WO2014102540A1 - Vaccines against hepatitis b virus - Google Patents

Vaccines against hepatitis b virus Download PDF

Info

Publication number
WO2014102540A1
WO2014102540A1 PCT/GB2013/053410 GB2013053410W WO2014102540A1 WO 2014102540 A1 WO2014102540 A1 WO 2014102540A1 GB 2013053410 W GB2013053410 W GB 2013053410W WO 2014102540 A1 WO2014102540 A1 WO 2014102540A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
seq
composition
hbv
peptides
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2013/053410
Other languages
English (en)
French (fr)
Inventor
Bertrand Victor Gilbert GEORGES
Carlton Bradley BROWN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Altimmune UK Ltd
Original Assignee
Immune Targeting Systems Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EA201591213A priority Critical patent/EA201591213A1/ru
Priority to EP21201879.0A priority patent/EP3995146A1/en
Priority to KR1020237003896A priority patent/KR102625645B1/ko
Priority to CA2895459A priority patent/CA2895459A1/en
Priority to ES13814593T priority patent/ES2906110T3/es
Priority to KR1020227003308A priority patent/KR102497063B1/ko
Priority to CN201380067602.2A priority patent/CN104903343A/zh
Priority to KR1020157020103A priority patent/KR102358621B1/ko
Priority to JP2015548778A priority patent/JP6811014B2/ja
Application filed by Immune Targeting Systems Ltd filed Critical Immune Targeting Systems Ltd
Priority to DK13814593.3T priority patent/DK2935313T3/da
Priority to US14/655,041 priority patent/US10300132B2/en
Priority to PL13814593T priority patent/PL2935313T3/pl
Priority to EP13814593.3A priority patent/EP2935313B1/en
Publication of WO2014102540A1 publication Critical patent/WO2014102540A1/en
Anticipated expiration legal-status Critical
Priority to US16/423,149 priority patent/US11382969B2/en
Priority to US17/861,189 priority patent/US11918645B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/29Hepatitis virus
    • A61K39/292Serum hepatitis virus, hepatitis B virus, e.g. Australia antigen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/01DNA viruses
    • C07K14/02Hepadnaviridae, e.g. hepatitis B virus
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/55Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2730/00Reverse transcribing DNA viruses
    • C12N2730/00011Details
    • C12N2730/10011Hepadnaviridae
    • C12N2730/10111Orthohepadnavirus, e.g. hepatitis B virus
    • C12N2730/10122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2730/00Reverse transcribing DNA viruses
    • C12N2730/00011Details
    • C12N2730/10011Hepadnaviridae
    • C12N2730/10111Orthohepadnavirus, e.g. hepatitis B virus
    • C12N2730/10134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2730/00Reverse transcribing DNA viruses
    • C12N2730/00011Details
    • C12N2730/10011Hepadnaviridae
    • C12N2730/10111Orthohepadnavirus, e.g. hepatitis B virus
    • C12N2730/10171Demonstrated in vivo effect

Definitions

  • the present invention relates to an immunogenic HBV peptide composition and to the treatment of HBV using the composition.
  • Hepatitis B virus (HBV) infection is a major cause of liver-related morbidity and mortality in Europe and worldwide. An estimated 650,000 individuals die each year from liver failure or hepatocellular carcinoma. Even though vaccination programs have led to declines in de novo HBV infections in many countries, chronic hepatitis B (CHB) is a rapidly growing problem in Europe due to immigration of HBV carriers from endemic areas.
  • CHB chronic hepatitis B
  • chronic HBV infection can be classified into three phases (or types of immune responses): immune tolerant, immune active and inactive chronic carrier. These distinct phases of chronic infection correspond with
  • HBV characteristic serologic patterns and correlate with the patient's immune response to HBV.
  • patients with persistent immune active chronic HBV infection receive HBV therapy.
  • CHB chronic hepatitis B
  • NUCs nucleoside/nucleotide analogues
  • NUCs remain the main treatment strategies with five NUCs being approved in Europe to treat CHB.
  • the most potent and preferred drugs, tenofovir and entecavir have a very favourable side-effect profile and are able to induce HBV DNA suppression in almost all patients.
  • life-long therapy is required for the majority of patients under most national and international guidelines. Only very few HBeAg-positive patients, and no HBeAg-negative patients, are able to clear HBsAg even after several years of NUC therapy.
