 3E, 3F and 3H. *P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001.
- FIGS. 4A-G provide an illustrative embodiment of data showing
- FIG. 4A provides an illustrative embodiment of western analysis of Racl protein after knockdown of CtBP l in human oral keratinocytes.
- FIG. 4D provides an illustrative
- FIG. 4E provides an illustrative embodiment of immunostaining of CtBP l in non-irradiated oral mucosa and radiation-induced oral mucositis in human specimens. Dotted lines denote the basement membrane. Scale bar, 50 ⁇ for both panels.
- FIGS. 5A-G provide an illustrative embodiment of data showing oral Tat-Smad7 application prevented radiation-induced oral mucositis in mice.
- FIG. 5A provides a graphical representation of the quantification of oral mucositis ulcer sizes on day 9 after initiation of 8 Gy x 3 radiation.
- Vehicle saline or 50% glycerol/PBS.
- FIG. 5B provides an illustrative embodiment of pathological alterations on day 9 of initiation of 8 Gy x 3 radiation.
- Vehicle saline or 50% glycerol/PBS.
- Scale bar 50 ⁇ for H&E panels and 25 ⁇ for remaining panels. Dotted lines delineate epithelial-stromal boundary; the solid line highlights the ulcer boundary.
- FIGS. 5A provides a graphical representation of the quantification of oral mucositis ulcer sizes on day 9 after initiation of 8 Gy x 3 radiation.
- Vehicle saline or 50% glycerol/PBS.
- Scale bar
- 5C, 5D, 5E, 5F, and 5G provide a graphical representation of the quantification of immunostaining shown in FIG. 5B.
- n 3 or 4 per group.
- Data are presented as mean ⁇ s.e.m (FIG. 5A) or mean ⁇ s.d. (FIGS. 5C-5G) and two-tail Student's ⁇ -test is used to calculate P values. *P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001. NS, no significance.
- FIGS. 6A-G provide an illustrative embodiment of data showing Tat-Smad7 treatment on oral mucositis.
- FIG. 6A provides a graphical representation of the
- FIG. 6B provides an illustrative embodiment of H&E staining of oral mucosa. Upper panels: open ulcer in Palifermin treated but not Tat-Smad7 treated mucosa. Lower panels: comparison of epithelial thickness between Palifermin treated and Tat-Smad7 treated mucosa. Dotted lines delineate the basement membrane. The vertical line highlights the ulcer boundary. Scale bar, 50 ⁇ for all panels.
- FIG. 6C provides an illustrative embodiment of immune-staining of Tat-Smad7 treatment in 20 Gy-induced oral mucositis after ulcers healed. V5 immunostaining visualizes Tat-Smad7 in oral epithelia (sections are away from the damaged regions).
- FIG. 6D provides an illustrative embodiment of Racl western analysis of Tat-Smad7 treated mouse tongues, day 10 after initiation of 8 Gy x 3 radiation.
- FIG. 6E provides an illustrative embodiment of Racl western analysis on Tat-Smad7 treated normal human oral keratinocytes 48 hours after treatment.
- FIG. 6G provides a graphical representation of the quantification of survival curves of NOK-SI keratinocytes and SCC lines (Cal27 and
- FIGS. 7A-E provide an illustrative embodiment of data showing K5.Smad7 oral mucosal tissues were resistant to radiation-induced oral mucositis.
- FIG. 7A provides an illustrative embodiment of Smad7 western blots: undetectable in non-irradiated wild-type (WT) tongue and barely detectable after radiation. K5.Smad7 tongues have comparable Smad7 protein levels before and after radiation. M: molecular marker.
- FIG. 7B provides an illustrative embodiment of Smad7 immunostaining. Note that nuclei in some irradiated epithelial cells are hypertrophic. Dotted lines delineate epithelial-stromal boundary. FIG.
- FIG. 7D provides an illustrative embodiment of immune-staining of K5.Smad7 tongue showing reduced infiltration of neutrophils (Ly-6G), macrophages (BM8) and activated T cells (CD4) compared to WT oral mucositis. Dotted lines delineate epithelial-stromal boundary.
- FIG. 7E provides an illustrative embodiment of
- FIGS. 8A-D provide an illustrative embodiment of data showing migration in spontaneously immortalized human oral epithelial cells (NOK-SI) was delayed by knocking down Smad7 but accelerated by knocking down TGF- ⁇ .
- FIGS. 8A and 8B provide an illustrative embodiment of representative images of cell migration. Pairs of dotted lines delineate the scratch wound. Quantification of cell migration and efficiency of Smad7 knockdown are presented in FIG. 2D and FIG. 2E (above). Scrambled, scrambled siRNA.
- FIG. 8C provides a graphical representation of the quantification of cell migration after TGF- ⁇ knockdown from 3 separate experiments.
- 8D provides a graphical representation of qRT-PCR showing TGF- ⁇ knockdown efficiency. Data are presented as mean ⁇ s.d. and two-tail Student's Mest was used to calculate P values. *P ⁇ 0.05, **P ⁇ 0.01. NS, no significance.
- FIGS. 9A-D provide an illustrative embodiment of data showing knocking down Racl reduced proliferation and migration of wild-type (WT) and Smad7 transgenic keratinocytes.
- FIG. 9A provides an illustrative embodiment of western blot analysis for Racl 48 hours after Racl siRNA (siRacl-1, siRacl-2) transfection. Control, scrambled siRNA.
- FIG. 9B provides a graphical representation of the percentage of BrdU labeled cells in WT and Smad7 cultured cells in BrdU incorporation assay with or without Racl knockdown. Data from 3 separate experiments were presented as mean ⁇ s.d. ***p ⁇ 0.001.
- FIG. 9A provides an illustrative embodiment of western blot analysis for Racl 48 hours after Racl siRNA (siRacl-1, siRacl-2) transfection. Control, scrambled siRNA.
- FIG. 9B provides a graphical representation of the percentage of Br
- FIG. 9C provides an illustrative embodiment of representative immunofluorescence of BrdU positive cells presented in (FIG. 9B).
- An antibody against keratin 14 (K14, red) was used for counterstain.
- FIG. 9D provides an illustrative embodiment of in vitro cell migration assay for Smad7 transgenic and WT keratinocytes after Racl knockdown. Pairs of dotted lines delineate the scratch wound. Quantification of cell migration is presented in FIG. 2G.
- FIGS. 10A-F provide an illustrative embodiment of data showing Smad7 increased Racl expression by repressing Smad and CtBP l binding to the SBE of the Racl promoter.
- FIG. 10A provides an illustrative embodiment of western blot analysis for GTP-Racl and total Racl in Smad7 transgenic keratinocytes. Additional samples are shown in FIG. 3B. M, molecular marker.
- FIG. 10B provides a graphical representation of the quantification of GTP-Racl, total Racl and Smad7 in WT and K5.Smad7 keratinocytes shown in FIG 10A and in FIG. 3B.
- FIGS. IOC and 10D provide an illustrative embodiment of western blot analysis for Smad2, Smad3, and Smad4 knockdown in NOK-SI cells. Their effects on Racl expression are shown in FIG. 3C. M, molecular marker. GAPDH, internal protein control by reprobing same blot.
- FIG. 10F provides an illustrative embodiment showing CtBP 1 knockdown promotes NOK-SI cell migration. Pairs of dotted lines delineate the scratch wound. Quantification of cell migration and efficiency of CtBP 1 knockdown are shown in FIG. 4A and FIG. 4C.
- FIGS. 11A-G provide an illustrative embodiment of data showing the purification and characterization of Tat-Smad7 and Tat-Cre proteins.
- FIG. 11A shows an illustrative embodiment of a schematic representation of Tat-Smad7 protein.
- FIG. 11B provides an illustrative embodiment of a western blot of purified Tat-Smad7 protein.
- FIG. llC provides an illustrative embodiment of immune-staining of Tat-Smad7 protein transduction in keratinocytes.
- Left and middle panels Tat-Smad7 staining (green) using a V5 antibody, counterstained with a K14 antibody (red).
- FIG. 11D provides an illustrative embodiment of immune-staining showing that V5 antibody staining detects Tat-Smad7 transduction in buccal mucosa 12 hours after Tat-Smad7 topical application. A K14 antibody was used for counterstain. Scale bar, 50 ⁇ for both panels.
- FIG. 11F provides an illustrative embodiment of an agarose gel showing activity of Tat-Cre: Tat-Cre cuts out a 1,460 bp floxed fragment from the 7,650 bp vector pLL3.7.
- FIG. 11G provides a graphical representation showing Tat-Smad7 protein preventive treatment reduced 20 Gy radiation-induced oral ulcers. Data are expressed as mean ⁇ s.e.m. Two-tail Student's ?-test is used to calculate P values. *P ⁇ 0.05, ***P ⁇ 0.001.
- FIGS. 12A-I provide an illustrative embodiment of data showing effects of Tat-Smad7 treatment on oral mucositis.
- FIG. 12B provides an illustrative embodiment of immunostaining of molecular markers for samples from FIG. 12A. Scale bar, 50 ⁇ for the top two panels and 25 ⁇ for other panels. Propidium iodide (PI) and K14 were used as counterstain.
- FIGS. 12C-G provide graphical representation of the quantifications of immunostaining shown in FIG.
- FIG. 12C provides a graphical representation quantification of the Luciferase assay.
- Tat-Smad7 treatment increased the activity of the Racl promoter with SBE but not the mutant SBE in mouse keratinocytes.
- FIG. 121 provides an illustrative embodiment of a ChIP assay for CtBPl binding to the SBE of mouse Racl promoter in Tat-Smad7 treated mouse keratinocytes. Data are expressed as mean ⁇ s.e.m (a) or mean ⁇ s.d (c-h) and two-tail Student's ⁇ -test is used to calculate P values. *P ⁇ 0.05, **P ⁇ 0.01, ***P ⁇ 0.001. NS, no significance.
- FIGS. 13A-H provide an illustrative embodiment of data showing effects of Tat-Smad7 treatment on migration of human keratinocytes and tumor cell lines.
- FIG. 13A provides an illustrative embodiment showing Tat-Smad7 accelerates NOK-SI cell migration. Quantification from four separate experiments is shown in FIG. 6F (above). Pairs of dotted lines delineate initial wounds.
- FIG. 13B provides an illustrative embodiment of immunostaining of Tat-Smad7 treatment in NOK-SI cells showing attenuated
- FIG. 13C provides an illustrative embodiment showing V5 staining of MSK921 cells 2 hours after Tat-Smad7 treatment. K14 staining was used as counterstain.
- FIG. 13D provides an illustrative embodiment of a Racl western analysis in MSK921 60 hours after Tat-Smad7 treatment. M, molecular marker.
- FIG. 13E provides a graphical representation of quantification of MSK921 cell migration from 3 separate experiments.
- FIG. 13F provides an illustrative embodiment showing a representative MSK921 cell migration assay treated with Tat-Smad7 and PBS. Pairs of solid lines delineate initial wounds. Dotted lines highlight the forefront of migrated cells.
- FIG. 13G provides a graphical representation of quantification of Cal27 cell migration from 3 separate experiments.
- FIG. 13H provides an illustrative embodiment showing representative images for FIG. 13G. Pairs of solid lines delineate initial wounds. Dotted lines highlight the forefront of migrated cells. Data are expressed as mean ⁇ s.d. and the two-tail Student's /-test is used to calculate P values. NS, no significance.
- FIGS. 14A-B show an illustrative schematic of a summary of potential mechanisms of Smad7-mediated protection and healing of oral mucositis.
- FIG. 14A shows an illustrative schematic of how radiation activates NF- ⁇ , increases TGF- ⁇ and CtBPl .
- NF-KB and TGF- ⁇ induce inflammation.
- TGF- ⁇ induces apoptosis, growth arrest and activates Smad-2, -3 and -4, which recruit CtBPl to the Racl promoter to repress Racl transcription, leading to blunted re-epithelialization.
- FIG. 14A shows an illustrative schematic of how radiation activates NF- ⁇ , increases TGF- ⁇ and CtBPl .
- NF-KB and TGF- ⁇ induce inflammation.
- TGF- ⁇ induces apoptosis, growth arrest and activates Smad-2, -3 and -4, which recruit CtBPl to the Racl promoter to repress Racl transcription, leading
- Smad7 relieves Racl transcriptional repression by either preventing TGF- ⁇ -mediated Smad activation (phosphorylation) or competing with signaling Smads/CtBPl transcriptional repression complex in binding to the Racl promoter. Increased Racl induced by Smad7 contributes to keratinocyte migration during re-epithelialization.
- FIG. 15 shows an illustrative schematic of Smad 7 domains associated with protein partners, potential target effects, and potential physiological effects.
- FIGS. 16A-B are graphs demonstrating the ability of truncated Smad7 proteins to accelerate wound healing in a mouse wound healing model.
- FIGS. 17A-C are photographs and graphs demonstrating that Smad7 accelerates wound healing in an impaired wound-healing model.
- FIG. 17A is a digital photograph illustrating the gross appearance of wounds in diabetic (db/db) mice treated with PBS or Tat-Smad7 over a time period of thirteen days.
- FIG. 17C is a histological comparison of wound samples taken eight days after wounding.
- the disclosure provides Smad7 proteins and biologically active fragments and derivatives thereof, nucleic acids encoding such proteins, vectors including such nucleic acids, and cells encompassing the vectors, nucleic acids, and/or proteins all for use in formulating medicaments and for treating and/or preventing one or more diseases or disorders. Also provided are methods for making and for screening Smad7 proteins and biologically active fragments and derivatives thereof useful for treating and/or preventing one or more diseases or disorders. Also provided are methods for predicting and/or evaluating a response to treatment using one or more markers associated with exposure to Smad7. Such markers may include, but are not limited to, Racl for cell migration, NF- ⁇ for inflammation, and TGF- ⁇ for growth arrest and inflammation.
- Smad7 treatable diseases and disorders may include those including one or more of reduced cell proliferation, reduced cell migration, increased cell death, excessive inflammation, and/or DNA damage.
- Smad7 treatable diseases and disorders may include those where treatment with a Smad7 protein and biologically active fragments and derivatives thereof that have one or more activities including but not limited to increasing proliferation, reducing or inhibiting cell death, reducing excessive inflammation, preventing DNA damage, and/or increasing cell migration.
- Such diseases and/or disorders may include but are not limited to acute (e.g., through surgery, combat, trauma) and chronic wounds (e.g., ulcers, such as diabetic, pressure, venous), scarring, fibrosis, and aberrant healing, mucositis (e.g., oral and/or gastro-intestinal), stomatitis, proctitis, autoimmune disease (e.g., psoriasis, arthritis), and cancer.
- Smad-dependent Racl repression overcomes Smad- independent Racl activation (if any) due to increased Smad signaling (evidenced by increased pSmad2) and Smad transcriptional co-repressor CtBP 1.
- Smad7 Smad-dependent Racl activation
- Smad7-mediated abrogation oiRacl repression would no longer occur.
- Racl activation also contributed to keratinocyte proliferation, knocking down Racl only partially attenuated the proliferative effect of Smad7. Therefore, Racl 's contribution to proliferation appears to be limited, and blocking TGF- ⁇ -induced growth arrest is also needed to overcome radiation-induced growth inhibitory effects.
- Smad7 did not reduce NF- ⁇ or TGF- ⁇ signaling below their normal physiological conditions. This incomplete blockade of NF- ⁇ or TGF- ⁇ signaling may be beneficial to oral mucositis healing, as a complete loss of either pathway could induce excessive inflammation.
- the primary obstacle to using growth factors to treat oral mucositis in cancer patients is the potential risk of promoting cancer cell growth. The majority of human oral cancers lose TGF- ⁇ signaling in tumor epithelial cells. Thus, anti-Smad-associated cell proliferation and migration by Smad7 would not be effective in cancer cells. In tumors with intact TGF- ⁇ signaling, activation of other oncogenic pathways could override
- TGF- ⁇ signaling promotes tumor invasion mainly through
- TGF- ⁇ signaling by Smad7 in cancer cells could abrogate TGF-p-mediated tumor promotion effects, which behaves similarly to TGF- ⁇ inhibitors currently being used in clinical trials for advanced cancers.
- the potent anti-inflammatory effect of Smad7 may reduce the risk of tumor progression. Therefore, long-term Smad7 application may also be helpful in cancer treatment.
- Smad7 is not a secreted protein
- local and short-term Smad7 protein delivery in oral mucositis treatment should have few systemic effects.
- Smad7 topical application may be suitable for both prevention and treatment of oral mucositis.
- Smad7-mediated oral mucositis healing appears to be a result of targeting multiple pathogenic processes mediated by one or more molecules (see, e.g., FIGS. 14A-B). It is believed that one or more of these molecules (e.g., TGF- ⁇ , NF-KB, CtBPl, Racl) may also be helpful as predictive and therapeutic responsive markers of oral mucositis in patients.
- these molecules e.g., TGF- ⁇ , NF-KB, CtBPl, Racl
- the present disclosure also provides, in another embodiment, genes encoding Smad7.
- genes encoding Smad7 In addition to the wild-type SMAD7 gene (SEQ ID NOs: 12, 22), as well as various codon-optimized versions (SEQ ID NOs: 9-11, 21, 23-41), it should be clear that the present technology is not limited to the specific nucleic acids disclosed herein.
- a "Smad7 gene” may contain a variety of different bases and yet still produce a corresponding polypeptide that is functionally indistinguishable from, and in some cases structurally identical to, the human gene disclosed herein.
- Nucleic acids according to the present technology may represent an entire Smad7 gene, a truncated portion, and/or a fragment of Smad7 that expresses a polypeptide with one or more activity associated with Smad7 such as but not limited to increasing proliferation, reducing or inhibiting cell death, reducing excessive inflammation, preventing DNA damage, and/or increasing cell migration, as well as treating or preventing one or more disease or disorders in which such treatment would be helpful as further discussed herein.
- Such activities can be assessed using one or more assays including, but not limited to, the ability to block phosphorylation of Smad2 and/or nuclear translocation of the NF- ⁇ p50 subunit, increase cell proliferation, reduce apoptosis and/or radiation-induced DNA damage, reduce inflammation and/or angiogenesis, promote healing in oral mucositis, surgical wounds, diabetes wounds, and/or wounds associated with chronic inflammation in mice.
- the nucleic acid may be derived from genomic DNA, i.e., cloned directly from the genome of a particular organism. In particular embodiments, however, the nucleic acid would comprise complementary DNA (cDNA). Also provided is a cDNA plus a natural intron or an intron derived from another gene; such engineered molecules are sometime referred to as
- mini-genes At a minimum, these and other nucleic acids of the present technology may be used as molecular weight standards in, for example, gel electrophoresis.
- cDNA is intended to refer to DNA prepared using messenger RNA (mRNA) as template.
- mRNA messenger RNA
- a nucleic acid encoding a Smad7 may refer to a nucleic acid molecule that has been isolated free of total cellular nucleic acid and/or may refer to a cDNA encoding a Smad7 polypeptide.
- isolated free of total cellular nucleic acid means that the nucleic acid molecule is about or at least about 75% pure, 80% pure, 85% pure, 90% pure, 95% pure, 96% pure, 97% pure, 98% pure, 99% pure, or 100% pure of other cellular nucleic acid molecules as determined using standard biochemical techniques, such as but not limited to agarose gel electrophoresis.