  • the long-term safety of NUC therapy is currently unknown. Therefore, concepts to enable a timely cessation of NUC therapy are urgently needed.
  • Therapeutic vaccination is a promising intervention for hepatitis B as a way to induce immune control over the disease.
  • T-cell responses have been shown to be critical for clearance of acute HBV infection.
  • therapeutic HBV vaccines based on HBsAg have failed to show benefit due to induced immune tolerance from high levels of circulating HBsAg, even under effective antiviral treatment.
  • the present inventors have identified regions of the HBV proteome that have a high degree of conservation between different HBV genotypes and that have unexpectedly better immunogenic properties compared to other similarly conserved regions of HBV proteins.
  • the inventors have unexpectedly shown using an in vitro assay that peptide sequences within particular domains of HBV polymerase and HBV core protein are able to elicit a response in PBMC from chronically infected HBV patients infected with different HBV genotypes and/or from chronically infected HBV patients of different ethnicities.
  • the inventors have surprisingly identified an immunodominant region in the terminal domain of HBV polymerase.
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising at least two peptides of from 15 to 60 amino acids in length, selected from peptides comprising a sequence of at least 15 contiguous amino acids of one of the sequences shown in SEQ ID NOs: 1 to 4 or of a sequence having at least 80% identity to one of the sequences shown in SEQ ID NOs: 1 to 4, wherein each peptide comprises at least one CD8+ T-cell epitope and/or at least one CD4+ T-cell epitope and wherein each peptide elicits a response in peripheral blood mononuclear cells (PBMC) from at least one chronically infected HBV individual in an in vitro assay.
  • the composition may comprise at least one peptide comprising at least 15 amino acids of one of the sequences shown in SEQ ID NOs: 1 to 3 and at least one peptide comprising at least 15 amino acids of the sequence shown in SEQ ID NO: 4.
  • At least one of the peptides may comprise a sequence shown in one of SEQ ID NOs: 24 to 33, or a sequence having at least 80% identity to one of the sequences shown in SEQ ID NOs: 24 to 33.
  • One or more of the peptides may comprise one or more amino acid(s) at the N-terminus and/or C-terminus to increase the net positive charge and/or to reduce hydrophobicity of the peptide.
  • the composition may therefore comprise a peptide comprising a sequence shown in one of SEQ ID NOs: 34 to 38.
  • the composition may further comprise at least one peptide derived from HBV surface protein.
  • the peptides derived from HBV surface protein may be of from 15 to 60 amino acids in length and comprise a sequence of at least 15 contiguous amino acids of the sequence shown in SEQ ID NO: 55 or of a sequence having at least 80% identity to at least 15 contiguous amino acids of the sequence shown in SEQ ID NO: 55, wherein the peptide comprises at least one CD8+ T-cell epitope and/or at least one CD4+ T-cell epitope and elicits a response in peripheral blood mononuclear cells (PBMC) from at least one chronically infected HBV individual in an in vitro assay.
  • PBMC peripheral blood mononuclear cells
  • composition wherein said composition is capable of eliciting an immune response in PBMC from at least two individuals of different ethnicities and from two individuals infected with different HBV genotypes.
  • the composition may be capable of eliciting an immune response: (a) in PBMC from two, three or all of: an individual infected with HBV genotype A, an individual infected with HBV genotype B, an individual infected with HBV genotype C and an individual infected with HBV genotype D; and/or in PBMC from two, three or all of: an Oriental or Indian individual infected with HBV, a Caucasian individual infected with HBV and an African or Arabic individual infected with HBV.
  • the peptides in a composition of the invention may be linked to a fluorocarbon vector.
  • the composition may further comprises HBc, HBe, or HBs antigen and/or an adjuvant.
  • the invention provides the composition of the invention for use in the treatment or prevention of HBV infection, particularly for the treatment of HBeAg-negative patients or HBeAg-positive patients.
  • the composition of the invention may be used in combination with: (i) interferon-alpha and/or nucleoside/nucleotide analogues (NUCs); and/or (ii) anti-PDl blocking antibodies, anti-CTLA4 blocking antibodies, anti-PDIL blocking antibodies, anti-LAG3 blocking antibodies, anti-TIM3 blocking antibodies and/or cyclophosphamide. Treatment with the composition may result in HBsAg loss or HBsAg seroconversion.