- the term "isolated free of total cellular protein” means that the protein molecule is about or at least about 75% pure, 80% pure, 85% pure, 90% pure, 95% pure, 96% pure, 97% pure, 98% pure, 99% pure, or 100% pure of other cellular nucleic acid molecules as determined using standard biochemical techniques, such as but not limited to a western blot.
- the present technology concerns a nucleic acid sequence essentially as set forth in, and/or including any one of SEQ ID NOs: 9-11, 21, 23-41.
- An isolated nucleic acid molecule may be produced using recombinant DNA technology (e.g., polymerase chain reaction (PCR) amplification, cloning) or chemical synthesis.
- Isolated nucleic acid molecules include natural nucleic acid molecules and homologues thereof, including, but not limited to, natural allelic variants and modified nucleic acid molecules in which nucleotides have been inserted, deleted, substituted, and/or inverted in such a manner that such modifications provide the desired effect (e.g., production of Smad7 protein in non-human expression systems).
- nucleic acid sequence substantially corresponds to at least a portion, and in some cases the entirety, of the one or more nucleic acid sequence (e.g., SEQ ID NOs: 9-11, 21, 23-41.
- sequences that substantially correspond to at least a portion of a nucleic acid sequence may correspond to about, or at least about 50 nucleic acids, 75 nucleic acids, 150 nucleic acids, 200 nucleic acids, 250 nucleic acids, 300 nucleic acids, 350 nucleic acids, 400 nucleic acids, 450 nucleic acids, 500 nucleic acids, 550 nucleic acids, 600 nucleic acids, 650 nucleic acids, 700 nucleic acids, 750 nucleic acids, 800 nucleic acids, 900 nucleic acids, 1000 nucleic acids, 1100 nucleic acids, 1200 nucleic acids, or 1250 nucleic acids of one or more of the sequences described herein.
- sequences that substantially correspond to at least a portion of a nucleic acid sequence may correspond to about a range of about 50-1250 nucleic acids, 75-1250 nucleic acids, 150-1250 nucleic acids, 200-1250 nucleic acids, 250-1250 nucleic acids, 300-1250 nucleic acids, 350—1250 nucleic acids, 400-1250 nucleic acids, 450-1250 nucleic acids, 500-1250 nucleic acids, 550-1250 nucleic acids, 600-1250 nucleic acids, 650-1250 nucleic acids, 700-1250 nucleic acids, 750-1250 nucleic acids, 800-1250 nucleic acids, 900-1250 nucleic acids, 1000-1250 nucleic acids, 1 100-1250 nucleic acids, 1200-1250 nucleic acids, at least about 50-75 nucleic acids, 75-150 nucleic acids, 75-200 nucleic acids, 75-250 nucleic acids, 75-300 nucleic acids, 75-350 nucleic acids, 75-
- sequences that substantially correspond to at least a portion of a nucleic acid sequence include identical sequences to that portion of the nucleic acid sequence.
- sequences that substantially correspond to at least a portion of a nucleic acid sequence or the entirety of a nucleic acid sequence may include one or more functionally equivalent codons.
- the term "functionally equivalent codon” is used herein to refer to one or more codons that encode the same amino acid, such as the six codons for arginine or serine, and in some embodiments refers to codons that encode biologically equivalent amino acids, as discussed in the following pages.
- biologically equivalent amino acid is used herein to refer to one or more amino acids that when changed from the amino acid present in the amino acid sequence of human Smad7 wild-type protein, do not change one or more (or in some embodiments any) of the biological activities of Smad7 described herein, such as but not limited to, increasing proliferation, reducing or inhibiting cell death, reducing excessive inflammation, preventing DNA damage, and/or increasing cell migration, as well as treating or preventing one or more disease or disorders in which such treatment would be helpful as further discussed herein.
- sequences that have about or at least about 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, and/or 99% of nucleotides that are identical to the nucleotides of any one of the codon-optimized nucleic acid sequences may be considered substantially corresponding nucleic acid sequences.
- Sequences that are essentially the same as those set forth in any one of the nucleic acid sequences also may be functionally defined as sequences that are capable of hybridizing to a nucleic acid segment containing the complement of SEQ ID NOs: 9-11, 21, 23-41 under various standard conditions.
- relatively high stringency conditions For applications requiring high selectivity, one will typically desire to employ relatively high stringency conditions to form the hybrids. For example, relatively low salt and/or high temperature conditions, such as provided by about 0.02 M to about 0.10 M NaCl at temperatures of about 50 °C to about 70 °C.
- hybridization may occur even though the sequences of the hybridizing strands are not perfectly complementary, but are mismatched at one or more positions.
- Conditions may be rendered less stringent by increasing salt concentration and/or decreasing temperature.
- a medium stringency condition could be provided by about 0.1 to 0.25 M NaCl at temperatures of about 37 °C to about 55 °C, while a low stringency condition could be provided by about 0.15 M to about 0.9 M salt, at temperatures ranging from about 20 °C to about 55 °C.
- Hybridization conditions can be readily manipulated depending on the desired results.
- hybridization may be achieved under conditions of, for example, 50 mM Tris-HCl (pH 8.3), 75 mM KCl, 3 mM MgCl 2 , 1.0 mM dithiothreitol, at temperatures between approximately 20 °C to about 37 °C.
- Other hybridization conditions utilized could include approximately 10 mM Tris-HCl (pH 8.3), 50 mM KCl, 1.5 mM MgCl 2 , at temperatures ranging from approximately 40 °C to about 72 °C.
- the sequences are aligned for optimal comparison purposes (e.g., gaps are introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino acid or nucleic acid sequence).
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions can then be compared.
- a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
- Gapped BLAST may be utilized as described in Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402.
- the default parameters of the respective programs for example, XBLAST and NBLAST
- XBLAST and NBLAST are used. See the website of the National Center for Biotechnology Information for further details (on the World Wide Web at ncbi.nlm.nih.gov).
- Proteins suitable for use in the methods described herein also includes proteins having between 1 to 15 amino acid changes, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, or 15 amino acid substitutions, deletions, or additions, compared to the amino acid sequence of any protein described herein.
- the altered amino acid sequence is at least 75% identical, for example, 77%, 80%, 82%, 85%, 88%, 90%, 92%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any protein inhibitor described herein.
- sequence-variant proteins are suitable for the methods described herein as long as the altered amino acid sequence retains sufficient biological activity to be functional in the compositions and methods described herein. In certain instances conservative amino acid substitutions are utilized.
- Illustrative conservative substitution among amino acids are within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine.
- the BLOSUM62 table is an amino acid substitution matrix derived from about 2,000 local multiple alignments of protein sequence segments, representing highly conserved regions of more than 500 groups of related proteins (Henikoff et al. (1992), Proc. Natl Acad. Sci. USA, 89: 10915-10919).
- the BLOSUM62 substitution frequencies can be used to define conservative amino acid substitutions that, in some embodiments, are introduced into the amino acid sequences described or disclosed herein. Although it is possible to design amino acid substitutions based solely upon chemical properties (as discussed above), the language "conservative amino acid substitution” preferably refers to a substitution represented by a BLOSUM62 value of greater than -1. For example, an amino acid substitution is conservative if the substitution is characterized by a BLOSUM62 value of 0, 1, 2, or 3.
- preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 1 (e.g., 1, 2 or 3), while more preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 2 (e.g., 2 or 3).
- the DNA segments of the present technology include those encoding biologically functional equivalent Smad7 proteins and peptides, as described above. Such sequences may arise as a consequence of codon redundancy and amino acid functional equivalency that are known to occur naturally within nucleic acid sequences and the proteins thus encoded.
- functionally equivalent proteins or peptides may be created via the application of recombinant DNA technology, in which changes in the protein structure may be engineered, based on considerations of the properties of the amino acids being exchanged. Changes designed by man may be introduced through the application of site-directed mutagenesis techniques or may be introduced randomly and screened later for the desired function, as described elsewhere.
- the Smad7 nucleic acid sequence has been optimized for expression in alternative host organisms (e.g., non-human).
- the genetic code is degenerate, so frequently one amino acid may be coded for by two or more nucleotide codons.
- multiple nucleic acid sequences may encode one amino acid sequence.
- the nucleic acids themselves are distinct, and can have distinct properties.
- one aspect of the choice of codon usage can be (but is not limited to) the ability to express a protein in a non-native cells (e.g., a human protein in bacteria or yeast), or the level of expression in such cells. In order to obtain enough protein for purification, testing, and use in in vitro assays, in animal models, and eventually in clinical development, efficient protein expression in non-human systems is needed.
- a series of 23 arginine amino acids in the human Smad7 protein sequence coded for by one or more of AGG (1.7% codon utilization; 9 residues), AGA (2.8% codon utilization; 2 residues), CGA (3.5% codon utilization; 4 residues), or CGG (5.4% codon utilization; 8 residues) has been identified, and it has been determined that in order to have efficient protein expression from non-human sources, such as, but not limited to, bacteria and/or yeast that one or more, and potentially all the arginine codons should be modified to CGT (20.6% codon utilization). Therefore, in some embodiments, the Smad7
- codon-optimized nucleic acid sequence includes at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, or 23 codons for arginine that have been changed to CGT.
- the Smad7 codon-optimized nucleic acid sequence includes one or more or all of the arginine codons at nucleic acid sequence positions 7-9, 43-45, 169-171, 403-405, 490-492, 526-528, 526-528, 823-825, 1057-1059, 16-18, 136-138, 199-201, 598-600, 31-33, 1 12-1 14, 316-318, 772-774, 940-942, 973-975, 1135-1 137, 1276-1278, 637-639, or 814-816 be changed to CGT.
- codon-optimized nucleic acid sequence includes at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32 or 33 codons for serine that have been changed to (AGC).
- the Smad7 codon-optimized nucleic acid sequence includes one or more or all of the serine codons at nucleic acid sequence positions 19-21, 46-48, 133-135, 292-294, 349-351, 451-453, 454-456, 460-462, 511-513, 514-516, 544-546, 595-597, 616-618, 634-636, 691-693, 694-696, 739-741, 745-747, 775-777, 847-849, 907-909, 919-921, 943-945, 1006-1008, 1009-1 101, 1030-1032, 1054-1056, 1093-1095, 1 126-1128, 1 192-1 194, 1237-1239, 1240-1242, 1273-1275.
- the Smad7 codon-optimized nucleic acid sequence includes at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1, or 12 codons for histidine that have been changed to (CAT).
- the Smad7 codon-optimized nucleic acid sequence includes one or more or all of the serine codons at nucleic acid sequence positions 142-144, 214-216, 217-219, 220-222, 226-228, 289-291, 589-591, 778-780, 1072-1074, 1147-1 149.
- 4 codons (nucleotides 217-219, 220-222, 589-591, 778-780) can be changed without introducing potential alternative open reading frames.
- one or more codon-optimized nucleic acids may include one or more of at least one and any integer up to 22 of its arginine codons modified to CGT, at least one and any integer up to 28 of its serine codons (optionally that are able to be modified with introducing open reading frames) modified to AGC, or at least one and any integer up to 12 of its histidine codons (optionally that are able to be modified with introducing open reading frames) modified to CAT.
- one or more codon-optimized nucleic acid may include at least one and any integer up to 22 of its arginine codons modified to CGT, at least one and any integer up to 28 of its serine codons (optionally that are able to be modified with introducing open reading frames) modified to AGC, and at least one and any integer up to 12 (optionally that are able to be modified with introducing open reading frames) of its histidine codons modified to CAT.
- one or more codon-optimized nucleic acid may include 22 of its arginine codons modified to CGT, 28 of its serine codons (optionally that are able to be modified with introducing open reading frames) modified to AGC, and 12 of its histidine codons (optionally that are able to be modified with introducing open reading frames) modified to CAT.
- one or more codon-optimized nucleic acid may also have a nucleotide substitution in the codon for Met216 (ATG), to form the codon for Leu216 (CTG).
- one or more codon-optimized nucleic acids may have about 65% to 75%, about 65% to 68%, about 68% to 75%, or about 68% to 71% homology to human Smad7 wild-type cDNA (SEQ ID NOs: 12, 22). In some embodiments, one or more codon-optimized nucleic acid may have about 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, or 75%, homology to human Smad7 wild-type cDNA (SEQ ID NOs: 12, 22). In some embodiments, one or more codon-optimized nucleic acid may also have a nucleotide substitution in the codon for Met216 (ATG), to form the codon for Leu216 (CTG).
- a methionine codon (Met216; ATG) that has the potential for being perceived by translation machinery (e.g., such as but not limited bacteria or yeast) as an alternative open reading frame has been identified.
- translation machinery e.g., such as but not limited bacteria or yeast
- the presence of the second potential open reading frame may decrease expression of the Smad7 protein.
- one or more Smad7 nucleic acid sequences are modified at nucleotide position (646-648) to encode a human Smad7 protein where Met216 (ATG) is modified to Leu216 (CTG).
- Smad7 protein retain one or more of the activities of full-length human Smad7, such as, but not limited to, increasing proliferation, reducing or inhibiting cell death, reducing excessive inflammation, preventing DNA damage, and/or increasing cell migration, as well as treating or preventing one or more disease or disorders in which such treatment would be helpful as further discussed herein.
- activities can be assessed using one or more assays including, but not limited to, the ability to block phosphorylation of Smad2 and/or nuclear translocation of the NF-KB p50 subunit, increase cell proliferation, reduce apoptosis and/or
- radiation-induced DNA damage reduce inflammation and/or angiogenesis, promote healing in oral mucositis, surgical wounds, diabetes wounds, and/or wounds associated with chronic inflammation in mice.
- various truncated forms and fragments of Smad7 protein retain only a subset of the one or more of the activities of full-length human Smad7.
- the C-terminal MH2 domain of Smad7 may primarily mediate the
- Smad7 peptides having this anti-inflammatory function may be sufficient and optionally an improvement for treating chronic inflammation associated conditions, such as but not limited to, oral mucositis, stomatitis, arthritis, and psoriasis, among others.
- the N-terminal MH1 domain may primarily mediate cell migration and/or blocking TGF- -induced growth arrest and/or fibrotic response.
- Smad7 peptides having this cell migration and proliferation function may be sufficient, and optionally an improvement, for enhancing healing that is not associated with excessive inflammation.
- Types of wounds that might benefit from this form of treatment include, but are not limited to, surgical wounds, fibrotic scarring, and diabetes wounds, defective healing and/or scarring among others.
- nucleic acid molecules encode fragments or truncated forms of Smad7 protein (optionally including Leu216). In some embodiments, these fragments and/or truncated forms of Smad7 protein retain one or more or all of the activities of full-length human Smad7 protein. In some embodiments, such truncated nucleic acid sequences encode the N-terminal portion of the Smad7 protein. In some embodiments, such truncated nucleic acid sequences encode the C-terminal portion of the Smad7 protein.
- such truncated nucleic acid sequences (nucleotide positions 4-774) encode amino acids 2-258 of the human Smad7 protein. In some embodiments, such truncated nucleic acid sequences (nucleotide positions 775-1278) encode amino acids 259-426 of the human Smad7 protein. In some embodiments, such fragments of the nucleic acid sequences (nucleotide positions 610-774) encode amino acids 204-258 of the human Smad7 protein.
- truncated refers to a molecule that contains nucleotide sequences encoding the natural N-terminus of a corresponding protein (with or without a cleaved leader sequence), but lacks one or more nucleotides starting from the C-terminus-encoding portion of the molecule, or a molecule that contains nucleotide sequences encoding the natural C-terminus of a corresponding protein (with or without a cleaved leader sequence), but lacks one or more nucleotides starting from the N-terminus-encoding portion of the molecule.
- molecules lacking nucleotides encoding at least about 25, at least about 50, at least about 75, at least about 100, at least about 125, at least about 150, at least about 200, at least about 250, at least about 300, or at least about 350, or at least about 400 amino acids from one or the other terminus are specifically provided.
- the term "truncated” may also be used in reference to protein molecules encoded by truncated nucleic acid molecules.
- a "truncated" molecule is biologically active, having (or encoding a polypeptide having) one or more of the Smad7 activities described herein.
- fragment refers to a molecule containing contiguous residues of a full length sequence but lacking some 5' and/or 3 ' sequences of the full length sequence.
- a “fragment” includes a portion of one or more of the full length sequences described herein.
- the "fragment” does not include sequences encoding either the N-terminal or the C-terminal, but only internal fragments.
- a "fragment” encodes a polypeptide that is biologically active, having one or more of the Smad7 activities described herein.
- nucleic acid fragments may encode proteins having at least about 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1 150 amino acids.
- fragment may also be used in reference to protein molecules encoded by Smad7 nucleic acid fragments.
- N-terminal portion refers to a fragment of a corresponding protein that contains the protein's N-terminus but lacks all sequences
- C-terminal portion refers to a fragment of a corresponding protein that contains the protein's C-terminus but lacks all sequences
- the Smad7 protein activity is generally believed to be the result of interactions in both the cytoplasm and nucleus of a cell. For that reason among others, there existed a general belief that Smad7 protein was not a candidate for a therapeutic role. However, it was decided to pursue development of Smad7 as a protein therapeutic, and modify the Smad7 nucleic acid sequence to encode a protein transduction domain (PTD) in frame with the Smad7 nucleic acid sequence (e.g., optionally any nucleic acid sequence described herein encoding Smad7 protein, including human wild-type and codon-optimized sequences, both full-length and biologically active fragments or truncated portions).
- PTD protein transduction domain
- the PTD is located at the 3 ' end of the Smad7 nucleic acid sequence, and in some embodiments the PTD is located at the 5' end of the Smad7 nucleic acid sequence. In some embodiments, there is a linker sequence encoding 1, 2, 3, 4, 5, or 6 amino acids that connects the PTD and the Smad7 nucleic acid sequence.
- the PTD nucleic acid sequence is a Tat nucleic acid sequence, ggccgtaaaaacgccgtcaacgccgccgt (SEQ ID NO: 1) encoding GRKKRRQRRR (SEQ ID NO: 2), tatggccgtaaaaaacgccgtcaacgccgccgt (SEQ ID NO: 3) encoding
- YGRKKRRQRRR (SEQ ID NO: 4), or ggccgtaaaaacgccgtcaa (SEQ ID NO: 5) encoding GRKKRRQ (SEQ ID NO: 6).
- the nucleic acid sequence further includes a nucleotide sequence encoding one or more of an epitope tag or a purification tag.
- the epitope tag is V5.
- the purification tag is one or more of glutathione-S-Transferase (GST) or 6-histidine (H6).
- epitope tag refers to nucleotides encoding peptide sequences that are recognized and bound by the variable region of an antibody or fragment.
- the epitope tag is not part of the native protein.
- the epitope tag is removable.
- the epitope tag is not intrinsic to the protein's native biological activity.
- epitope tags include, but are not limited to V5.
- purification tag refers to nucleotides encoding peptide sequences that facilitate the purification of the protein, but are generally not necessary for the protein's biological activity.
- purification tags may be removed following protein purification. Examples of purification tags include, but are not limited to GST and H-6.
- expression vectors are employed to express the Smad7 polypeptide product, which can then be purified for various uses.