  • the invention also provides the composition of the invention for use in the treatment or prevention of end-stage liver disease or hepatocellular carcinoma or for use in the treatment or prevention of hepatitis D virus (HDV) infection.
  • HDV hepatitis D virus
  • a method of treating or preventing HBV infection comprising administering to a subject in need thereof a therapeutically effective amount of a composition according to the invention, and the use of a composition according to the invention in the manufacture of a medicament for the treatment or prevention of HBV are also provided.
  • the invention provides a peptide of from 15 to 60 amino acids in length comprising at least 15 contiguous amino acids of the sequence shown in any one of SED ID NOs: 1 to 4 or of a sequence having at least 80% identity to one of the sequences shown in SEQ ID NOs: 1 to 4, which peptide comprises at least one CD8+ T- cell epitope and/or at least one CD4+ T-cell epitope and is capable of eliciting a response in peripheral blood mononuclear cells (PBMC) from at least one chronically infected HBV individual in an in vitro assay.
  • PBMC peripheral blood mononuclear cells
  • the peptide of may comprise at least 15 contiguous amino acids of the sequence shown in SED ID NO: 5, 6, 14 or 15.
  • the invention also provides a peptide comprising one of the sequences shown in SEQ ID NOs: 24 to 38, or a sequence having at least 80% identity to one of the sequences shown in SEQ ID NOs: 24 to 38.
  • the peptide of the invention may be covalently linked to a fluorocarbon vector.
  • Figure 1 is a comparison of IFNy responses in chronic HBV-infected subjects in immune control phase or undergoing active treatment. Following a 10 day culture with an HBV-derived overlapping short peptide pool library (0.1 ⁇ g/peptide/mL), PBMC were restimulated ⁇ g/peptide/mL) in an 18h IFNy ELISpot assay with one of pools 1 to 23 of the overlapping peptides representing specific regions of the HBV proteome.
  • Figure 2 shows the specificity of ⁇ responses to HBV-derived short peptide pools in HBV-infected subjects grouped by infecting FIBV genotypes. Following a 10 day culture with an HBV-derived overlapping short peptide pool library
  • PBMC peripheral blood mononuclear cells
  • Figure 3 shows ⁇ responses to HBV-derived short peptide pools in chronic HBV-infected subjects grouped by ethnic background. Following a 10 day culture with an HBV-derived overlapping short peptide pool library (O. ⁇ g/peptide/mL), PBMC were restimulated ⁇ g/peptide/mL) in an 18h IFNy ELISpot assay with one of pools 1 to 23 of the overlapping peptides representing specific regions of the HBV proteome.
  • HBV-derived peptide pool library O. ⁇ g/peptide/mL
  • Figure 4 shows representative dot plots of CD4 and CD8 T-cell IFNy production in PBMC from chronic HBV and healthy control subjects following stimulation with HBV polymerase- and core-derived short peptide pools.
  • PBMC from subjects were stimulated for 10 days with a short peptide pool library (O. ⁇ g/peptide/mL), followed by overnight stimulation ⁇ g/peptide/mL) with HBV derived short peptide pool 2 or 14, representing regions of the HBV polymerase and core respectively.
  • Results are expressed as IFNy-producing cells, as a percentage of parent CD3/CD4 or CD3/CD8 T- cell populations. Stimulation in culture medium or PMA/ionomycin were used as negative and positive controls respectively and the gating strategy was based on negative control IFNy production.
  • Figure 5 is a comparison of ⁇ responses to HBV-derived short peptide pools representing 35-40mer peptides in PBMC from healthy subjects and chronic HBV- infected HBeAg-negative subjects in immune control phase or undergoing active treatment.
  • PBMC were restimulated ⁇ g/peptide/mL) in an 18h IFNy ELISpot assay with one of pools 24 to 46 of the overlapping peptides, each representing 35-40mer regions of the HBV proteome.
  • Figure 6 shows the specificity of ⁇ responses to HBV-derived short peptide pools representing 35-40mer peptides in HBV-infected subjects grouped by infecting HBV genotype.
  • Figure 7 shows IFNy responses to HBV-derived short peptide pools representing 35-40mer peptides in chronic HBeAg-negative HBV-infected subjects grouped by ethnic background.
  • PBMC HBV-derived overlapping short peptide pool library
  • IFNy ELISpot assay with one of pools 24 to 46 of the overlapping peptides, each representing 35-40mer regions of the HBV proteome.
  • Figure 8 is a summary of cytokine responses by PBMC from HBV-infected subjects to individual short peptide pools representing 35-40mer peptides.
  • Figure 9 shows the number of ⁇ spot forming cells (mean values) measured in PBMCs from chronic HBV-infected (either HBeAg-negative inactive carriers or HBeAg-negative treated subjects). Following a 10 day culture with the nine
  • Figure 10 shows the frequency of responders to the ⁇ ELISpot assay in response to HBV peptides measured in PBMCs from chronic HBV-infected (either HBeAg-negative inactive carriers or HBeAg-negative treated subjects).
  • PBMC peripheral blood mononuclear cells
  • the nine unconjugated HBV peptides P113, P151, P277(K), P376, P753(K), P797(K), P856(K), P877 and P1266(K)
  • PBMC were restimulated in an 18h IFNy ELISpot assay with individual peptides at a concentration of 5 ⁇ / ⁇ 1.
  • Figure 11 shows the number of ⁇ spot forming cells (mean values) measured in PBMCs from chronic FIBV-infected subjects grouped by infecting FIBV genotypes. Following a 10 day culture with the nine unconjugated HBV peptides (NP113, NP151, P277(K), P376, P753(K), P797(K), P856(K), P877 and P1266(K))
  • PBMC peripheral blood mononuclear cells
  • Figure 12 shows the number of ⁇ spot forming cells measured (mean values) in PBMCs from chronic FIBV-infected subjects grouped by ethnic background.
  • PBMC peripheral blood mononuclear cells
  • Figure 13 shows the frequency of cytokine-producing CD4+ and CD8+ T cell in
  • FIG. 13 A, 13B, 13C, 13D and 13E correspond to results obtained for groups of individuals infected by HBV genotypes A, B, C, D and non-A/B/C/D respectively.
  • PBMC peripheral blood mononuclear cells
  • FIG. 13 A, 13B, 13C, 13D and 13E correspond to results obtained for groups of individuals infected by HBV genotypes A, B, C, D and non-A/B/C/D respectively.
  • PBMC were restimulated in an 18h IFNy ELISpot assay with individual peptides at a concentration of 5 ⁇ g/ml.
  • Results are expressed as cytokine-producing cells, as a percentage of parent CD3/CD4 or CD3/CD8 T cell populations. Stimulation in culture medium or PMA/ionomycin were used as negative and positive controls respectively and the gating strategy was based on negative control IFNy production.
  • the graphic represents the number of ⁇ spot- forming cells per 10 6 splenocytes measured in response to the 9 peptide components of the vaccines.
  • the graphic represents the number of IFNy spot- forming cells per 10 6 splenocytes measured in response each of the 9 peptide components of the vaccines. Bars represent cumulative median responses to each individual peptide.
  • Figure 16 shows that FP02.1 promotes T cell responses against CTL epitopes restricted by MHC class I molecules after a single immunisation.
  • Figure 17 shows IFNy production by BALB/c mice immunised with FP-02.1 or NP02.1. Number of IFNy SFC/10 6 splenocytes produced in response to a mixture of the nine peptides for each splenocyte population.
  • SEQ ID Nos: 1 to 38 and 40 to 72 are the amino acid sequences of regions of the reference HBV sequence shown in SEQ ID NO: 39 of HBV polymerase as shown in Table 1 below.
  • SEQ ID NO: 39 is a virtual HBV protein sequence built by linear coassembly of the terminal domain of polymerase (positions 1 to 181), the reverse transcriptase domain of polymerase (position 182 to 549) the RNase domain H of polymerase (position 550 to 702), the core protein (position 703 to 914), the X protein (position 915 to 1068) and the surface protein (positions 1069 to 1468).
  • the proteome sequence was obtained from consensus of consensus sequences generated from genotype A, B, C and D consensus sequences.
  • SEQ ID Nos: 73 to 219 are the amino acid sequences of short peptides within each of pools 1 to 46.
  • SEQ ID NO: 220 is the amino acid sequence of pool 5.
  • the present invention provides a composition comprising broadly immunogenic peptide sequences capable of eliciting multiepitopic CD4+ and CD8+ T-cell immune responses with broad applicability in terms of population coverage and HBV genotype coverage.