- the expression vectors are used in gene therapy. Expression requires that appropriate signals be provided in the vectors, and which include various regulatory elements, such as enhancers/promoters from both viral and mammalian sources that drive expression of the genes of interest in host cells. Elements designed to optimize messenger RNA stability and trans latability in host cells also are defined. The conditions for the use of a number of dominant drug selection markers for establishing permanent, stable cell clones expressing the products are also provided, as is an element that links expression of the drug selection markers to expression of the polypeptide.
- expression construct is meant to include any type of genetic construct containing a nucleic acid coding for a gene product in which part or all of the nucleic acid encoding sequence is capable of being transcribed.
- the transcript may be translated into a protein, but it need not be.
- expression includes both transcription of a gene and translation of mRNA into a gene product. In other embodiments, expression only includes transcription of the nucleic acid encoding a gene of interest.
- vector is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated.
- a nucleic acid sequence can be "exogenous,” which means that it is foreign to the cell into which the vector is being introduced or that the sequence is homologous to a sequence in the cell but in a position within the host cell nucleic acid in which the sequence is ordinarily not found.
- Vectors include plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs).
- expression vector refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules or ribozymes.
- Expression vectors can contain a variety of "control sequences,” which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host organism, including promoters and enhancers. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions, such as transcription termination signals and poly-adenylation sites.
- Suitable non-viral methods for nucleic acid delivery for transformation of an organelle, a cell, a tissue or an organism for use with the present technology are believed to include virtually any method by which a nucleic acid (e.g., DNA) can be introduced into an organelle, a cell, a tissue or an organism, as described herein or as would be known to one of ordinary skill in the art.
- a nucleic acid e.g., DNA
- Such methods include, but are not limited to, direct delivery of DNA such as by injection (U.S.
- compositions discussed above Numerous expression systems exist that comprise at least a part or all of the compositions discussed above.
- Prokaryote- and/or eukaryote-based systems can be employed for use with the present technology to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides. Many such systems are commercially and widely available.
- the insect cell/baculovirus system can produce a high level of protein expression of a heterologous nucleic acid segment, such as described in U.S. Patents 5,871,986 and 4,879,236, both herein incorporated by reference, and which can be bought, for example, under the name MAXBAC ® 2.0 from INVITROGEN ® and BACPACKTM BACULOVIRUS EXPRESSION SYSTEM FROM CLONTECH ® .
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an bacterial expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- FIG. 1 A block diagram illustrating an exemplary expression system
- Primary mammalian cell cultures may be prepared in various ways. In order for the cells to be kept viable while in vitro and in contact with the expression construct, it is necessary to ensure that the cells maintain contact with the correct ratio of oxygen and carbon dioxide and nutrients but are protected from microbial contamination. Cell culture techniques are well documented.
- One embodiment of the foregoing involves the use of gene transfer to immortalize cells for the production of proteins.
- the gene for the protein of interest may be transferred as described above into appropriate host cells followed by culture of cells under the appropriate conditions.
- the gene for virtually any polypeptide may be employed in this manner.
- the generation of recombinant expression vectors, and the elements included therein, are discussed above.
- the protein to be produced may be an endogenous protein normally synthesized by the cell in question.
- Examples of useful mammalian host cell lines are Vero and HeLa cells and cell lines of Chinese hamster ovary, W138, BHK, COS-7, 293, HepG2, NIH3T3, RTN and MDCK cells.
- a host cell strain may be chosen that modulates the expression of the inserted sequences, or modifies and process the gene product in the manner desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the protein.
- Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins.
- a number of selection systems may be used including, but not limited to, HSV thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine
- anti-metabolite resistance can be used as the basis of selection for dhfr, that confers resistance to; gpt, that confers resistance to mycophenolic acid; neo, that confers resistance to the aminoglycoside G418; and hygro, that confers resistance to hygromycin.
- the terms "cell,” “cell line,” and “cell culture” may be used interchangeably. All of these terms also include their progeny, which are any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations.
- "host cell” refers to a prokaryotic or eukaryotic cell, and it includes any transformable organism that is capable of replicating a vector and/or expressing a
- a host cell can, and has been, used as a recipient for vectors.
- a host cell may be "transfected” or “transformed,” which refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
- a transformed cell includes the primary subject cell and its progeny.
- Host cells may be derived from prokaryotes or eukaryotes (e.g., bacteria or yeast), depending upon whether the desired result is replication of the vector or expression of part or all of the vector-encoded nucleic acid sequences.
- eukaryotes e.g., bacteria or yeast
- ATCC American Type Culture Collection
- An appropriate host can be determined by one of skill in the art based on the vector backbone and the desired result.
- a plasmid or cosmid for example, can be introduced into a prokaryote host cell for replication of many vectors.
- Bacterial cells used as host cells for vector replication and/or expression include DH5a, JM109, and KC8, as well as a number of commercially available bacterial hosts such as SURE ® Competent Cells and SOLOPACKTM Gold Cells (STRATAGENE ® , La Jolla).
- bacterial cells such as E. coli LE392 could be used as host cells for phage viruses.
- Examples of eukaryotic host cells for replication and/or expression of a vector include HeLa, NIH3T3, Jurkat, 293, Cos, CHO, Saos, and PC12. Many host cells from various cell types and organisms are available and would be known to one of skill in the art. Similarly, a viral vector may be used in conjunction with either a eukaryotic or prokaryotic host cell, particularly one that is permissive for replication or expression of the vector.
- Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
- control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
- One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
- Smad7 also antagonizes other signaling pathways, like the NF-KB pathway.
- Smad7 protein is encoded by the SMAD7 gene, discussed above. Like many other TGF- ⁇ family members, Smad7 is involved in cell signaling. It is a TGF- ⁇ type 1 receptor antagonist. It blocks TGF- ⁇ and activin associating with the receptor, blocking access to Smad2. It is an inhibitory Smad (I-SMAD) and is enhanced by SMURF2.
- Smad7 also enhances muscle differentiation.
- polypeptide polypeptide
- peptide protein
- protein protein
- the terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally occurring amino acid, for example, an amino acid analog.
- the terms encompass amino acid chains of any length, including full length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
- the present technology relates to Smad7 protein
- compositions In addition to the entire Smad7 molecule, the present technology also relates to truncated portions and fragments of the polypeptide that retain one or more activity associated with Smad7, such as, but not limited to, increasing proliferation, reducing or inhibiting cell death, reducing excessive inflammation, preventing DNA damage, and/or increasing cell migration, as well as treating or preventing one or more disease or disorders in which such treatment would be helpful as further discussed herein.
- Such activities can be assessed using one or more assays including, but not limited to, the ability to block phosphorylation of Smad2 and/or nuclear translocation of the NF- ⁇ p50 subunit, increase cell proliferation, reduce apoptosis and/or radiation-induced DNA damage, reduce inflammation and/or angiogenesis, promote healing in oral mucositis, surgical wounds, diabetes wounds, and/or wounds associated with chronic inflammation in mice.
- assays including, but not limited to, the ability to block phosphorylation of Smad2 and/or nuclear translocation of the NF- ⁇ p50 subunit, increase cell proliferation, reduce apoptosis and/or radiation-induced DNA damage, reduce inflammation and/or angiogenesis, promote healing in oral mucositis, surgical wounds, diabetes wounds, and/or wounds associated with chronic inflammation in mice.
- Protein fragments may be generated by genetic engineering of translation stop sites within the coding region (discussed below).
- treatment of the Smad7 molecule with proteolytic enzymes, known as proteases can produces a variety of proteolytic enzymes, known as proteases.
- N-terminal, C-terminal and internal fragments may be purified according to known methods, such as precipitation (e.g., ammonium sulfate), HPLC, ion exchange chromatography, affinity chromatography (including immunoaffinity chromatography) or various size separations (sedimentation, gel electrophoresis, gel filtration).
- an isolated protein or polypeptide in the present embodiments include full-length proteins, fusion proteins, chimeric proteins, or any fragment (truncated form, portion) or homologue of such a protein.
- an isolated protein can be a protein (including a polypeptide or peptide) that has been removed from its natural milieu (i.e., that has been subject to human manipulation), and can include, but is not limited to, purified proteins, partially purified proteins, recombinantly produced proteins, proteins complexed with lipids, soluble proteins, synthetically produced proteins, and isolated proteins associated with other proteins.
- isolated protein does not reflect the extent to which the protein has been purified.
- an isolated protein is produced
- Variants of Smad7 are also provided - these can be substitutional, insertional or deletion variants.
- Deletion variants lack one or more residues of the native protein that are not essential for activity, including the truncation mutants described above and herein.
- Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein, and may be designed to modulate one or more properties of the polypeptide, such as stability against proteolytic cleavage and/or translation and/or transcription (protein expression), without the loss of other functions or properties.
- substitutions of this kind preferably are conservative, that is, one amino acid is replaced with one of similar shape and charge.
- Conservative substitutions are well known in the art and include, for example, each amino acid can be changed or substituted with a different amino acid.
- the hydropathic index, hydrophilicity, charge and size are normally considered.
- Smad7 deletion variants of Smad7 include truncations and fragments, for example, including polypeptide molecules having N-terminal sequences, but not C-terminal sequences, having C-terminal sequences but not N-terminal sequences, or having internal sequences, but not N-terminal or c-terminal sequences.
- Smad7 polypeptide truncations or fragments include, but are not limited to, molecules including amino acid residues 2-258, 259-426, 204- 258 corresponding to the native human Smad7 protein sequence.
- truncated refers to a molecule that contains the natural N-terminus of a corresponding protein (with or without a cleaved leader sequence), but lacks one or more amino acids starting from the C-terminus of the molecule, or a molecule that contains the natural C-terminus of a corresponding protein (with or without a cleaved leader sequence), but lacks one or more amino acids starting from the N-terminus of the molecule.
- molecules lacking at least about 25, at least about 50, at least about 75, at least about 100, at least about 125, at least about 150, at least about 200, at least about 250, at least about 300, or at least about 350, or at least about 400 amino acids from one or the other terminus are specifically provided.
- a "truncated" molecule is biologically active, having one or more of the Smad7 activities described herein.
- fragment refers to a molecule containing contiguous residues of a full length sequence but lacking some N-terminal and/or C-terminal residues of the full length sequence.
- a “fragment” includes a portion of one or more of the full length sequences described herein.
- the “fragment” does not include sequences encoding either the N-terminal or the C-terminal, but only internal fragments.
- a "fragment” encodes a polypeptide that is biologically active, having one or more of the Smad7 activities described herein.
- polypeptide fragments have at least about 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1 100, 1150 amino acids.
- a specialized kind of variant is the fusion protein.
- This molecule generally has all or a substantial portion of the native molecule, linked at the N- or C-terminus, to all or a portion of a second polypeptide.
- the fusion protein may include any one of the fragments and/or truncated (N-terminal, C-terminal) Smad7 proteins described throughout the disclosure.
- fusions may employ leader sequences from other species to permit the recombinant expression of a protein in a heterologous host.
- Another useful fusion includes the addition of an optional functionally active domain, such as but not limited to an antibody epitope and/or a purification tag (e.g., V5:
- Another type of fusion includes attaching a domain that can act as the target for an activating or inactivating ligand, thereby permitting control of the fusion protein's function once delivered to a subject.
- domains include, for example, steroid ligand binding (e.g., ER, PR, GR), which can be activated by small molecules, e.g., 4-hydroxyl tamoxifen or RU486 that are either uniquely able to activate those steroid ligand binding domains and/or do not exist in nature and will therefore enable full control of the Smad7 function by the presence of these small molecules.
- a fusion protein finding particular utility in the present technology is a fusion including a protein transduction domain (PTD), also called a cell delivery domain or cell transduction domain.
- PTD protein transduction domain
- Such domains have been described in the art and are generally characterized as short amphipathic or cationic peptides and peptide derivatives, often containing multiple lysine and arginine resides (Fischer, Med. Res. Rev. 27:755-795 (2007)).
- the PTD is one or more variant of TAT protein from HIV (GRKKRRQRRR, YGRKKRRQRRR, or GRKKRRQ ) or alternatively, HSV VP 16. Alternate forms of Tat may be used.
- a linker may be used to connect one or more PTDs and SMad7.
- the PTD (optionally Tat) is fused or linked in frame to the N-terminal and/or C-terminal end of any one of the Smad7 full-length, fragments, and/or truncated (N-terminal, C-terminal) proteins described throughout the disclosure.
- Other examples of PTDs provided by the present technology are shown in Table 1.
- the present technology provides for sequence variants of Smad7 in which one or more residues have been altered.
- the methionine residue found at position 216 of the human Smad7 sequence is modified to a leucine residue (ATG to CTG).
- Smad7 -treatable diseases and disorders may include those including one or more of reduced cell proliferation, reduced cell migration, increased cell death, excessive inflammation, and/or DNA damage.
- Smad7-related diseases and disorders may include those where treatment with a Smad7 protein and biologically active fragments and derivatives thereof that have one or more activities including but not limited to increasing proliferation, reducing or inhibiting cell death, reducing excessive inflammation, preventing DNA damage, and/or increasing cell migration is helpful.
- Such diseases and/or disorders may include but are not limited to acute (e.g., through surgery, combat, trauma) and chronic wounds (e.g., ulcers, such as diabetic, pressure, venous), scarring, fibrosis, and aberrant healing, mucositis (e.g., oral and/or gastro-intestinal), stomatitis, proctitis, autoimmune disease (e.g., psoriasis, arthritis), and cancer.
- one or more of the diseases and or disorders described herein may be prevented, treated, and/or ameliorated by providing to a subject in need of such treatment a therapeutically effective amount of one or more of the Smad7 proteins (e.g., full-length or biologically active truncated (e.g., N- terminal or C-terminal) or fragment thereof) described in the disclosure.
- the one or more Smad7 proteins are fusion proteins including a PTD domain.
- the one or more Smad7 proteins includes Leu216.
- the Smad7 proteins make part of a pharmaceutical composition including one or more pharmaceutically acceptable excipients.
- one or more of the diseases and or disorders described herein may be prevented, treated, and/or ameliorated by providing to a subject in need of such treatment a therapeutically effective amount of one or more of the nucleic acid molecules encoding one or more Smad7 proteins (e.g., full-length or biologically active truncated (e.g., N- terminal or C-terminal) or fragment thereof) described in the disclosure.
- the one or more nucleic acid molecules include codon-optimized nucleotide sequences and/or sequences that encode Leu216.
- the one or more Smad7 nucleic acid molecules are provided to the subject in a construct including an expression vector.
- the Smad7 nucleic acid molecules (optionally part of an expression vector) make part of a pharmaceutical composition including one or more pharmaceutically acceptable excipients.
- non-human animals refers to persons or non-human animals in need of treatment and or prevention using one or more of the treatments described herein.
- non-human animals include laboratory animals such as monkeys, mice, rats, and rabbits, domestic pets such as dogs and cats, and livestock such as cattle, horses, pigs, goats and sheep.
- a chronic wound is a wound that does not heal in an orderly set of stages and in a predictable amount of time the way most wounds do; wounds that do not heal within three months are often considered chronic.
- Chronic wounds seem to be detained in one or more of the phases of wound healing. For example, chronic wounds often remain in the inflammatory stage for too long. In acute wounds, there is a precise balance between production and degradation of molecules such as collagen; in chronic wounds this balance is lost and degradation plays too large a role.
- PTD-Smad7 has been shown to enhance wound healing in a mouse skin model and a mucosal model. Application of PTD-Smad7 was effective through a topical route, which is desirable for wound treatment. Although not intending to be bound by theory, it is believed that PTD-Smad7 may act to treat or ameliorate chronic wounds through multiple routes, which may include one or more of reducing inflammation, increasing cell proliferation (e.g., keratinocytes), increasing cell migration (e.g., keratinocytes), or reducing fibrosis (e.g., through modulation of collagen), among others. [0116] Chronic wounds may never heal or may take years to do so.
- Acute and chronic wounds are at opposite ends of a spectrum of wound healing types that progress toward being healed at different rates.
- the vast majority of chronic wounds can be classified into three categories: venous ulcers, diabetic, and pressure ulcers. A small number of wounds that do not fall into these categories may be due to causes such as radiation poisoning or ischemia.
- Venous and arterial ulcers are responsible for the following reasons: acute pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, a progressive pulmonary disease, pulmonary embos, pulmonary embos, pulmonary embos, pulmonary embos, pulmonary embos, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embolism, pulmonary embos, pulmonary embos, pulmonary embos, pulmonary embos, pulmonary embo
- Diabetic ulcers Another major cause of chronic wounds, diabetes, is increasing in prevalence. Diabetics have a 15% higher risk for amputation than the general population due to chronic ulcers. Diabetes causes neuropathy, which inhibits nociception and the perception of pain. Thus patients may not initially notice small wounds to legs and feet, and may therefore fail to prevent infection or repeated injury. Further, diabetes causes immune compromise and damage to small blood vessels, preventing adequate oxygenation of tissue, which can cause chronic wounds. Pressure also plays a role in the formation of diabetic ulcers.
- Pressure ulcers Another leading type of chronic wounds is pressure ulcers, which usually occur in people with conditions such as paralysis that inhibit movement of body parts that are commonly subjected to pressure such as the heels, shoulder blades, and sacrum. Pressure ulcers are caused by ischemia that occurs when pressure on the tissue is greater than the pressure in capillaries, and thus restricts blood flow into the area. Muscle tissue, which needs more oxygen and nutrients than skin does, shows the worst effects from prolonged pressure. As in other chronic ulcers, reperfusion injury damages tissue.
- Chronic wounds may affect only the epidermis and dermis, or they may affect tissues all the way to the fascia. They may be formed originally by the same things that cause acute wounds, such as surgery or accidental trauma, or they may form as the result of systemic infection, vascular, immune, or nerve insufficiency, or comorbidities such as neoplasias or metabolic disorders.
- the reason a wound becomes chronic is that the body's ability to deal with the damage is overwhelmed by factors such as repeated trauma, continued pressure, ischemia, or illness.
- Some of the major factors that lead to chronic wounds include, but are not limited to, ischemia, reperfusion injury, and bacterial colonization.
- Ischemia is an important factor in the formation and persistence of wounds, especially when it occurs repetitively (as it usually does) or when combined with a patient's old age. Ischemia causes tissue to become inflamed and cells to release factors that attract neutrophils such as interleukins, chemokines, leukotrienes, and complement factors.
- neutrophils While they fight pathogens, neutrophils also release inflammatory cytokines and enzymes that damage cells.
- ROS Reactive Oxygen Species
- the enzymes and ROS produced by neutrophils and other leukocytes damage cells and prevent cell proliferation and wound closure by damaging DNA, lipids, proteins, the ECM, and cytokines that speed healing.
- Neutrophils remain in chronic wounds for longer than they do in acute wounds, and contribute to the fact that chronic wounds have higher levels of inflammatory cytokines and ROS. Because wound fluid from chronic wounds has an excess of proteases and ROS, the fluid itself can inhibit healing by inhibiting cell growth and breaking down growth factors and proteins in the ECM.
- Infection can lead not only to chronic wounds but also to gangrene, loss of the infected limb, and death of the patient.