  • the present invention provides a pharmaceutical composition comprising at least one peptide from 15 to 60 amino acids in length, wherein said peptide comprises a fragment of at least 15 contiguous amino acids of the terminal domain of HBV polymerase, reverse transcriptase domain of HBV polymerase, RNase H domain sequence of HBV polymerase or HBV core protein.
  • the peptide is of from 15 to 60 amino acids in length and is selected from peptides comprising a sequence of at least 15 contiguous amino acids of one of the sequences shown in SEQ ID NOs: 1 to 4.
  • the peptide comprises at least one CD8+ T-cell epitope and/or at least one CD4+ T-cell epitope.
  • the peptide elicits a response in peripheral blood mononuclear cells (PBMC) from at least one chronically infected HBV individual in an in vitro assay.
  • PBMC peripheral blood mononuclear cells
  • the composition may comprise multiple peptides having the properties defined above.
  • the composition may be capable of eliciting an immune response in peripheral blood mononuclear cells (PBMC) from at least two individuals of different ethnicities and/or from two individuals infected with different HBV genotypes.
  • PBMC peripheral blood mononuclear cells
  • composition of the invention may comprise one or more peptides comprising at least 15 contiguous amino acids, such as at least 20, 25, 29, 30, 31, 32, 33, 34 or 35 amino acids from one of SEQ ID NOs: 1 to 4.
  • SEQ ID NOs: 1, 2 and 3 are HBV polymerase sequences.
  • SEQ ID NO: 4 is an HBV core protein sequence.
  • peptide present in the composition of the invention may comprise at least 15, 20, 25, 30, 32, 33, 34 or 35 amino acids from one of SEQ ID NOs: 5 to 13.
  • peptides from within these subregions contain sequences within one of SEQ ID NOs: 14 to 23.
  • Exemplary short peptides within SEQ ID NOs: 1 to 4 are shown in SEQ ID NOs: 80 to 117 and 142 to 184.
  • Preferred exemplary short peptides are shown in SEQ ID NOs: 80 to 83, 86 to 89, 98 to 101, 105 to 112, 146 to 150, 163 to 166 and 169 to 181.
  • a composition of the invention may comprise a peptide comprising one or more of these short sequences.
  • SEQ ID NOs: 24 to 29 Particularly preferred peptides from these HBV polymerase sequences comprise one of the sequences shown in SEQ ID NOs: 24 to 29.
  • SEQ ID NO: 24 is a preferred region of SEQ ID NOs: 1, 5 and 14.
  • SEQ ID NO: 25 is a preferred region of SEQ ID NOs: 1, 6 and 15.
  • SEQ ID NO: 26 is a preferred region of SEQ ID NOs: 2, 7 and 16.
  • SEQ ID NOs: 27 is a preferred region of SEQ ID NOs: 2, 8 and 17.
  • SEQ ID NO: 28 is a preferred region of SEQ ID NOs: 2, 9 and 18.
  • SEQ ID NO: 29 is a preferred region of SEQ ID NOs: 3 and 19.
  • SEQ ID NO: 4 comprise one of the sequences shown in SEQ ID NOs: 30 to 33.
  • SEQ ID NO: 30 is a preferred region of SEQ ID NOs: 10 and 20.
  • SEQ ID NO: 31 is a preferred region of SEQ ID NOs: 11 and 21.
  • SEQ ID NO: 32 is a preferred region of SEQ ID Nos: 12 and 22.
  • SEQ ID NO: 33 is a preferred region of SEQ ID NOs: 13 and 23.
  • peptides are comprised within the sequences shown in SEQ ID NOs: 24 to 33 and include peptides comprising at least 20, such as 25, 29, 30, 31, 32, 33 or 34 contiguous amino acids from within one of these sequences.
  • composition may further comprise at least one peptide of from 15 to 60 amino acids in length, wherein said peptide comprises a fragment of at least 15 contiguous amino acids of HBV surface protein.
  • the HBV surface protein peptide is typically of from 15 to 60 amino acids in length and is selected from peptides comprising a sequence of at least 15 contiguous amino acids of the sequence shown in SEQ ID NO: 55.
  • the HBV surface protein peptide may comprise at least 15, 20, 25, 30, 32, 33, 34 or 35 amino acids from one of SEQ ID NOs: 55, and preferably from SEQ ID NO: 71.
  • composition of the invention may comprise a peptide comprising one or more of these short sequences.
  • Particularly preferred peptides from these HBV surface protein sequences comprise one of the sequences shown in SEQ ID NOs: 221.
  • SEQ ID NO: 221 is a preferred region of SEQ ID NOs: 55 and 71.
  • compositions of the invention are peptides that comprise a sequence that comprises one or more, such as two, three or four, amino acid substitutions, additions or deletions, preferably substitutions, within one of the sequences shown in one of SEQ ID NOs: 1 to 33, 55, 71 and 221.
  • One, two, three or more amino acids within the contiguous sequence may be substituted.
  • substitutions within the specified sequences include mutations to remove cysteine residues.
  • cysteine residues may be substituted by serine residues.
  • Such peptides will have a sequence identity of at least 80%, such as at least 85%, 90%, 95% or 98% to at least 15 or 20, such as 25, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40, contiguous amino acids within one of SEQ ID NOs: 1 to 33, 55, 71 and 221, or to the entire length of one of the sequences shown in SEQ ID NOs: 24 to 33 and 221 (for example, as determined using the BLAST program available at the National Center for Biotechnology Information (blast.ncbi.nlm.nih.gov/Blast.cgi)).
  • Such peptides include sequences that match the amino acid sequence of HBV genotype A, B, C, D, E or F in the equivalent region of the HBV polymerase or core protein.
  • the peptides may comprise additional sequences, provided that their overall length does not exceed 60 amino acids.
  • the peptide may comprise at least 20, such as 25, 29, 30, 31, 32, 33, 34 or 35 contiguous amino acids from within one of the sequences shown in one of SEQ ID NOs: 1 to 33, 55, 71 and 221, preferably SEQ ID NOs: 24 to 33 and 221 and may have a length of from 15, 20 or 25 amino acids up to 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55 or 60 amino acids.
  • the peptide typically has a length of from 15 or 20 to 60 amino acids, such as from 25 to 50 amino acids, preferably from 30 to 40 amino acids, for example, 31, 32, 33, 34, 35, 36, 37, 38 or 39 amino acids.
  • the peptide may include additional sequences.
  • the additional sequences may facilitate manufacture or formulation of the peptide or enhance stability of the peptide.
  • the peptide may comprise one or more additional amino acids, typically at the N-terminus and/or the C-terminus to enhance the net positive charge of the peptide and/or to reduce the hydrophobicity of the peptide.
  • the net positive charge may be increased so that the peptide has an isoelectric point greater than or equal to 7.
  • one or more, such as two or three positively charged amino acids are added to the N- and/or C-terminus of one or more of the peptides in the composition.
  • arginine and/or lysine are added to the N- and/or C-terminus of one or more of the peptides in the composition.
  • three lysine residues may be added to the N- and/or C-terminus of one or more of the peptides.
  • Positive amino acids are typically added at the end(s) of peptides that have an overall hydrophobicity of more than 65%, a net charge of less than zero and/or include cluster of hydrophobic amino acids.
  • the peptide may comprise one or more epitope that is not present in a consensus HBV sequence.
  • One such example is the use of fusion peptides where a promiscuous T helper epitope is covalently linked (optionally via a polypeptide linker or spacer) to the consensus sequence.
  • the promiscuous T helper epitope can be the PADRE peptide, tetanus toxoid peptide (830-843) or influenza haemagglutinin, HA(307-319).
  • the terminus of the peptide can be altered, for example to promote solubility of the fluorocarbon-peptide construct via the formation of micelles.
  • the N- or C- terminal amino acid residues of the peptide can be modified.
  • the desired peptide is particularly sensitive to cleavage by peptidases, the normal peptide bond can be replaced by a non-cleavable peptide mimetic. Such bonds and methods of synthesis are well known in the art.
  • the peptide may be a native peptide.
  • the peptide may be modified to increase longevity, such as half-life or persistence at the site of administration, of the peptide in vivo or to direct the peptide to antigen-presenting cells.
  • the immunogenic peptide can contain one or more non-naturally occurring amino acids and/or non- naturally occurring covalent bonds for covalently connecting adjacent amino acids.
  • the non-standard, non-naturally occurring amino acids can also be incorporated into the immunogenic peptides provided that they do not interfere with the ability of the peptide to interact with MHC molecules and remain cross-reactive with T- cells recognising the natural sequences.