- GFs growth factors
- Chronic wounds such as diabetic and venous ulcers are also caused by a failure of fibroblasts to produce adequate ECM proteins and by keratinocytes to epithelialize the wound. Fibroblast gene expression is different in chronic wounds than in acute wounds.
- Excess matrix metalloproteinases which are released by leukocytes, may also cause wounds to become chronic. MMPs break down ECM molecules, growth factors, and protease inhibitors, and thus increase degradation while reducing construction, throwing the delicate compromise between production and degradation out of balance.
- a mouth ulcer (also termed an oral ulcer, or a mucosal ulcer) is an ulcer that occurs on the mucous membrane of the oral cavity. More plainly, a mouth ulcer is a sore or open lesion in the mouth. Mouth ulcers are very common, occurring in association with many diseases and by many different mechanisms, but usually there is no serious underlying cause. The two most common causes of oral ulceration are local trauma (e.g. , rubbing from a sharp edge on a filling) and aphthous stomatitis ("canker sores”), a condition characterized by recurrent formation of oral ulcers for largely unknown reasons.
- local trauma e.g. , rubbing from a sharp edge on a filling
- canker sores aphthous stomatitis
- oral ulceration e.g., an ulcer left by rupture of a blister caused by herpes labialis, i.e., a cold sore.
- Mouth ulcers often cause pain and discomfort, and may alter the person's choice of food while healing occurs (e.g., avoiding acidic or spicy foods and beverages). They may occur singly or multiple ulcers may occur at the same time (a "crop" of ulcers). Once formed, the ulcer may be maintained by inflammation and/or secondary infection. Rarely, a mouth ulcer that does not heal for many weeks may be a sign of oral cancer. Other causes include burns, chemical injury, or infection.
- a mucosal ulcer is an ulcer which specifically occurs on a mucous membrane.
- An ulcer is a tissue defect which has penetrated the epithelial-connective tissue border, with its base at a deep level in the submucosa, or even within muscle or periosteum.
- An ulcer is a deeper breech of the epithelium than an erosion or an excoriation, and involves damage to both epithelium and lamina intestinal.
- An erosion is a superficial breach of the epithelium, with little damage to the underlying lamina limbal.
- a mucosal erosion is an erosion which specifically occurs on a mucous membrane.
- Trauma can also be described as both unplanned, such as an accident, or planned, in the case of surgery. Both can be characterized by mild to severe tissue damage, blood loss and/or shock, and both may lead to subsequent infection, including sepsis.
- the present technology provides for treatment of trauma, including both pre-treatment (in the case of a medical procedure) and treatment after trauma injury has occurred.
- PTD-Smad7 has been shown to enhance wound healing in a mouse skin model and a mucosal model. Application of PTD-Smad7 was effective through a topical route, which is desirable for wound treatment. Although not intending to be bound by theory, it is believed that PTD-Smad7 may act to treat or ameliorate wounds through multiple routes, which may include one or more of reducing inflammation, increasing cell proliferation (e.g., keratinocytes), increasing cell migration (e.g., keratinocytes), or reducing fibrosis (e.g., through modulation of collagen), among others.
- reducing inflammation e.g., keratinocytes
- increasing cell migration e.g., keratinocytes
- reducing fibrosis e.g., through modulation of collagen
- reduced inflammation could significantly contribute to accelerated wound healing, optionally through reduced angiogenesis and collagen production and/or reduced leukocyte infiltration leading to reduction of cytokines and chemokines normally released by leukocytes, which are angiogenic and fibrogenic.
- Temporal treatment with Smad7 may allow early stage angiogenesis and collagen production required for wound repair, while preventing prolonged angiogenesis and collagen production. These changes could potentially accelerate wound stromal remodeling and prevent excessive scarring due to unresolved inflammation or collagen overproduction. For surgical procedures (as well as everyday injuries), particularly where the potential for scarring is an issue, treatment with Smad7 may be beneficial.
- Surgery uses operative manual and instrumental techniques on a patient to investigate and/or treat a pathological condition such as disease or injury, to help improve bodily function or appearance, or sometimes for some other reason.
- a pathological condition such as disease or injury
- the present technology can address trauma resulting from surgeries, as defined further below.
- a procedure is considered surgical when it involves cutting of a patient's tissues or closure of a previously sustained wound.
- Other procedures that do not necessarily fall under this rubric such as angioplasty or endoscopy, may be considered surgery if they involve common surgical procedure or settings, such as use of a sterile environment, anesthesia, antiseptic conditions, typical surgical instruments, and suturing or stapling. All forms of surgery are considered invasive procedures; so-called noninvasive surgery usually refers to an excision that does not penetrate the structure being addressed (e.g., laser ablation of the cornea) or to a radiosurgical procedure (e.g., irradiation of a tumor). Surgery can last from minutes to hours.
- Surgical procedures are commonly categorized by urgency, type of procedure, body system involved, degree of invasiveness, and special instrumentation.
- Elective surgery is done to correct a non-life-threatening condition, and is carried out at the patient's request, subject to the surgeon's and the surgical facility's availability.
- Emergency surgery is surgery which must be done quickly to save life, limb, or functional capacity. Exploratory surgery is performed to aid or confirm a diagnosis.
- Therapeutic surgery treats a previously diagnosed condition.
- Amputation involves cutting off a body part, usually a limb or digit.
- Replantation involves reattaching a severed body part.
- Reconstructive surgery involves reconstruction of an injured, mutilated, or deformed part of the body.
- Cosmetic surgery is done to improve the appearance of an otherwise normal structure.
- Excision is the cutting out of an organ, tissue, or other body part from the patient.
- Transplant surgery is the replacement of an organ or body part by insertion of another from different human (or animal) into the patient. Removing an organ or body part from a live human or animal for use in transplant is also a type of surgery.
- Minimally invasive surgery involves smaller outer incision(s) to insert miniaturized instruments within a body cavity or structure, as in laparoscopic surgery or angioplasty.
- an open surgical procedure requires a large incision to access the area of interest.
- Laser surgery involves use of a laser for cutting tissue instead of a scalpel or similar surgical instruments.
- Microsurgery involves the use of an operating microscope for the surgeon to see small structures.
- Robotic surgery makes use of a surgical robot, such as Da Vinci or Zeus surgical systems, to control the instrumentation under the direction of the surgeon.
- the present technology contemplates the treatment of a variety of autoimmune and/or inflammatory disease states such as spondyloarthropathy, ankylosing spondylitis, psoriatic arthritis, reactive arthritis, enteropathic arthritis, ulcerative colitis, Crohn's disease, irritable bowel disease, inflammatory bowel disease, rheumatoid arthritis, juvenile rheumatoid arthritis, familial Mediterranean fever, amyotrophic lateral sclerosis, Sjogren's syndrome, early arthritis, viral arthritis, multiple sclerosis, or psoriasis.
- spondyloarthropathy ankylosing spondylitis
- psoriatic arthritis reactive arthritis
- enteropathic arthritis ulcerative colitis
- Crohn's disease irritable bowel disease
- inflammatory bowel disease rheumatoid arthritis
- juvenile rheumatoid arthritis juvenile rheumatoid arthritis
- familial Mediterranean fever amyotrophic lateral sclerosis
- autoimmune diseases are associated with an overactive immune response of a body against substances and tissues normally present in the body, and not normally the focus of an immune response. There are more than 80 types of autoimmune diseases, some of which have similar symptoms, and they may arise from a similar underlying cause.
- the classic sign of an autoimmune disease is inflammation, which as disclosed herein is amenable to treatment with Smad7 (optionally PTD-Smad7) compositions.
- PTD-Smad7 acts to heal as well as to prevent oral mucositis in a mouse model.
- PTD-Smad7 was shown to be more effective than palifermin, the existing approved drug for preventing oral mucositis, in direct comparisons.
- Oral cancer the 6 th most common cancer worldwide, is a subtype of head and neck cancer, and includes any cancerous tissue growth located in the oral cavity. It may arise as a primary lesion originating in any of the oral tissues, by metastasis from a distant site of origin, or by extension from a neighboring anatomic structure, such as the nasal cavity or the oral cancers may originate in any of the tissues of the mouth, and may be of varied histologic types: teratoma, adenocarcinoma derived from a major or minor salivary gland, lymphoma from tonsillar or other lymphoid tissue, or melanoma from the pigment-producing cells of the oral mucosa.
- oral cancers There are several types of oral cancers, but around 90% are squamous cell carcinomas, originating in the tissues that line the mouth and lips. Oral or mouth cancer most commonly involves the tongue. It may also occur on the floor of the mouth, cheek lining, gingiva (gums), lips, or palate (roof of the mouth). Most oral cancers look very similar under the microscope and are called squamous cell carcinoma. These are malignant and tend to spread rapidly.
- Oral mucositis is a chronic oral ulceration. This disease frequently occurs in radiation-treated patients of all cancer types, including but not limited to patients who are radiation-treated for organ transplants (to eliminate rejection of the transplants), and patients undergoing routine chemotherapy.
- Oral mucositis is a major factor in determining the maximum dose possible of radiation and chemotherapy to the head and neck region; it can significantly complicate cancer treatment, extend hospitalization, decrease quality of life and increase costs.
- KEPIVANCE® a recombinant protein of human keratinocyte growth factor (KGF)
- KGF human keratinocyte growth factor
- Other potential therapies include topical rinses, such as viscous 2% lidocaine rinses, or baking soda and saline solutions, or a cocktail solution, for instance BAX (lidocaine, diphenhyramine, sorbitol and MYLANTA®).
- Other investigative or mucoprotective adjuvant therapies include, but are not limited to, beta carotene, tocopherol, laser irradiation, prophylactic brushing the oral mucosa with silver-nitrate, misoprostol, leucovorin, systemic KGF, pentoxifylline, allopurinol mouthwash, systemic sucralfate, chlorhexidine gluconate, and cryotherapy.
- Chemotherapy- and radiation-induced gut mucositis is an inflammatory condition that arises as a result of the acute death of rapidly dividing intestinal epithelial cells. Most chemotherapeutic drugs used for treatment of solid tumors, alone, in a combination of drugs, or with radiation, will result in the death of a large number of intestinal epithelial cells. The clinical manifestations of the ensuing mucositis include digestive symptoms such as nausea and vomiting, serious diarrhea, acute weight loss and wasting. This is fast becoming one of the limiting factors for administering chemotherapy for many cancer patients.
- Bone marrow failure syndromes are a set of conditions that develop when the hematopoietic stem cell compartment is compromised and fails to give rise to normal cell types. Bone marrow failure occurs as a result of inherited genetic abnormalities, exposure to a noxious substance, such as toxins, chemicals or viruses.
- TGF- ⁇ and NF- ⁇ activations are known to promote cancer invasion and metastasis.
- TGF- ⁇ inhibitors are in clinical trials for treating metastatic cancer and NF-KB inhibitors are used in cancer prevention.
- Smad7 has been shown to prevent angiogenesis and fibrogenesis, and may therefore be particularly useful in situations where the tumor needs to develop a blood supply and/or stroma.
- the cancer may be selected from the group consisting of brain, lung, liver, spleen, kidney, lymph node, small intestine, pancreas, blood cells, colon, stomach, breast, endometrium, prostate, testicle, cervix, uterus, ovary, skin, head & neck, esophagus, bone marrow and blood cancer.
- the cancers may be metastatic or primary, recurrent or multi-drug resistant.
- the cancer is a solid tumor (organ tumor). Solid tumors refer to a mass of cells that grow in organ systems and can occur anywhere in the body.
- Two types of solid tumors include epithelial tumors (carcinomas) that occur in the epithelial tissue inside or outside an organ, and sarcomas (connective tissue tumors) that occur in connective tissue such as, but not limited to, muscles, tendons, fat, nerves and other connective tissues that support, surround, or connect structures and organs in the body.
- the cancer is a liquid tumor or cancer of the blood, bone marrow, or lymph nodes.
- These tumors include, but are not limited to, leukemia, lymphoma, and myeloma.
- Smad7 effects on wound stroma include one or more of reducing inflammation, angiogenesis, or collagen production, among others.
- these effects may be mediated through reduction of NF- ⁇ signaling (evidenced by reduced p50), and blocking TGF- ⁇ signaling (evidenced by reduced pSmad2).
- reduced inflammation could significantly contribute to accelerated wound healing, optionally through reduced angiogenesis and collagen production and/or reduced leukocyte infiltration leading to reduction of cytokines and chemokines normally released by leukocytes, which are angiogenic and fibrogenic.
- Temporal treatment with Smad7 may allow early stage angiogenesis and collagen production required for wound repair, while preventing prolonged angiogenesis and collagen production. These changes could potentially accelerate wound stromal remodeling and prevent excessive scarring due to unresolved inflammation or collagen overproduction.
- Stomatitis is an inflammation of the mucous lining of any of the structures in the mouth, which may involve the cheeks, gums, tongue, lips, throat, and roof or floor of the mouth.
- the inflammation can be caused by conditions in the mouth itself, such as poor oral hygiene, dietary protein deficiency, poorly fitted dentures, or from mouth burns from hot food or drinks, toxic plants, or by conditions that affect the entire body, such as medications, allergic reactions, radiation therapy, or infections.
- Severe iron deficiency anemia can lead to stomatitis. Iron is necessary for the upregulation of transcriptional elements for cell replication and repair. Lack of iron can cause the genetic downregulation of these elements, leading to ineffective repair and regeneration of epithelial cells, especially in the mouth and lips.
- angular stomatitis is a frequent cause is repeated lip-licking and in adults it may be a sign of underlying iron deficiency anemia, or vitamin B deficiencies (e.g., B2-riboflavin, Bg-folate or B ⁇ -cobalamin), which in turn may be evidence of poor diets or malnutrition (e.g., celiac disease).
- vitamin B deficiencies e.g., B2-riboflavin, Bg-folate or B ⁇ -cobalamin
- angular cheilitis can be caused by a patient's jaws at rest being "overdosed" due to edentulousness or tooth wear, causing the jaws to come to rest closer together than if the complete/unaffected dentition were present.
- Treatment usually involves the administration of topical nystatin or similar antifungal agents.
- Another treatment can be to correct the jaw relationship with dental treatment (e.g., dentures or occlusal adjustment).
- Migratory stomatitis is a condition in which extensive areas in the oral cavity mucosa are affected by annular atrophic red lesions that are surrounded by a thin white rim. This is a relatively uncommon form of the geographic tongue condition, that, as opposed to migratory stomatitis, is confined to the dorsal and lateral aspects of the tongue mucosa only.
- Proctitis is inflammation of the lining of the rectum, the lower end of the large intestine leading to the anus. With proctitis, inflammation of the rectal lining— called the rectal mucosa— is uncomfortable and sometimes painful. The condition may lead to bleeding or mucous discharge from the rectum, among other symptoms.
- Some causes of proctitis include, but are not limited to: sexually transmitted diseases (STDs), such as those that can be transmitted during anal sex (e.g., gonorrhea, chlamydia, syphilis, and herpes); non-STD infections from, for example, food borne bacteria (e.g., Salmonella and Shigella); anorectal trauma from, for example, anal sex or the insertion of objects or substances into the rectum (e.g., chemicals from enemas); ulcerative colitis and Crohn's disease or other inflammatory bowel diseases, may cause ulcers (e.g., sores) in the inner lining of the colon and rectum; radiation therapy, particularly of the pelvic area (e.g., rectal, ovarian, or prostate cancer) which may lead to rectal bleeding; antibiotics which lead to a loss of commensal bacteria allowing harmful bacteria (e.g., Clostridium difficile) to cause disease.
- compositions - proteins, expression vectors, virus stocks, proteins and drugs - in a form appropriate for the intended application.
- this will entail preparing compositions that are essentially free of pyrogens, as well as other impurities that could be harmful to humans or animals.
- PTD-Smad7 (and truncated variants) were purified extensively prior to use in animal models. PTD-Smad7 (and truncated versions) were prepared for topical and trans-mucosal application using a mixture of glycerol and PBS.
- compositions of the present technology comprise an effective amount of the vector to cells, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. Such compositions also are referred to as inocula.
- pharmaceutically or pharmacologically acceptable refer to molecular entities and compositions that do not produce adverse, allergic, or other untoward reactions when administered to an animal or a human.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like.
- the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the vectors or cells of the present technology, its use in therapeutic compositions is contemplated. Supplementary active ingredients also can be incorporated into the compositions.
- the active compositions of the present technology may include classic pharmaceutical preparations. Administration of these compositions according to the present technology will be via any common route so long as the target tissue is available via that route.
- routes of administration may include oral parenteral (including intravenous, intramuscular, subcutaneous, intradermal, intra-articular, intra-synovial, intrathecal, intra-arterial, intracardiac, subcutaneous, intraorbital, intracapsular, intraspinal, intrastemal, and transdermal), nasal, buccal, urethral, rectal, vaginal, mucosal, dermal, or topical
- administration may be by orthotopic, intradermal, subcutaneous, intramuscular, intraperitoneal or intravenous injection.
- Such compositions would normally be administered as pharmaceutically acceptable compositions, described supra.
- direct intratumoral administration perfusion of a tumor, or administration local or regional to a tumor, for example, in the local or regional vasculature or lymphatic system, or in a resected tumor bed.
- Administration can also be via nasal spray, surgical implant, internal surgical paint, infusion pump, or via catheter, stent, balloon or other delivery device.
- the most useful and/or beneficial mode of administration can vary, especially depending upon the condition of the recipient and the disorder being treated.
- Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as
- Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- a coating such as lecithin
- surfactants for example, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. The use of such media and agents for
- compositions are well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
- compositions of the present technology may be formulated in a neutral or salt form.
- Pharmaceutically-acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- formulations are easily administered in a variety of dosage forms. Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biologies standards.
- the polypeptides of the present technology may be incorporated with excipients and used in the form of non-ingestible mouthwashes and dentifrices. It is anticipated that virtually any pill or capsule type known to one of skill in the art including, e.g., coated, and time delay, slow release, etc., may be used with the present technology.
- a mouthwash may be prepared incorporating the active ingredient in the required amount in an appropriate solvent, such as a sodium borate solution (Dobell's Solution).
- the active ingredient may be incorporated into an antiseptic wash containing sodium borate, glycerin and potassium bicarbonate.
- the active ingredient may also be dispersed in dentifrices, including: gels, pastes, creams, powders and slurries.
- the active ingredient may be added in a therapeutically effective amount to a paste dentifrice that may include water, binders, abrasives, flavoring agents, foaming agents, and humectants.
- compositions suitable for oral dosage may take various forms, such as tablets, capsules, caplets, and wafers (including rapidly dissolving or effervescing), each containing a predetermined amount of the active agent.
- the compositions may also be in the form of a powder or granules, a solution or suspension in an aqueous or non-aqueous liquid, and as a liquid emulsion (oil-in-water and water-in-oil).
- the active agents may also be delivered as a bolus, electuary, or paste. It is generally understood that methods of preparations of the above dosage forms are generally known in the art, and any such method would be suitable for the preparation of the respective dosage forms for use in delivery of the compositions.
- an active agent compound may be administered orally in combination with a pharmaceutically acceptable vehicle such as an inert diluent or an edible carrier.
- a pharmaceutically acceptable vehicle such as an inert diluent or an edible carrier.
- Oral compositions may be enclosed in hard or soft shell gelatin capsules, may be compressed into tablets or may be incorporated directly with the food of the patient's diet. The percentage of the composition and preparations may be varied; however, the amount of substance in such therapeutically useful compositions is preferably such that an effective dosage level will be obtained.
- Hard capsules containing the active agent compounds may be made using a physiologically degradable composition, such as gelatin. Such hard capsules comprise the compound, and may further comprise additional ingredients including, for example, an inert solid diluent such as calcium carbonate, calcium phosphate, or kaolin.
- Soft gelatin capsules containing the compound may be made using a physiologically degradable composition, such as gelatin. Such soft capsules comprise the compound, which may be mixed with water or an oil medium such as peanut oil, liquid paraffin, or olive oil.
- Sublingual tablets are designed to dissolve very rapidly. Examples of such compositions include ergotamine tartrate, isosorbide dinitrate, and isoproterenol HCL.
- compositions of these tablets contain, in addition to the drug, various soluble excipients, such as lactose, powdered sucrose, dextrose, and mannitol.
- suitable coating materials include, but are not limited to, cellulose polymers (such as cellulose acetate phthalate, hydroxypropyl cellulose, hydroxypropyl methylcellulose, hydroxypropyl methylcellulose phthalate, and hydroxypropyl methylcellulose acetate succinate), polyvinyl acetate phthalate, acrylic acid polymers and copolymers, and methacrylic resins (such as those commercially available under the trade name EUDRAGIT ® ), zein, shellac, and polysaccharides.
- cellulose polymers such as cellulose acetate phthalate, hydroxypropyl cellulose, hydroxypropyl methylcellulose, hydroxypropyl methylcellulose phthalate, and hydroxypropyl methylcellulose acetate succinate
- polyvinyl acetate phthalate acrylic
- Powdered and granular compositions of a pharmaceutical preparation may be prepared using known methods. Such compositions may be administered directly to a patient or used in the preparation of further dosage forms, such as to form tablets, fill capsules, or prepare an aqueous or oily suspension or solution by addition of an aqueous or oily vehicle thereto. Each of these compositions may further comprise one or more additives, such as dispersing or wetting agents, suspending agents, and preservatives. Additional excipients (e.g., fillers, sweeteners, flavoring, or coloring agents) may also be included in these compositions.
- additives such as dispersing or wetting agents, suspending agents, and preservatives.
- Additional excipients e.g., fillers, sweeteners, flavoring, or coloring agents
- Liquid compositions of pharmaceutical compositions which are suitable for oral administration may be prepared, packaged, and sold either in liquid form or in the form of a dry product intended for reconstitution with water or another suitable vehicle prior to use.
- a tablet containing one or more active agent compounds described herein may be manufactured by any standard process readily known to one of skill in the art, such as, for example, by compression or molding, optionally with one or more adjuvant or accessory ingredient.
- the tablets may optionally be coated or scored and may be formulated so as to provide slow or controlled release of the active agents.
- Solid dosage forms may be formulated so as to provide a delayed release of the active agents, such as by application of a coating.
- Delayed release coatings are known in the art, and dosage forms containing such may be prepared by any known suitable method. Such methods generally include that, after preparation of the solid dosage form (e.g., a tablet or caplet), a delayed release coating composition is applied. Application can be by methods, such as airless spraying, fluidized bed coating, use of a coating pan, or the like.
- Materials for use as a delayed release coating can be polymeric in nature, such as cellulosic material (e.g., cellulose butyrate phthalate, hydroxypropyl methylcellulose phthalate, and carboxymethyl ethylcellulose), and polymers and copolymers of acrylic acid, methacrylic acid, and esters thereof.
- cellulosic material e.g., cellulose butyrate phthalate, hydroxypropyl methylcellulose phthalate, and carboxymethyl ethylcellulose
- acrylic acid, methacrylic acid, and esters thereof e.g., acrylic acid, methacrylic acid, and esters thereof.
- Solid dosage forms according to the present technology may also be sustained release (i.e., releasing the active agents over a prolonged period of time), and may or may not also be delayed release.
- Sustained release compositions are known in the art and are generally prepared by dispersing a drug within a matrix of a gradually degradable or hydrolyzable material, such as an insoluble plastic, a hydrophilic polymer, or a fatty compound.
- a solid dosage form may be coated with such a material.
- compositions for parenteral administration include aqueous and non-aqueous sterile injection solutions, which may further contain additional agents, such as antioxidants, buffers, bacteriostats, and solutes, which render the compositions isotonic with the blood of the intended recipient.
- the compositions may include aqueous and non-aqueous sterile suspensions, which contain suspending agents and thickening agents.
- Such compositions for parenteral administration may be presented in unit-dose or multi-dose containers, such as, for example, sealed ampoules and vials, and may be stores in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example, water (for injection), immediately prior to use.
- Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules, and tablets of the kind previously described.
- compositions for rectal delivery include rectal suppositories, creams, ointments, and liquids. Suppositories may be presented as the active agents in combination with a carrier generally known in the art, such as polyethylene glycol. Such dosage forms may be designed to disintegrate rapidly or over an extended period of time, and the time to complete disintegration can range from a short time, such as about 10 minutes, to an extended period of time, such as about 6 hours.
- Topical compositions may be in any form suitable and readily known in the art for delivery of active agents to the body surface, including dermally, buccally, and sublingually. Typical examples of topical compositions include ointments, creams, gels, pastes, and solutions. Compositions for administration in the mouth include lozenges.
- oral (topical, mucosal, and/or dermal) delivery materials can also include creams, salves, ointments, patches, liposomes, nanoparticles, microparticles, timed-release formulations and other materials known in the art for delivery to the oral cavity, mucosa, and/or to the skin of a subject for treatment and/or prevention of a condition disclosed herein.
- Certain embodiments concern the use of a biodegradable oral (topical, mucosal, and/or dermal) patch delivery system or gelatinous material.
- These compositions can be a liquid formulation or a pharmaceutically acceptable delivery system treated with a formulation of these compositions, and may also include activator/inducers .
- compositions for use in the methods of the present technology may also be administered transdermally, wherein the active agents are incorporated into a laminated structure (generally referred to as a "patch") that is adapted to remain in intimate contact with the epidermis of the recipient for a prolonged period of time.
- patches are available as single layer “drug-in-adhesive" patches or as multi-layer patches where the active agents are contained in a layer separate from the adhesive layer. Both types of patches also generally contain a backing layer and a liner that is removed prior to attachment to the recipient's skin.
- Transdermal drug delivery patches may also be comprised of a reservoir underlying the backing layer that is separated from the skin of the recipient by a
- Transdermal drug delivery may occur through passive diffusion, electrotransport, or iontophoresis.
- a patch contemplated herein may be a slowly dissolving or a time-released patch.
- a slowly dissolving patch can be an alginate patch.
- a patch may contain a detectible indicator dye or agent such as a fluorescent agent.
- a tag e.g., detectible tag such as a biotin or fluorescently tagged agent
- a treatment molecule in order to detect the molecule after delivery to the subject.
- one or more oral delivery patches or other treatment contemplated herein may be administered to a subject three times daily, twice daily, once a day, every other day, weekly, and the like, depending on the need of the subject as assessed by a health professional.
- Patches contemplated herein may be oral-biodegradable patches or patches for exterior use that may or may not degrade.
- Patches contemplated herein may be 1 mm, 2 mm, 3 mm, 4 mm to 5 mm in size or more depending on need.
- skin patches are contemplated herein for use for example in a subject suffering from psoriasis.
- Smad7 can be delivered topically using vehicles such as glycerol, carboxymethycellulose. It can also use transdermal system (e.g., commercially available from 3M) for delivery. Subcutaneous injection into the lesion (in normal saline or PBS) can also be used.
- vehicles such as glycerol, carboxymethycellulose.
- transdermal system e.g., commercially available from 3M
- Subcutaneous injection into the lesion in normal saline or PBS
- PBS normal saline
- compositions may include short-term, rapid-onset, rapid-offset, controlled release, sustained release, delayed release, and pulsatile release compositions, providing the compositions achieve administration of a compound as described herein. See Remington 's Pharmaceutical Sciences ( 18th ed. ; Mack Publishing Company, Eaton, Pennsylvania, 1990), herein incorporated by reference in its entirety.
- the compounds and compositions disclosed herein can be delivered via a medical device.
- a medical device can generally be via any insertable or implantable medical device, including, but not limited to stents, catheters, balloon catheters, shunts, or coils.
- the present technology provides medical devices, such as stents, the surface of which is coated with a compound or composition as described herein.
- the medical device of this technology can be used, for example, in any application for treating, preventing, or otherwise affecting the course of a disease or condition, such as those disclosed herein.
- agents/therapies at the same time, e.g. , using a single composition or pharmacological formulation that includes both agents, or by contacting the cell/subject with two distinct compositions or formulations, at the same time, wherein one composition includes the Smad7 agent and the other includes the other agent.
- the Smad7 agent may precede or follow the other treatment by intervals ranging from minutes to weeks.
- agents suitable for use in a combined therapy against an inflammatory disorder include steroids, glucocorticoids, non-steriodal anti-inflammatory drugs ( SAIDS; including COX-1 and COX-2 inhibitors), aspirin, ibuprofen, and naproxen.
- SAIDS non-steriodal anti-inflammatory drugs
- Analgesics are commonly associated with anti-inflammatory drugs but which have no anti-inflammatory effects.
- An example is paracetamol, called
- NSAIDS which reduce pain and inflammation by inhibiting COX enzymes, paracetamol has recently been shown to block the reuptake of endocannabinoids, which only reduces pain, likely explaining why it has minimal effect on inflammation.
- a particular agent for combination use is an anti-TGF- ⁇ antibody.
- the present technology has particular relevance to the treatment of DNA damage and/or inflammation resulting from certain anti-cancer therapies, and for the treatment of cancer.
- the present technology may be applied as a combination with cancer therapies.
- This process may involve contacting the cells, organ, or patient with the agents/therapies at the same time, including by contacting the cells, organ or patient with a single composition or pharmacological formulation that includes both agents, or with two distinct compositions or formulations at the same time, wherein one composition includes the Smad7 agent and the other includes the other agent.
- the compositions can be delivered at different times, including repeated doses of one or both agents.
- Agents or factors suitable for use in a combined therapy include any chemical compound or treatment method that induces DNA damage when applied to a cell. Such agents and factors include radiation and waves that induce DNA damage such as, irradiation, microwaves, electronic emissions, and the like.
- a variety of chemical compounds, also described as "chemotherapeutic” or “genotoxic agents,” are intended to be of use in the combined treatment methods disclosed herein.
- chemotherapeutic or “genotoxic agents”
- agents are intended to be of use in the combined treatment methods disclosed herein.
- treating cancer according to the present technology one would contact the tumor cells with an agent in addition to the expression construct. This may be achieved by irradiating the localized tumor site; alternatively, the tumor cells may be contacted with the agent by administering to the subject a therapeutically effective amount of a pharmaceutical composition.
- SERMs selective estrogen receptor antagonists
- Tamoxifen 4-hydroxy Tamoxifen (Afimoxfene)
- Falsodex Raloxifene
- Bazedoxifene Raloxifene
- Clomifene Femarelle
- Lasofoxifene Ormeloxifene
- Toremifene Toremifene
- Chemotherapeutic agents contemplated to be of use include, e.g., camptothecin, actinomycin-D, mitomycin C.
- the present technology also encompasses the use of a combination of one or more DNA damaging agents, whether radiation-based or actual compounds, such as the use of X-rays with cisplatin or the use of cisplatin with etoposide.
- the agent may be prepared and used as a combined therapeutic composition, or kit, by combining it with a MUC1 peptide, as described above.
- Heat shock protein 90 is a regulatory protein found in many eukaryotic cells. HSP90 inhibitors have been shown to be useful in the treatment of cancer. Such inhibitors include Geldanamycin, 17-(Allylamino)-17-demethoxygeldanamycin, PU-H71 and Rifabutin.
- Agents that directly cross-link DNA or form adducts are also envisaged. Agents such as cisplatin, and other DNA alkylating agents may be used. Cisplatin has been widely used to treat cancer, with efficacious doses used in clinical applications of 20 mg/m 2 for 5 days every three weeks for a total of three courses. Cisplatin is not absorbed orally and must therefore be delivered via injection intravenously, subcutaneous ly, intratumorally or intraperitoneally.
- Agents that damage DNA also include compounds that interfere with DNA replication, mitosis and chromosomal segregation.
- chemotherapeutic compounds include adriamycin, also known as doxorubicin, etoposide, verapamil, podophyllotoxin, and the like. Widely used in a clinical setting for the treatment of neoplasms, these compounds are administered through bolus injections intravenously at doses ranging from 25-75 mg/m 2 at 21 day intervals for doxorubicin, to 35-50 mg/m 2 for etoposide intravenously or double the intravenous dose orally.
- Microtubule inhibitors such as taxanes, also are contemplated. These molecules are diterpenes produced by the plants of the genus Taxus, and include paclitaxel and docetaxel.
- Epidermal growth factor receptor inhibitors such as Iressa, mTOR, the mammalian target of rapamycin, also known as FK506-binding protein 12-rapamycin associated protein 1 (FRAPl) is a serine/threonine protein kinase that regulates cell growth, cell proliferation, cell motility, cell survival, protein synthesis, and transcription. Rapamycin and analogs thereof (“rapalogs”) are therefore provided for use in combination cancer therapy in accordance with the present technology.
- FRAPl FK506-binding protein 12-rapamycin associated protein 1
- TNF-a tumor necrosis factor-alpha
- cytokine involved in systemic inflammation
- cytokines that stimulate the acute phase reaction.
- the primary role of TNF is in the regulation of immune cells. TNF is also able to induce apoptotic cell death, to induce inflammation, and to inhibit tumorigenesis and viral replication.
- nucleic acid precursors and subunits also lead to DNA damage.
- nucleic acid precursors have been developed.
- agents that have undergone extensive testing and are readily available are preferentially used by neoplastic tissue, making this agent particularly useful for targeting to neoplastic cells.
- 5-fluorouracil (5-FU) are preferentially used by neoplastic tissue, making this agent particularly useful for targeting to neoplastic cells.
- 5-FU Although quite toxic, 5-FU, is applicable in a wide range of carriers, including topical, however intravenous administration with doses ranging from 3 to 15 mg/kg/day being commonly used.
- ⁇ -rays ⁇ -rays
- x-rays x-rays
- UV-irradiation UV-irradiation
- Dosage ranges for x-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 weeks), to single doses of 2000 to 6000 roentgens.
- Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
- ERBITUX® GLEEVEC®, HERCEPTI ®, and RITUXAN®.
- downstream molecules turned on or bound by Smad7 can be identified as additional therapeutic targets for example, to treat oral mucositis, psoriasis and other conditions aggravated by TGF- ⁇ activities and NF- ⁇ activities.
- kits provided herein may include compositions discussed above for treating a subject having a condition provided herein, such as but not limited to oral mucositis, psoriasis, or wound healing.
- the kits can include one or more containers containing the therapeutic Smad7 compositions of the present technology. Any of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container, into which compositions may be preferably and/or suitably aliquoted. Kits herein may also include a kit for assessing biological targets that contribute to a condition provided herein.
- markers may include, but are not limited to, Racl for cell migration, NF- ⁇ for inflammation, and TGF- ⁇ for growth arrest and inflammation.
- methods for detection of and/or changes in the levels of one or more markers associated with Smad7 activity are provided and/or known in the art.
- the level of expression of one or more of the Smad7 markers in a subject may be assessed, and based on the level detected, a decision may be made to treat (or to continue or discontinue treatment) with Smad7, or to employ an alternate treatment.
- detection of as used herein refers to the ability to measure the presence or absence of a marker at some repeatable and controlled level. Typically, detection is performed over background values, which may include the noise (or detection limits) inherent in the testing system. As such, there is typically a "lower limit" of detection associated with an assay, and in order to be detected, a change may need to be above a certain cut-off level, for example. Determination of such limits is well-known in the art.
- detection is performed as compared to controls, which may include, but are not limited to, a comparison with data from normal subjects and/or comparable normal tissue (in the same or different subjects) absent the disease or disorder present in the subject (or the specific tissue of the subject tested).
- the comparison may be between levels detected at a variety of time intervals (and/or locations) in a patient.
- the detection needs to be statistically significant as compared to background or control levels; the ability to assess significance is well-known in the art, and exemplified in the Examples.
- the term "changes in the levels" as used herein refers to a detectable change from a control or background level, and or a previously detected level.
- the change is an increase as compared to another level, and in some embodiments the change is a decrease as compared to another level.
- the detectable change is statistically significant.
- such changes can be assessed quantitatively as at least about a 5%, 10%, 25%, 50%, 100%, 200%, 500% or greater change, and/or about a 5-10%, 10-25%, 10-50%, 25-50%, 50-75%, 50-100%, 100-150%, 100-200%, 200-300%, 300-500%, or 500-1000% change.
- biological activity may be assessed using one of the methods described herein, including those described below in Examples 5 and 8. Some of the biological activities that can be assessed include, but are not limited to, increasing cell proliferation, reducing or inhibiting cell death, reducing excessive inflammation, preventing DNA damage, and/or increasing cell migration, as well as animal models treating or preventing one or more disease or disorders in which such treatment would be helpful as further discussed herein.
- Such activities can be assessed using one or more assays including, but not limited to, the ability to block phosphorylation of Smad2 and/or nuclear translocation of the NF- ⁇ p50 subunit, increase cell proliferation, reduce apoptosis and/or radiation-induced DNA damage, reduce inflammation and/or angiogenesis, promote healing in oral mucositis, surgical wounds, diabetes wounds, and/or wounds associated with chronic inflammation in mice and other laboratory models.
- Some specific examples include, but are not limited to,
- IF immunofluorescence
- IHC immunohistochemistry
- TUNEL TUNEL assay for apoptosis
- biologically active fragments are those that are selected to include one or more or all of the activities described herein. In some embodiments, biologically active fragments selected to include only or primarily 1, only or primarily 2, only or primarily 3, only or primarily 4, or only or primarily 5 of the activities described herein. In some embodiments, biologically active fragments selected to exclude only or primarily 1, only or primarily 2, only or primarily 3, only or primarily 4, or only or primarily 5 of the activities described herein. In some embodiments, the biologically active fragments are selected to include or to exclude a specific subset of the activities described herein. For instance, increased proliferation and migration may be sufficient for treating diabetic wounds, whereas anti-inflammation is needed in chronic inflammatory wounds. Reduced apoptosis and DNA damage activities are needed for treating oral mucositis but not for treating surgical wounds
- the term "primarily includes” as used herein refers to fragments in which although some level of other biological activity may remain, that activity is reduced as compared with full-length fragments, whereas the activity that is considered “primary” remains at about the same or an increased level as that observed in the full-length native protein.
- the term “primarily excludes” as used herein refers to fragments in which although some level of a particular biological activity may remain, the level of that particular activity is reduced (optionally significantly and/or statistically significantly reduced) as compared with full-length fragments, whereas one or more other biological activities remains at about the same or increased level as that observed in the full-length native protein.
- the methods include assessing changes in the level of expression of one or more biological activities, including increases and decreases of one or more activities in a selected fragment are assessed as changes in reference to the activities observed in the full-length protein.
- one or more biological activities are being selected to remain the same as that observed in the full-length fragments while other activities may be increased or decreased or even eliminated (e.g., such fragments would lack one or more of the activities discussed).
- the change is an increase as compared to another level, and in some embodiments the change is a decrease as compared to another level.
- the detectable change is statistically significant. In some
- such changes can be assessed quantitatively as at least about a 5%, 10%, 25%, 50%, 100%, 200%, 500% or greater change, and/or about a 5-10%, 10-25%, 10-50%, 25-50%, 50-75%, 50-100%, 100-150%, 100-200%, 200-300%, 300-500%, or 500-1000% change.
- an activity that "remains the same” can still be observed to have some change from the activity of the full-length protein, but such change might be limited to, for example, about a 1%, 2%, 5%, 10%, or 20% change or less.
- fragments of interest may include those that primarily mediate the anti-inflammatory effect of Smad7.
- anti-inflammatory function may be sufficient and optionally an improvement for treating chronic inflammation associated conditions, such as but not limited to, oral mucositis, stomatitis and psoriasis, among others.
- fragments of interest may include those that primarily mediate cell migration and/or blocking
- TGF- -induced growth arrest and/or fibrotic response Smad7 peptides having this cell migration and proliferation function may be sufficient, and optionally an improvement, for enhancing healing that is not associated with excessive inflammation.
- Types of wounds that might benefit from this form of treatment include, but are not limited to, surgical wounds, fibrotic scarring, and diabetes wounds, defective healing and/or scarring among others.
- methods for producing Smad7 protein including any of the Smad7 variants, fragments, truncations, fusion proteins (e.g., PTD-Smad7) described herein are contemplated.
- the inventors have discovered methods of producing Smad7 protein at levels and purity sufficient for research, development, or commercialization that include nucleic acid codon optimization.
- methods for producing Smad7 including the use of one or more of the codon-optimized Smad7 nucleic acid molecules described herein (e.g., within the Examples) are expressly contemplated.
- Example 1 K5.Smad7 mice are resistant to oral mucositis
- a transgenic mouse model expressing a human Smad7 protein in keratinocytes was generated as previously described (Han et ah, Dev. Cell, 11 :301-312, 2006). Transgene expression in oral epithelia was confirmed (FIGS. 7A-B). The mice were bred into in the C57BL/6 background, and 8-10 weeks old male and female transgenic mice and wild-type littermates were used in studies. These mice showed improved healing of excisional skin wounds (Han et al, Am. J. Pathol., 179: 1768-1779, 201 1) and
- FIG. 1A histological analyses revealed that wild-type mice developed oral mucositis (FIG. 1A) similar to that in humans (FIG. 1C).
- the First affiliated Hospital of Kunming Medical University, China provided de-identified archived human tissue paraffin sections and approved the study as an exempt for human subjects.
- Oral mucositis lesions were from the tongue, buccal or oropharyngeal mucosa adjacent to recurrent oral cancers that had undergone radiotherapy.
- Non-irradiated oral mucosa sections were from surgically removed sleep apnea oral tissues and a tongue biopsy adjacent to a cyst (mucocele).
- K5.Smad7 oral epithelia typically showed radiation dose-dependent damage, i.e., thinning epithelium and flattened tongue papillae after 8 Gy x 3 radiation, and more damaged (hypo- or hypertrophic) epithelial cells after 18 Gy and 22 Gy radiation (FIG. 1A).
- FIG. 1C Consistent with increased leukocyte infiltration in human oral mucositis lesions (FIG. 1C), lesions in wild-type mice harbored numerous infiltrated leukocytes (FIGS. 1D-E) consisting of neutrophils, macrophages, and lymphocytes (FIG. 7D); all were substantially reduced in K5.Smad7 oral mucosa (FIGS. 1D-E and 7D).
- TGF- ⁇ an immune suppressant in internal organ, but pro-inflammatory in oral mucosa, together with its activated signaling mediator, phosphorylated (p) Smad2, were also increased in oral mucositis compared to non-irradiated oral mucosa in wild-type mice (FIGS. 2A-B). Similar changes were also detected in human oral mucositis lesions (FIGS. 2A-B).
- Rhinl a protein indispensable for oral wound healing was examined. Racl was reduced after Smad7 knockdown (FIG. 2E). It was expected that TGF- ⁇ overexpression in oral mucositis would activate Racl through a Smad- independent mechanism. However, although total Racl protein increased by 2-fold after irradiation, activated Racl protein did not change considerably in wild-type tongues (FIG. 2F).
- Luciferase reporter assays using a SBE-containing Racl -Luc construct show that knockdown of Smad7 in wild-type keratinocytes significantly reduced luciferase activity (FIG. 3E). Conversely, Smad7 transgenic cells had increased luciferase activity compared to wild-type cells, and mutating the SBE attenuated this increase (FIG. 3F). Thus, Smad7 binding to SBE appears necessary to expel signaling Smads to abrogate Racl repression.
- FIGS. 4D-4F CtBP 1 positive cells were significantly increased in irradiated oral mucosa of wild-type and K5.Smad7 mice as well as in human oral mucositis (FIGS. 4D-4F). Additionally, CtBPl mRNA in irradiated wild-type oral mucosa was significantly increased on day 9 and day 10 (FIG. 4G). CtBPl mRNA level in K5.Smad7 mucosa was similar to wild-type mucosa at earlier time points, but declined to normal by day 10 (FIG. 4G).
- Smad7 transgene's ability to block multiple pathological processes of oral mucositis prompted us to explore if localized Smad7 delivery can be used to prevent and treat oral mucositis. Because Smad7 is a nuclear protein, local Smad7 delivery needs to allow Smad7 to rapidly enter into cells before saliva washes off the protein. Thus, a recombinant human Smad7 with an N-terminal Tat-tag allowing proteins to rapidly permeate the cell membrane and enter the nucleus was produced. A V5 epitope was added to the C-terminal end of the Tat-Smad7 protein to track Tat-Smad7 cell penetration (FIGS. 11A-11D).
- Tat-Smad7 bioactivity was tested (FIG. 11C).
- Tat-Cre recombinant protein with the same tags as a control (FIGS. 11E-F) was produced, and cloned into the pETlOl-Topo protein expression vector
- Tat-Cre was transformed into BL-21 STARTM E. coli (Invitrogen) to produce Tat-Cre protein and was purified with Ni-NTA column.
- Tat-Smad7 was added to primary mouse keratinocytes. Slides were fixed in cold methanol for 5 minutes and stained for V5 and pSmad2. Tat-Cre activity was verified by digesting a 1,460 bp floxed fragment from the 7,650 bp vector pLL3.7 (Addgene). For in vivo treatments, 30 ⁇ ⁇ 50% glycerol/PBS as a vehicle control and Tat-Cre as a non-irrelevant protein control were used. Tat-Smad7 or Tat-Cre (in 30 50% glycerol/PBS, doses and regimens are specified in each figure) was topically applied to mouse oral cavity and mice were restricted from oral intake for 1 hour.
- glycerol/PBS were topically applied to the oral cavity of 8-10 week old C3H females (Jackson Laboratory) or C57BL/6 mice daily, starting 24 hours prior to radiation through day 8 after initiation of radiation. Treated tissues were examined on day 9. Mouse tongues were harvested, fixed in 10% formalin, embedded in paraffin, and cut into 5 ⁇ sections. Histological changes were analyzed and ulcers were measured using H&E stained slides. An additional group received Palifermin treatment with a clinical regimen, i.e., 6.25 mg kg "1 (i.p.) daily for 3 days prior to irradiation, and daily for 3 days 24 hours after the last dose of radiation. [0237] Tat-Cre showed no effect compared to vehicle controls (FIGS. 5A-B).
- Tat-Smad7 treatments showed preventive effects on ulcer formation similar to Palifermin (FIG. 5A).
- BED 20 Gy
- both Palifermin and Tat-Smad7 treated oral mucosa prevented open ulceration in the majority of cases (FIG. 5B).
- Palifermin-treated mucosa exhibited more keratinocyte down-growth but also more damaged keratinocytes (condensed or charcoal-like nuclei, swelled mono- or multi-nucleated cells and shattered nuclear fragments in conified layers) than Tat-Smad7 -treated mucosa (FIG. 5B).
- Immunostaining revealed that Palifermin increased proliferation more significantly than Tat-Smad7.
- Tat-Smad7 reduced apoptosis, leukocyte infiltration, nuclear pSmad2 and NF- ⁇ p50, but Palifermin did not (FIGS. 5B-5G).
- mice were exposed to fractionated (8 Gy x 3) cranial radiation and Tat-Smad7 (topically) or Palifermin (6.25 mg kg "1 , i.p.) was applied daily from day 6 after initiation of radiation (when mucosal damage was obvious) till day 9. Treated tissues were examined on day 10. Although beginning post-radiation administration of Palifermin at earlier time points than the current protocol reduced oral mucositis in mice, Palifermin administration with the current protocol did not accelerate ulcer closure (FIG. 6A), regardless of its hyperproliferative effect on the entire oral mucosa (FIG. 6B). This is not surprising, as Palifermin is approved to prevent but not treat oral mucositis.
- Tat-Smad7 treated oral mucositis reduced ulcer sizes and pathological alterations after both fractionated and single dose radiation (FIGS. 6A-B and FIGS. 12A-12G). Away from ulcers, Tat-Smad7 treated oral mucosa exhibited less hyperplasia and more
- Tat-Smad7 increased Racl promoter activity and reduced CtBPl binding to the SBE of the mouse Racl promoter (FIGS. 12G and 121), and increased Racl protein in mouse oral mucositis and human oral keratinocytes (FIGS. 6D-E).
- Tat-Smad7-treated human oral keratinocytes after wound scratch had accelerated wound closure had accelerated wound closure (FIG. 6F and FIG. 13A). Further, irradiated human oral keratinocytes increased nuclear pSmad2 and NF- ⁇ p50, which were attenuated by Tat-Smad7 treatment (FIG. 13B). In contrast, although Tat-Smad7 penetrated oral cancer cells efficiently (FIG. 13C), it did not further elevate Racl protein level that is already abundant in cancer cells (FIG. 13D). This result could account for faster migration of cancer cells than normal keratinocytes (FIG. 6F and FIGS.
- Colony assays show that survival of human oral keratinocytes was slightly increased by Tat-Smad7 treatment with or without radiation (FIG. 6G). Consistent with the notion that reduced survival after irradiation is more prominent in cancer cells than in normal cells, SCC cells showed substantial reductions in cell survival after radiation. Treatment with Tat-Smad7 did not affect survival in SCC cells with or without radiation (FIG. 6G).
- Smad7 In order to be effective as a therapeutic, SMAD7 needed to be able to penetrate cells efficiently. In order to achieve this, the Smad7 sequence was modified to include a protein transduction domain.
- the Tat sequence from HIV was selected to test with Smad7 as a protein transduction domain.
- the nucleotide and protein sequences of Tat that were used in fusion proteins with Smad7 and Smad7 fragments are derived from Cardarelli et ah, Traffic Apr 9(4):528-39 (2008).
- the Tat nucleotide and amino acid sequences are provided below: ggccgtaaaaaacgccgtcaacgccgccgt (SEQ ID NO: 1)
- Fusion proteins were prepared having Tat directly linked in frame to human Smad7 complementary DNA (cDNA) either at the 5 ' or 3 ' ends of Smad7 as shown below:
- the 5' Tat-Smad7 construct included a 3' V5 tag sequence, and was cloned into the pGEX-6p-l protein expression vector (New England Biolabs) to make a GST-Tat-Smad7 fusion protein. Tat-Smad7 gene was transformed into BL-21 Star Escherichia coli
- Tat-Smad7 protein The protein was purified by glutathione column purification and elution, using enzymatic cleavage from the Glutathione S Transferase (GST) fusion (Precision enzyme, GE Life Sciences).
- GST Glutathione S Transferase
- V5 tag at the 3' end was included to monitor Tat-Smad7 penetration into cells by immunostaining using a V5 antibody.
- This epitope tag can be deleted for use in the clinic (e.g., by re-cloning the sequence in the absence of the V5 tag), if appropriate.
- Tat-Smad7-V5-6H A PTD-Smad7 fusion protein (Tat-Smad7-V5-6H) was also created having a 6-Histidine (6-H) tag for protein purification, and is shown below.
- Tat-Smad7-V5-6H has the following nucleotide sequence: 1-53 include the 5' sequence of pET-TOPO; 54-1365 include Tat-Smad7; 1366-1497 include 3' pET-TOPO containing the V5 epitope and 6xHis tag (V5 includes 1393-1434, His tag includes 1444- 1461, and the Stop includes 1462-1464).
- Tat-human Smad7 codon-optimized for protein production, cloned to pET101/D-Topo vector is shown below: ttcccctctagaaataattttgtttaactttaagaaggaattcaggagcccttcaccatg
- Tat-Smad7-v5 and Smad7 A comparison of the protein sequence of Tat-Smad7-v5 and Smad7 is provided below.
- the first amino acid of Smad7 in Tat-Smad7 is not M (unlike Smad7), because Tat-Smad7 is designed to be in-frame with Tat and/or GST to form a GST fusion protein. Tat-Smad7 is then cleaved from the GST fusion protein after purification.
- Upper case nucleotides identify the V5 tag.
- Underlined italics indicate amino acids from the optional pET101-Topo backbone vector.
- Tat-Smad7-V5 1 gsgrkkrrqrrrgfrtkrsalvrrlwrsrapggedeeegagggggggelr human Smad7 -mfrtkrsalvrrlwrsrapggedeeegagggggggelr
- Tat-Smad7-V5 51 gegatdsrahgaggggpgragcclgkavrgakghhhphppaagagaagga human Smad7 39 gegatdsrahgaggggpgragcclgkavrgakghhhphppaagagaagga
- Tat-Smad7-V5 101 eadlkalthsvlkklkerqlelllqavesrggtrtaclllpgrldcrlgp human Smad7 89 eadlkalthsvlkklkerqlelllqavesrggtrtaclllpgrldcrlgp Tat-Smad7-V5 151 gapagaqpaqppssyslplllckvfrwpdlrhssevkrlcccesygkinp human Smad7 139 gapagaqpaqppssyslplllckvfrwpdlrhssevkrlcccesygkinp Tat-Smad7-V5 201 elvccnphhlsrlcelesppppysrypmdflkptadcpdavpssaetggt human Smad7 189 elvccnphhl
- IF Immunofluorescence
- IHC immunohistochemistry
- IF and IHC were performed as previously described (Han, G., Li, F., Ten Dijke, P. & Wang, X.J. Temporal smad7 transgene induction in mouse epidermis accelerates skin wound healing. Am J Pathol 179, 1768-1779 (201 1)).
- Primary antibodies used were guinea pig antibody to K14 (1 :400, Fitzgerald, 20R-CP200), rat antibody to CD4 (1 :20, BD
- TUNEL Terminal deoxynucleotidyl transferase uridine nick end-labeling
- PCNA or BrdU were quantified as cells mm "1 epithelial length including all epithelial cells, TUNEL or CD45-positive cells as cells mm "1 epithelial length including all epithelial layers and stroma above the muscle layer, nuclear pSmad2 or NF- ⁇ p50 positive cells as the number of positive cells/existing total remaining epithelial cells (i.e., excluding sloughed epithelial cells induced by irradiation). Consecutive fields of slides were used to count BrdU-labeled cells using MetaMorph software. [0251] Cell culture.
- Smad7 transgenic and wild-type primary keratinocytes were prepared from neonatal mouse skin as previously described (Han, G., Li, F., Ten Dijke, P. & Wang, X.J. Temporal smad7 transgene induction in mouse epidermis accelerates skin wound healing. Am J Pathol 179, 1768-1779 (2011)), and cultured in PCT medium (CELLnTEC). Spontaneously immortalized normal oral keratinocytes ( OK-SI) derived from gingival tissues of healthy volunteers were cultured and maintained in defined keratinocyte medium (Castilho, R.M., et al.
- Rhenl is required for epithelial stem cell function during dermal and oral mucosal wound healing but not for tissue homeostasis in mice.
- PloS one 5, el0503 (2010)).
- Oral cancer cells Cal27 (ATCC) and MSK921 were cultured (D. Raben's lab, fingerprinted by University of Colorado Cancer Center Tissue Culture Core) in Dulbecco Modified Eagle Medium supplemented with 10% fetal bovine serum (GIBCO®; Invitrogen).
- Tat-Smad7 was added to the culture medium immediately after irradiation.
- Cells were fixed in 100% cold methanol 4 hours after Tat-Smad7 treatment for immunostaining of pSmad2, NF- ⁇ p50 and V5.
- siRNA was transfected when cells were plated.
- Target siRNAs included in this study are: mouse siRacl-1 (Invitrogen, MSS237708) and siRacl-2 (IDT,
- MMC.RNAI.N009007.12.3 human siSmad2 (Dharmacon, L-003561-00-0005), siSmad3 (Invitrogen, HSS106252), and siSmad4 (Invitrogen, HSS 118066); human siCtBP l-1 and siCtBPl-2; human siSmad7-l and siSmad7-2; human TGF- ⁇ (Dharmacon,
- In vitro keratinocyte proliferation assay In vitro keratinocyte proliferation was determined by BrdU incorporation in wild-type and Smad7 transgenic keratinocytes. Cells at 70% confluency were transfected with Racl siRNAs, and changed to regular culture medium 24 hours later. An in situ cell proliferation kit (Roche Applied Science) was used to perform in vitro BrdU labeling and detection, and MetaMorph software was used to count BrdU-labeled cells. [0254] In vitro cell migration assays.
- Cell survival assay Cell survival assays were performed as previously described (Munshi, A., Hobbs, M. & Meyn, R.E. Clonogenic cell survival assay. Methods in molecular medicine 1 10, 21-28 (2005)), with slight modifications. Briefly, cells were plated in 12-well plates at 500 cells well "1 for non-irradiated wells, and increased up to 1,500 cells well "1 along with increased radiation doses. Cells were irradiated 24 hours after they were plated. Tat-Smad7 was added at 1 ⁇ g mL "1 or the same volume of PBS used to dissolve Tat-Smad7 (control) to culture medium of irradiated and non-irradiated cells. The medium was changed every other day with freshly added Tat-Smad7 or PBS for 10 tol4 days.
- Colonies were fixed in methanol, stained in 0.5% crystal violet solution (containing 25% methanol), counted and the average from 4 wells in each experiment was calculated. Two to three separate experiments were performed for each cell line. The relative surviving fraction was calculated as previously described, i.e., the absolute surviving fraction (colony numbers/total plated cells) under each radiation dose divided by the absolute surviving fraction of non-irradiated cells.
- the antibodies used in this study included rabbit antibody to Smad7 (1 :500), rabbit antibodies to Smad2 (1 :300, Zymed, 51-1300) and Smad4 (1 :300, Epitomics, 1676-1), rabbit antibody to Smad3 (1 :300, Cell Signaling Technology, 9513), mouse antibody to Racl (1 :500, BD Biosciences, 610651), rabbit antibody to CtBPl (1 :500, Millipore, 07-306), mouse antibody to tubulin (1 :3000, Sigma, T5168), mouse antibody to GAPDH (1 :5000, Abeam, Ab8245) and goat antibody to actin (1 : 1000, Santa Cruz Biotechnology, SC1616). Gray-scale images were obtained using the ODYSSEY v.1.2 software (LI-COR Biosciences).
- BIOCHEMTM Kit for Rac 1 activation (Cytoskeleton Inc, BK035). Wild-type and Smad7 transgenic keratinocytes were cultured in 15 cm diameter tissue culture plates and prepared protein lysates using the provided lysis buffer. To assay Racl activity, 1 mg of cell lysate was used. To examine total Racl and Smad7 proteins, 50 ⁇ g of lysate was used. To measure GTP-bound Racl in mouse tongues, half of the tongue was ground to a powder in liquid nitrogen and lysed with lysis buffer to extract protein, GTP-bound Racl was assayed in 2 mg of protein lysate per sample and 50 ⁇ g of protein lysate was loaded for total Racl protein western blot.
- ChIP assays were performed using the ChIP-IT express kit (Active Motive, 53009) as previously described (Hoot, K.E., et al. HGF upregulation contributes to angiogenesis in mice with keratinocyte-specific Smad2 deletion. J Clin Invest 120, 3606-3616 (2010); Hoot, K.E., et al . Keratinocyte-specific Smad2 ablation results in increased epithelial-mesenchymal transition during skin cancer formation and progression. Owens, et al. , J. Clin.Invest 118, 2722-2732 (2008). Smad4-dependent desmoglein-4 expression contributes to hair follicle integrity.
- DNA-protein complex was isolated from primary mouse keratinocytes.
- ChIP 6.3 ⁇ g sheared chromatin was incubated with protein-G magnetic beads and 2 ⁇ g each of rabbit antibodies to Smad2 (Cell Signaling Technology, 3122), Smad3 (Cell Signaling Technology, 9523), Smad4 (Cell Signaling Technology, 9515), Smad7 antibody (Santa Cruz Biotechnology, SC-11392), CtBPl (Millipore) or a negative control rabbit IgG (Santa Cruz Biotechnology, SC-2027).
- the SBE sequence 5'-TGTCTGTGCT-3' was mutated to 5 ' -TGATAGAGCT-3 ' .
- Racl-Luc and pGL4.74 (1 :20) were co-transfected with Smad7 siRNA, CtBP 1 siRNA or scrambled siRNA using Lipofectamine 2000 (Invitrogen) to primary mouse keratinocytes, or primary mouse keratinocytes with Tat-Smad7 treatment (1 ⁇ g mL "1 ).
- Cell lysates were collected and luciferase assays were performed 48 hours after transfection or Tat-Smad7 treatment, using the DUAL-LUCIFERASE® Reporter Assay kit (Promega) following manufacturer's instructions.
- Rac 1 -luciferase activity was measured with the Glomax machine (Promega) and expressed by the ratio of firefly activity to Renilla activity.
- Primers used for amplification oiRacl promoter sequence were:
- Example 6 Codon optimization for Smad7 protein production in E. coli or yeast
- arginine codons also have low frequency usages.
- CGA (3.5% codon utilization): nucleotides 16-18, 136-138, 199-201, 598-600, which code for arginine at positions 6, 46, 67, 200;
- CGG (5.4% codon utilization): nucleotides 31-33, 1 12-1 14, 316-318, 772-774, 940-942, 973-975, 1135-1 137, 1276-1278, which code for arginine at positions 11, 38, 106, 258, 314, 325, 379, 426;
- AGA (2.8% codon utilization): nucleotides 637-639, 814-816, which code for arginine at positions 213, 272.
- nucleotides 1-6 include the restriction recognition site for BamHI; nucleotides 7-36 include the Tat sequence; nucleotides 37-1314 include codon-optimized human Smad7 cDNA; nucleotides 1342-1383 include the V5 epitope; nucleotides 1384-1386 are the stop codon; and nucleotides 1387-1392 including the restriction recognition site for Sail.
- ATG is removed to be used with GST.
- the entire designed sequence was converted to E. coli codons based on "Codon-Usage Database.”
- the initial optimized Smad7 sequence (SEQ ID NO: 26) is shown below:
- gagctgctgc tgcaagcagt agaatcccgt ggcggtaccc gtacggcttg tctgctgctgctggctg
- Tat-Smad7-V5 A nucleotide sequence comparison between Tat-Smad7-V5 and human Smad7 cDNA is provided below.
- Human Smad7 and codon-optimized Tat-Smad7-V5 share 68% codon homology.
- Human Smad7 and codon-optimized Tat-Smad7 share 71% codon homology.
- Human Smad7 and codon-optimized Smad7 share 73% codon homology.
- Scoring matrix Linear (Mismatch 2, OpenGap 4, ExtGap 1)
- Sequence 2 Tat-Smad7-V5 1 - 1392 ( 1392 bps) human Smad7 - -aiSg g gagq38cgg8g3 ⁇ 4a:ggtgg:g Tat-Smad7-V5 ggS
- Tat-Smad7-V5 301 gaag3 ⁇ 4c:ga
- Tat-Smad7-V5 541 cg SacagtfecgiaagiBtagacgcielglg
- Tat-Smad7-V5 841 gagSiaaaggcgtgfccgg t gcgifg isgtsjcg3 ⁇ 4agsggga g egg3 ⁇ 4gga :8:t3 ⁇ 4ii8 t ists human Smad7 865 gatg ggtea ggaatggct
- Tat-Smad7-V5 141 il:g ⁇ St
- Tat-Smad7-V5 1321 gagctcaattcgaagcttgaaggtaagcctatccctaaccctctcctcggcctcgattct human Smad7 1282
- Met216 which may form an alternative open reading frame, was not altered as it was desired to preserve the amino acid sequence of Smad7, if possible. In future codon optimizations, Met216 will be mutated to Leu216 to improve protein production without impacting function in vitro and in vivo.
- Smad7 has several activities in vivo including, but not limited to, one or more of enhancing cell proliferation, enhancing cell migration, reducing DNA damage, reducing cell apoptosis, and decreasing inflammation. Smad7's effects on these processes are due to one or more of blocking TGF- ⁇ signaling, blocking NF- ⁇ signaling, blocking CtBPl activity, and/or increasing Racl expression and/or activity. It is believed that a smaller functional domain of Ptd-Smad7 may be sufficient to deliver a therapeutic effect (see, e.g., FIG. 15). In addition, the resulting shorter protein sequence is expected to enhance protein production. Additionally, it is believed that different truncated Tat-Smad7 proteins that contain partial Smad7 sequences may be useful for different treatments.
- Smad7 the C-terminal MH2 domain of Smad7 (about half length of Smad7 protein, e.g., 208-426aa) may primarily mediate the anti-inflammatory effect of Smad7 (Hong et ah, Nat Immunology , 8, 504-513, 2007).
- Smad7 peptides having this anti-inflammatory function may be sufficient and optionally an improvement for treating chronic inflammation associated conditions, such as but not limited to, oral mucositis, stomatitis and psoriasis, among others.
- the N-terminal MH1 domain plus the linker region of Smad7 (about half of the protein, e.g., 2-208aa) is known to activate MAPK and binds to Smurf, a ubiquitin E3 ligase to degrade TGF- ⁇ receptor (Aragon, et ah, Structure 20: 1726-1736 (2012)). It is believed that it may primarily mediate cell migration and/or blocking TGF-p-induced growth arrest and/or fibrotic response. Smad7 peptides having this cell migration and proliferation function may be sufficient, and optionally an improvement, for enhancing healing that is not associated with excessive inflammation. Types of wounds that might benefit from this form of treatment include, but are not limited to, surgical wounds, fibrotic scarring, and diabetes wounds, defective healing and/or scarring among others.
- nucleotides 1-6 include the restriction recognition site for BamHI; nucleotides 7-36 include the Tat PTD sequence; nucleotides 37-810 include codon-optimized for the C terminal amino acids 258 to 426 of human Smad7; nucleotides 568-609 include the V5 epitope sequence; nucleotides 610-612 include the stop sequence; and nucleotides 613-618 include the restriction recognition site for Sail: ggatccggccgtaaaaaacgccgtcaacgccgcgttcacattggtgtgtggttgcctat
- nucleotides 1-6 include the restriction recognition site for BamHI; nucleotides 7-36 include the Tat PTD sequence; nucleotides 37-810 include codon-optimized for the N terminal amino acids 1-258 of human Smad7; nucleotides 811-852 include the V5 epitope sequence (corresponding amino acid sequence in bold); nucleotides 853-855 include the stop sequence; and nucleotides 856-861 include the restriction recognition site for Sail.
- Activity of truncated Smad7 proteins is tested using the in vitro and in vivo assays used to test full-length Smad7 described above, among other assays.
- assays include, but are not limited to, the ability to block phosphorylation of Smad2 and/or nuclear translocation of the F- ⁇ p50 subunit, increase cell proliferation, reduce apoptosis and/or radiation-induced DNA damage, reduce inflammation and/or angiogenesis, promote healing in oral mucositis, surgical wounds, diabetes wounds, and/or wounds associated with chronic inflammation in mice.
- FIG. 16A demonstrates the effect of C-terminally truncated (259-426aa) Tat-C-Smad7 on a mouse wound healing model.
- Wild-type C57BL/6 mice were anaesthetized, dorsally wounded by a 6-mm dermal punch biopsy, and treated every other day with the topical application of PBS (control, 3 mice, 4 wounds/mouse), full-length Tat-Smad7 (O ⁇ g/IC ⁇ L PBS/wound, 3 mice, 4 wounds/mouse) or Tat-C-Smad7
- FIG. 16B illustrates the effect of N-terminally truncated (l-258aa) Tat-N-Smad7 on wound healing.
- Wild-type C57BL/6 mice were anaesthetized, dorsally wounded by a 6-mm dermal punch biopsy, and treated every other day with the topical application of PBS (control, 6 mice, 4 wounds/mouse), full-length Tat-Smad7 (O ⁇ g/IC ⁇ L PBS, 6 mice, 4 wounds/mouse), or Tat-N-Smad7 (O ⁇ g/IC ⁇ L PBS, 6 mice, 4 wounds/mouse).
- Tat-Smad7 proteins (Tat-C-Smad7 and Tat-N-Smad7) promote wound healing. Moreover, these results demonstrate that certain truncated Tat-Smad7 proteins are more effective in accelerating wound healing than full-length Tat-Smad7.
- compositions comprising truncated Tat-Smad7 proteins are useful in treating wounds and in accelerating wound healing.
- Example 10 Smad7 accelerates wound healing in an impaired wound-healing model
- Diabetic (db/db) mice were dorsally wounded by a 6-mm dermal punch biopsy as described above in Example 9, and treated every other day with the topical application of PBS (control, 6 mice, 4 wounds/mouse), full-length Tat-Smad7 (O ⁇ g/IC ⁇ L PBS, 6 mice, 4 wounds/mouse), or REGRANEX® cream (smear with cotton swab, 6 mice 4 wounds/mouse) to the wounds before day 8 when the wounds were not completely covered by scabs. After day 10, the treatments were topically applied to the gap between the scab and wound periphery to avoid the barrier of the hard scab and the unwounded stratum corneum.
- REGRANEX® which contains a recombinant human platelet-derived growth factor (PDGF), is approved for topical administration to diabetic ulcers.
- PDGF platelet-derived growth factor
- Tat-Smad7 is useful for accelerating wound closure in poorly healing diabetic wounds, and provides an alternative to treatment with REGRANEX®.
- Example 1 Additional codon optimization for Smad7 protein production
- Smad7 nucleic acid molecules are designed with additional nucleotide changes selected to increase protein production. For example, the utilization of codons encoding the amino acids Ser and His will be manipulated. In codon-optimized human Smad7 in examples above, the Ser codon (TCC or TCG) has an amino acid frequency of approximately 9% of codon utilization. It is believed that changing the codon of Ser to AGC will increase Smad7 protein production, at least partly because it can optionally increase codon usage to 15%.
- Smad7 protein There are 33 Ser amino acids in Smad7 protein (nucleotides at positions 19-21, 46-48, 133-135, 292-294, 349-351, 451-453, 454-456, 460-462, 51 1-513, 514-516, 544-546, 595-597, 616-618, 634-636, 691-693, 694-696, 739-741, 745-747, 775-777, 847-849, 907-909, 919-921, 943-945, 1006-1008, 1009-1101, 1030-1032, 1054-1056, 1093-1095, 1126-1 128, 1 192-1194, 1237-1239, 1240-1242, 1273-1275; with a corresponding serine amino acid position of 7, 16, 45, 98, 1 17, 151, 152, 154, 171, 172, 182, 199, 206, 212, 231, 232, 247, 249, 259, 283, 303, 307, 315, 336,
- 23 (nucleotides 19-21, 292-294, 349-351, 451-453, 454-456, 460-462, 51 1-513, 514-516, 544-546, 616-618, 634-636, 691-693, 694-696, 739-741, 745-747, 775-777, 847-849, 907-909, 919-921, 1009-1 101, 1030-1032, 1054-1056, 1093-1095; corresponding serine amino acid position of 7, 98, 117, 151, 152, 154, 171, 172, 182, 206, 212, 231, 232, 247, 249, 259, 283, 303, 307, 337, 344, 352, 365) can be changed without introducing potential alternative open reading frames.
- the His codon (CAC) has 9.6% of codon usage. It is believed that changing the His codon to CAT (optionally to 12.6% usage) will increase Smad7 protein production.
- His nucleotides 142-144, 214-216, 217-219, 220-222, 226-228, 289-291, 589-591, 778-780, 1072-1074, 1147-1149; corresponding to histidine amino acids at position 48, 72, 73, 74, 76, 97, 170, 196, 197, 260, 358, 383) in Smad7 protein.
- 4 (nucleotides 217-219. 220-222, 589-591, 778-780, histidine residues 73, 76, 197, 260) can be changed without introducing potential alternative open reading frames.
- wild-type human Smad7 includes a Met amino acid as amino acid 216 (Met216). This may be perceived as an alternative open reading frame by bacterial machinery, for example, and decrease protein production. It is believed that changing Met216 to Leu216 (ATG to CTG), the amino acid that has the biochemical property the closest to Met and thus not expected to change 3D structure of the protein, will increase protein production.
- Top strand Tat-Smad7-V5; bottom strand: after optimized Ser,
- nucleic acid sequences and their corresponding amino acid sequences that would include all these changes are provided below.
- the amino acid sequence includes the V5 epitope indicated in bold, and the pET101-Topo backbone indicated by italics and underlining.
- the Tat-Smad7 M216L fully-optimized full length nucleotide and protein sequence is shown below: ggatccggccgtaaaaaacgccgtcaacgccgcgtggtttccgtacgaaacgcagcgccc
- the optimized nucleotide and amino acid sequences will also be used to make a variety of N-terminal and C-terminal Tat-Smad7 fragments. Representative examples are provided below.
- Tat-N-Smad7-V5 most optimized nucleotide and amino acid sequences are provided.
- the protein sequence includes the V5 epitope, which is indicated by bold capital letters. ggatccggccgtaaaaaacgccgtcaacgccgccgtggtttccgtacgaaacgcagcgcc
- Tat-C-Smad7-V5 most optimized nucleotide and amino acid sequences are provided.
- the protein sequence includes the V5 epitope (indicated by bold capital letters), and the pET101-Topo backbone (indicated by underlined italics).
- Horioiocjy Block Percent Matches S3 Score 541 Length «18
- Tat -c- Smad7 - 336611 aa gcgt t cgat cgagaaagcc a agsct cagcgcccgaacqaccat ⁇ aattcatg
- Tat -c- 601 atagoa gcgagtc
- Tat-N- 3mad7- 4 13811 ccgccgagca :tacagcctgccgctgctgtgtaaagtgtttcgt ggccggacctg Tat--N- 3mad7 - 481
- Tat-N- •3mad7- 554411 cgccagagsS!icgaagttaaacgcctgtgctgtr.gcgagagc atggcaaaattaacccg Tat--N--SmadV- 541 ... ;. ⁇ ..iiS
- Tat- -N- Smad7 - SSSSII ccgccgtatsfecgt acccgatggatttcctgaaaccgactgcagat gcccggacgca Tat--N- ⁇ Smad7- SSI
- codon-optimized nucleic acids will also be assessed for their ability to produce Smad7 protein in one or more expression systems. Provided below is another example of such a sequence.
- Tat-Smad7 M7216L -V5 optimized by Optimizer program: ggatccggtcgtaaaaaacgtcgtcagcgtcgtcgtggtttccgtaccaaacgttctgcg G S G R K K R R Q R R R G F R T K R S A ctggttcgtctgtggcgttctcgtgcgcgggtggtgaagacgaagaagaaggtgcggcgcgggtggtgaagacgaagaagaaggtgcg
- ATG is removed to be used with GST; 682 ATG to CTG (M216 to L) 1 ggatccggtc gtaaaaacg tcgtcagcgt cgtcgtggtt tccgtaccaa acgttctgcg 61 ctggttcgtc gtctgtggcg ttctcgtgcg ccgggtggtg aagacgaaga agaaggtgcg 121 ggtggtggtg gtggtggtgg tgaactgcgt ggtgaaggtg cgaccgactc tcgtgcgcac 181 ggtgcgggtg gtggtggtcc gggtcgtgcgggttgcgggtaaagc ggttcgtggt 241 ggtgcgggt
- Scoring matrix Linear (Mismatch 2, CpenGap 4
- TatSmadV Ser glg a3 ⁇ 4:Ee 3 ⁇ 4cggKa3 ⁇ 4S3 ⁇ 4 ⁇
- Tat-Smad7-21 121 ggtggtgg ggtgg gtg ⁇
- Tat-Sraad7-21 181 ggtgcgggtggtggtggtccgggtcgtgcgggt gctgcctgggtaaagcggt cgtggt
- Tat-Smad7-21 301 gaagcggaccfcgaaagcgcfcgacccactctgttctgaaaaaactgaaagaacgtcagctg
- Tat-Smad7-21 4 81 ccgccgtcttcttactctctgccgctgctgtgcaaagttttccgttggccggacctg
- TatSmad7 Ser 4 8 1 ccgccgagcagctacagcctgocgctgctgtgtaaagtgtttcgttggccggacotg
- Tat-Smad7-21 601 gaactggtttgctgcaacccgcaccacctgtctcgtctgtgcgaactggaatctccgccg
- Tat-Smad7 106 saicecgg Htctegt& ⁇
- Protein production using the sequences below is carried out by transfecting mammalian expression vectors (e.g., pCMV-6-Entry) into HEK293 or CHO cells.
- mammalian expression vectors e.g., pCMV-6-Entry
- Mol 1 human Smad7 mRNA (1-3103) Mol 2 optimized GST-Tat-Smad7-myc-flag
- human Smad7 500 tcaccaccatccccacccgccagccgcgggcgccggcgcggccgggggcg optimized GS 1027 c -- ..t a..a..a c..a. human Smad7 550 ccgaggcggatctgaaggcgctcacgcactcggtgctcaagaaactgaag optimized GS 1071 .t a..c a..c..g..t...
- human Smad7 700 cgggggcgcccgccggcgcgcagcctgcgcagccgccctcgtcctactcg optimized GS 1221 . c .. c .. t .. t .. g .. a a..c t .. a .. tagt ..
- tagc human Smad7 750 ctccccctcctgctgcaaagtgttcaggtggccggatctcaggcattc optimized GS 1271 ..g g t..g c.a t gc human Smad7 800 ctcggaagtcaagaggctgtgttgctgtgaatcttacgggaagatcaacc optimized GS 1321 aagc a c..t..c..g..c c t....
- human Smad7 850 ccgagctggtgtgctgcaacccccatcaccttagccgactctgcgaacta optimized GS 1371 .a.. a t t gtct g--t g human Smad7 900 gagtctcccccctcttactccagatacccgatggattttctcaaacc optimized GS 1421 c t..a..c t..g..t..t c g..g.........
- human Smad7 950 aactgcagactgtccagatgctgtgccttcctccgctgaaacagggggaa optimized GS 1471 ...c.t c a c t..c..g..t human Smad7 1000 cgaattatctggcccctggggggctttcagattcccaacttcttctggag optimized GS 1521 .c..c..c t c..a...gage, .c g..g..g a human Smad7 1050 cctggggatcggtcacactggtgcgtggtggcatactgggaggagaagac optimized GS 1571 ..a cage t c..c a human Smad7 1100 gagagtggggaggctctactgtgtccaggagccctctctggatatcttcttt
- human Smad7 1200 aacaagagtcagctggtgcagaaggtgcggagcaaatcggctgcggcat optimized GS 1721 ..t a..c g--t human Smad7 1250 ccagctgacgcgggaggtggatggtgtgtgggtgtacaaccgcagcagtt optimized GS 1771 ca c.c c ttca. human Smad7 1300 accccatcttcatcaagtccgccacactggacaacccggactccaggacg optimized GS 1821 .t..a ag t t .. c .. t ... c .
- ag c human Smad7 1400 cgagaaggcgtacagcctgcagcggcccaatgaccacgagtttatgcagc optimized GS 1921 t..t...c c.t c human Smad7 1450 agccgtggacgggctttaccgtgcagatcagctttgtgaagggctggggt optimized GS 1971 ....t a c..t c.c a c human Smad7 1500 cagtgctacacccgccagttcatcagcagctgccccgtgctggctagaggt optimized GS 2021 aa . g tea t..c..t g..a.. human Smad7 1550 catcttcaa
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Virology (AREA)
- Epidemiology (AREA)
- Wood Science & Technology (AREA)
- Dermatology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Investigating Or Analysing Biological Materials (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2904329A CA2904329C (en) | 2013-03-08 | 2014-03-07 | Ptd-smad7 therapeutics |
| EP14761076.0A EP2964774B1 (en) | 2013-03-08 | 2014-03-07 | Ptd-smad7 therapeutics |
| HK16107300.2A HK1219986B (zh) | 2013-03-08 | 2014-03-07 | Ptd-smad7治疗剂 |
| US14/773,167 US10456448B2 (en) | 2013-03-08 | 2014-03-07 | PTD-SMAD7 therapeutics |
| JP2015561737A JP6576251B2 (ja) | 2013-03-08 | 2014-03-07 | PTD−Smad7薬物療法 |
| SG11201507045TA SG11201507045TA (en) | 2013-03-08 | 2014-03-07 | Ptd-smad7 therapeutics |
| CN201480025596.9A CN105358704B (zh) | 2013-03-08 | 2014-03-07 | Ptd-smad7治疗剂 |
| IL241190A IL241190B (en) | 2013-03-08 | 2015-09-06 | 7smad–ptd medical |
| US16/584,608 US20200023037A1 (en) | 2013-03-08 | 2019-09-26 | Ptd-smad7 therapeutics |
| US17/727,579 US20220370560A1 (en) | 2013-03-08 | 2022-04-22 | Ptd-smad7 therapeutics |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361775252P | 2013-03-08 | 2013-03-08 | |
| US61/775,252 | 2013-03-08 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/773,167 A-371-Of-International US10456448B2 (en) | 2013-03-08 | 2014-03-07 | PTD-SMAD7 therapeutics |
| US16/584,608 Continuation US20200023037A1 (en) | 2013-03-08 | 2019-09-26 | Ptd-smad7 therapeutics |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014138670A1 true WO2014138670A1 (en) | 2014-09-12 |
Family
ID=51492023
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/022052 Ceased WO2014138670A1 (en) | 2013-03-08 | 2014-03-07 | Ptd-smad7 therapeutics |
Country Status (8)
| Country | Link |
|---|---|
| US (5) | US10456448B2 (enExample) |
| EP (1) | EP2964774B1 (enExample) |
| JP (1) | JP6576251B2 (enExample) |
| CN (1) | CN105358704B (enExample) |
| CA (1) | CA2904329C (enExample) |
| IL (1) | IL241190B (enExample) |
| SG (1) | SG11201507045TA (enExample) |
| WO (1) | WO2014138670A1 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2018507840A (ja) * | 2016-01-25 | 2018-03-22 | インダストリー−アカデミック コオペレイション ファウンデーション,ヨンセイ ユニバーシティ | Smadタンパク質を含む自己免疫疾患治療用組成物、Smadタンパク質を含む融合タンパク質、これを製造するためのベクター、及びその製造方法 |
| JPWO2022191244A1 (enExample) * | 2021-03-10 | 2022-09-15 |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3536337A1 (en) | 2010-09-22 | 2019-09-11 | The Regents of the University of Colorado, a body corporate | Therapeutic applications of smad7 |
| WO2014138670A1 (en) | 2013-03-08 | 2014-09-12 | The Regents Of The University Of Colorado, A Body Corporate | Ptd-smad7 therapeutics |
| EP3731854A4 (en) * | 2017-12-30 | 2021-10-06 | The Regents of The University of Colorado, A Body Corporate | THERAPEUTICS MADE FROM PTD-SMAD7 FUSION PROTEINS |
| EP4401785A4 (en) * | 2021-09-15 | 2025-11-05 | Univ Colorado Regents | SMAD7 POLYPEPTIDE FORMULATIONS |
| WO2023150743A2 (en) * | 2022-02-07 | 2023-08-10 | Aavogen Inc. | Codon-optimized smad7 gene therapy to treat and prevent muscle wasting and to enhance muscle mass |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6251628B1 (en) * | 1997-05-20 | 2001-06-26 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding Smad7 |
| WO2012040295A2 (en) * | 2010-09-22 | 2012-03-29 | The Regents Of The University Of Colorado | Therapeutic applications of smad7 |
Family Cites Families (46)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL8200523A (nl) | 1982-02-11 | 1983-09-01 | Univ Leiden | Werkwijze voor het in vitro transformeren van planteprotoplasten met plasmide-dna. |
| US4879236A (en) | 1984-05-16 | 1989-11-07 | The Texas A&M University System | Method for producing a recombinant baculovirus expression vector |
| US4952500A (en) | 1988-02-01 | 1990-08-28 | University Of Georgia Research Foundation, Inc. | Cloning systems for Rhodococcus and related bacteria |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| US5302523A (en) | 1989-06-21 | 1994-04-12 | Zeneca Limited | Transformation of plant cells |
| US5550318A (en) | 1990-04-17 | 1996-08-27 | Dekalb Genetics Corporation | Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof |
| US7705215B1 (en) | 1990-04-17 | 2010-04-27 | Dekalb Genetics Corporation | Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof |
| US5322783A (en) | 1989-10-17 | 1994-06-21 | Pioneer Hi-Bred International, Inc. | Soybean transformation by microparticle bombardment |
| DK0506884T3 (da) | 1989-12-21 | 1996-11-04 | Whitehead Biomedical Inst | Fremgangsmåde til afgivelse af molekyler til eukaryotiske celler |
| US5484956A (en) | 1990-01-22 | 1996-01-16 | Dekalb Genetics Corporation | Fertile transgenic Zea mays plant comprising heterologous DNA encoding Bacillus thuringiensis endotoxin |
| US5670488A (en) | 1992-12-03 | 1997-09-23 | Genzyme Corporation | Adenovirus vector for gene therapy |
| US5384253A (en) | 1990-12-28 | 1995-01-24 | Dekalb Genetics Corporation | Genetic transformation of maize cells by electroporation of cells pretreated with pectin degrading enzymes |
| WO1993004169A1 (en) | 1991-08-20 | 1993-03-04 | Genpharm International, Inc. | Gene targeting in animal cells using isogenic dna constructs |
| US5610042A (en) | 1991-10-07 | 1997-03-11 | Ciba-Geigy Corporation | Methods for stable transformation of wheat |
| US5702932A (en) | 1992-07-20 | 1997-12-30 | University Of Florida | Microinjection methods to transform arthropods with exogenous DNA |
| EP0652965A1 (en) | 1992-07-27 | 1995-05-17 | Pioneer Hi-Bred International, Inc. | An improved method of agrobacterium-mediated transformation of cultured soybean cells |
| JP2702285B2 (ja) | 1992-08-21 | 1998-01-21 | バイオジェン,インコーポレイテッド | Tat由来の輸送ポリペプチド |
| GB9222888D0 (en) | 1992-10-30 | 1992-12-16 | British Tech Group | Tomography |
| US5436222A (en) | 1993-03-15 | 1995-07-25 | The Research Foundation Of State University Of New York | Use of platelet factor 4 to treat inflammatory diseases |
| US5656610A (en) | 1994-06-21 | 1997-08-12 | University Of Southern California | Producing a protein in a mammal by injection of a DNA-sequence into the tongue |
| US5871986A (en) | 1994-09-23 | 1999-02-16 | The General Hospital Corporation | Use of a baculovirus to express and exogenous gene in a mammalian cell |
| US5736524A (en) | 1994-11-14 | 1998-04-07 | Merck & Co.,. Inc. | Polynucleotide tuberculosis vaccine |
| US5780448A (en) | 1995-11-07 | 1998-07-14 | Ottawa Civic Hospital Loeb Research | DNA-based vaccination of fish |
| US5945100A (en) | 1996-07-31 | 1999-08-31 | Fbp Corporation | Tumor delivery vehicles |
| US5981274A (en) | 1996-09-18 | 1999-11-09 | Tyrrell; D. Lorne J. | Recombinant hepatitis virus vectors |
| GB2320431B (en) | 1996-12-20 | 2000-08-30 | Johnson & Johnson Medical | Compositions for the treatment of chronic wounds |
| US6891082B2 (en) | 1997-08-01 | 2005-05-10 | The Johns Hopkins University School Of Medicine | Transgenic non-human animals expressing a truncated activintype II receptor |
| US5994624A (en) | 1997-10-20 | 1999-11-30 | Cotton Incorporated | In planta method for the production of transgenic plants |
| AU3365299A (en) | 1998-03-27 | 1999-10-18 | Eli Lilly And Company | Treatment and prevention of vascular disease |
| US8466134B1 (en) | 1998-06-26 | 2013-06-18 | Athena Neurosciences, Inc. | Aqueous compositions containing corticosteroids for nasal and pulmonary delivery |
| US6998240B2 (en) | 2001-06-11 | 2006-02-14 | Wisconsin Alumni Research Foundation | Screen for selective inhibitors or activators of Smad protein function |
| AUPR638101A0 (en) | 2001-07-13 | 2001-08-09 | Bioa Pty Limited | Composition and method for treatment of disease |
| ATE532547T1 (de) | 2002-09-06 | 2011-11-15 | 3M Innovative Properties Co | Dosierventil für einen dosierinhalator mit konsistenter abgabe |
| KR100472938B1 (ko) | 2002-10-31 | 2005-03-11 | 학교법인 한림대학교 | 세포침투 효율을 향상시킨 수송도메인-목표단백질-수송도메인 융합단백질 및 그 용도 |
| CA2542276A1 (en) | 2003-10-16 | 2005-04-28 | The University Court Of The University Of Edinburgh | Control of es cell self-renewal and lineage specification, and medium therefor |
| ES2343641T3 (es) | 2005-01-14 | 2010-08-05 | Camurus Ab | Formulaciones bioadhesivas topicas. |
| MX2007012344A (es) * | 2005-04-05 | 2007-12-13 | Pioneer Hi Bred Int | Metodos y composiciones para disenar moleculas de acido nucleico para la expresion de polipeptido en plantas usando la desviacion de codon de virus de planta. |
| CA2623940C (en) | 2005-09-27 | 2017-01-10 | Tissuetech, Inc. | Amniotic membrane preparations and purified compositions and methods of use |
| WO2008105925A2 (en) | 2006-09-01 | 2008-09-04 | Oregon Health & Science University | COMPOUNDS AND METHODS FOR MODULATING β-CATENIN/SMAD-7 INTERACTIONS |
| US20080114287A1 (en) | 2006-11-14 | 2008-05-15 | Kar Neng Lai | Ultrasound Microbubble Mediated Genes Delivery System |
| ES2690554T3 (es) | 2008-03-17 | 2018-11-21 | The Scripps Research Institute | Enfoques químicos y genéticos combinados para la generación de células madre pluripotentes inducidas |
| US8591961B2 (en) | 2008-09-04 | 2013-11-26 | Allergan, Inc. | Aesthetic treatment of scars and aging skin |
| WO2009151600A2 (en) | 2008-06-10 | 2009-12-17 | Tufts University | Smad proteins control drosha-mediated mirna maturation |
| US20100184033A1 (en) | 2008-07-16 | 2010-07-22 | West Michael D | Methods to accelerate the isolation of novel cell strains from pluripotent stem cells and cells obtained thereby |
| DE18200782T1 (de) * | 2012-04-02 | 2021-10-21 | Modernatx, Inc. | Modifizierte polynukleotide zur herstellung von proteinen im zusammenhang mit erkrankungen beim menschen |
| WO2014138670A1 (en) | 2013-03-08 | 2014-09-12 | The Regents Of The University Of Colorado, A Body Corporate | Ptd-smad7 therapeutics |
-
2014
- 2014-03-07 WO PCT/US2014/022052 patent/WO2014138670A1/en not_active Ceased
- 2014-03-07 SG SG11201507045TA patent/SG11201507045TA/en unknown
- 2014-03-07 EP EP14761076.0A patent/EP2964774B1/en active Active
- 2014-03-07 US US14/773,167 patent/US10456448B2/en active Active
- 2014-03-07 JP JP2015561737A patent/JP6576251B2/ja active Active
- 2014-03-07 CA CA2904329A patent/CA2904329C/en active Active
- 2014-03-07 US US14/201,488 patent/US9422352B2/en active Active
- 2014-03-07 CN CN201480025596.9A patent/CN105358704B/zh active Active
-
2015
- 2015-09-06 IL IL241190A patent/IL241190B/en active IP Right Grant
-
2016
- 2016-07-12 US US15/208,424 patent/US20170000851A1/en not_active Abandoned
-
2019
- 2019-09-26 US US16/584,608 patent/US20200023037A1/en not_active Abandoned
-
2022
- 2022-04-22 US US17/727,579 patent/US20220370560A1/en not_active Abandoned
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6251628B1 (en) * | 1997-05-20 | 2001-06-26 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding Smad7 |
| WO2012040295A2 (en) * | 2010-09-22 | 2012-03-29 | The Regents Of The University Of Colorado | Therapeutic applications of smad7 |
Non-Patent Citations (11)
| Title |
|---|
| ALTSCHUL ET AL., J. MOL BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| HAN ET AL., DEV CELL BIOL, vol. 11, 2006, pages 301 - 312 |
| HONG ET AL., NAT IMMUNOL, vol. 8, 2007, pages 504 - 513 |
| KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 2264 - 2268 |
| KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5877 |
| MALLAWAARACHCHI ET AL., ARTERIOSCLER THROMB VASE BIOL, vol. 25, 2005, pages 1383 - 1387 |
| SAIKA ET AL., AM J PATHOL, vol. 166, 2005, pages 1405 - 1418 |
| SAIKA ET AL., LAB INVEST, vol. 84, 2004, pages 1259 - 1270 |
| See also references of EP2964774A4 |
| ZHANG, S ET AL.: "Smad7 Antagonizes Transforming Growth Factor Beta Signaling In The Nucleus By Interfering With Functions Smad-DNA Complex Formation.", MOLECULAR AND CELLULAR BIOLOGY., vol. 27, no. 12, 1 June 2007 (2007-06-01), pages 4488 - 4499, XP055277041, DOI: 10.1128/MCB.01636-0 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2018507840A (ja) * | 2016-01-25 | 2018-03-22 | インダストリー−アカデミック コオペレイション ファウンデーション,ヨンセイ ユニバーシティ | Smadタンパク質を含む自己免疫疾患治療用組成物、Smadタンパク質を含む融合タンパク質、これを製造するためのベクター、及びその製造方法 |
| KR101853923B1 (ko) * | 2016-01-25 | 2018-05-02 | 연세대학교 산학협력단 | Smad 단백질을 포함하는 자가 면역 질환 치료용 조성물, Smad 단백질을 포함하는 융합 단백질, 이를 제조하기 위한 벡터, 및 이의 제조 방법 |
| JPWO2022191244A1 (enExample) * | 2021-03-10 | 2022-09-15 | ||
| JP7678483B2 (ja) | 2021-03-10 | 2025-05-16 | 国立大学法人 熊本大学 | コロナウイルス感染を検出する方法 |
Also Published As
| Publication number | Publication date |
|---|---|
| HK1219986A1 (zh) | 2017-04-21 |
| CN105358704A (zh) | 2016-02-24 |
| SG11201507045TA (en) | 2015-10-29 |
| US20170000851A1 (en) | 2017-01-05 |
| US10456448B2 (en) | 2019-10-29 |
| EP2964774A4 (en) | 2016-08-10 |
| EP2964774B1 (en) | 2020-05-06 |
| US20200023037A1 (en) | 2020-01-23 |
| JP6576251B2 (ja) | 2019-09-18 |
| US20160039894A1 (en) | 2016-02-11 |
| CA2904329C (en) | 2021-11-30 |
| JP2016510596A (ja) | 2016-04-11 |
| IL241190A0 (en) | 2015-11-30 |
| IL241190B (en) | 2019-09-26 |
| CN105358704B (zh) | 2020-01-03 |
| US20140288006A1 (en) | 2014-09-25 |
| EP2964774A1 (en) | 2016-01-13 |
| CA2904329A1 (en) | 2014-09-12 |
| US20220370560A1 (en) | 2022-11-24 |
| US9422352B2 (en) | 2016-08-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220370560A1 (en) | Ptd-smad7 therapeutics | |
| US10350265B2 (en) | Therapeutic applications of Smad7 | |
| TW201107471A (en) | Polypeptides selective for αvβ3 integrin conjugated with a variant of human serum albumin (HSA) and pharmaceutical uses thereof | |
| JP6825181B2 (ja) | 膵炎を治療するための薬剤の製造におけるil−22二量体の使用 | |
| CN114380919B (zh) | 经修饰的il-2分子及其用途 | |
| KR20130043242A (ko) | Sparc 혈관형성 영역과 사용방법 | |
| US20200332302A1 (en) | Therapeutics of ptd-smad7 fusion proteins | |
| AU2017235608A1 (en) | Novel alpha-1-microglobulin derived proteins and their use | |
| HK1219986B (zh) | Ptd-smad7治疗剂 | |
| HK1223294B (en) | Therapeutic applications of smad7 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201480025596.9 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14761076 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2904329 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14773167 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 241190 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2015561737 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014761076 Country of ref document: EP |