  • Non-natural amino acids can be used to improve peptide resistance to protease or chemical stability. Examples of non-natural amino acids include D-amino acids and cysteine modifications.
  • the peptide may be coupled to a carrier, such as a protein carrier or a delivery vector.
  • a carrier such as a protein carrier or a delivery vector.
  • Suitable delivery vectors include lipopeptides, for example fatty acyl chains such as a monopalmitoyl chain, virosomes, liposomes and cell penetrating peptides, such as penetratin and transactivator of transcription (TAT).
  • TAT transactivator of transcription
  • One or more, and preferably all, of the HBV peptides in the composition of the invention are preferably covalently linked to a fluorocarbon vector.
  • a composition of the invention may comprise multiple peptides. Accordingly, the composition may comprise at least two, such as at least three, four, five, six, seven, eight, nine, ten or more peptides, each comprising a sequence of at least 15 contiguous amino acids of one of SEQ ID NOs: 1 to 4 as described above. The composition may additionally comprise a peptide comprising a sequence of at least 15 contiguous amino acids of SEQ ID NO: 55 as described above.
  • the composition may comprise at least one peptide comprising at least 15 amino acids of one of the sequences shown in SEQ ID NOs: 1 to 3 and at least 15 amino acids of the sequence shown in SEQ ID NO: 4, and optionally at least one peptide comprising at least 15 amino acids of one of the sequences shown in SEQ ID NO: 55.
  • the composition may comprise at least one peptide comprising at least 15 amino acids of one of the sequences shown in SEQ ID NOs: 24, 25, 26, 27, 28, 29 and 34 and at least 15 amino acids of one of the sequences shown in SEQ ID NOs: 30 to 33 and 35 to 38.
  • the composition may comprise at least one peptide comprising a sequence of at least 15 contiguous amino acids of one of SEQ ID NOs: 1 and/or 2 as described above and at least one peptide comprising a sequence of at least 15 contiguous amino acids of SEQ ID NO: 3 or 4 as described above.
  • the composition may comprise a peptide comprising a sequence of at least 15 contiguous amino acids of SEQ ID NO: 1 or 2 (or peptides comprising sequences of both SEQ ID NOs: 5 and 6) as described above and a peptide comprising at least 15 contiguous amino acids of any one of SEQ ID NOs: 10 to 13 as described above.
  • the invention may comprise peptides comprising a sequence of at least 15 contiguous amino acids of any two, three, four, five or all of SEQ ID NOs: 5, 6, 7, 8 and 9 as described above and/or may comprise peptides comprising a sequence of at least 15 contiguous amino acids of any two, three or all of SEQ ID NOs: 10 to 13 as described above.
  • a peptide present in a composition of the invention may consist of, or consist essentially of, one of the sequences shown in SEQ ID NOs: 24 to 38.
  • a HBV surface protein peptide present in a composition of the invention may consist of, or consist essentially of, one of the sequences shown in SEQ ID NOs: 221 and 222.
  • the invention thus provides a pharmaceutical composition comprising at least one peptide, such as two or more peptides that consist of, consist essentially of or comprise the amino acid sequence shown in one of SEQ ID NOs: 24 to 38, and optionally at least one peptide that consists of, consists essentially of or comprises the amino acid sequence shown in SEQ ID NOs: 221 or 222.
  • the composition may comprise at least two, such as three, four, five, six, seven, eight, nine or ten peptides comprising the sequences shown in SEQ ID NOs: 24 to 33 and 221.
  • one or more of the peptides comprising one of SEQ ID NOs: 24 to 33 and 221 may comprise N- or C-terminal lysine residues. More particularly the peptides comprising SEQ ID NOs: 26, 29, 30, 31, 32 and 221 may have the sequences shown in SEQ ID NOs: 34 to 38 and 222, respectively.
  • the composition may comprise at least two, such as three, four, five, six, seven, eight, nine or ten of the peptides comprising, consisting of, or consisting essentially of the sequences shown in SEQ ID NOs: 24, 25, 27, 28, 33, 34, 35, 36, 37 and 38, or at least two, such as three, four, five, six, seven or eight of the peptides comprising, consisting of, or consisting essentially of SEQ ID NOs: 24, 25, 28, 33, 34, 36, 37 and 38. Any possible combination of these peptides may be present in a composition of the invention.
  • Preferred combinations include one or more, such as any two, any three, any four or all, of SEQ ID NOs: 24, 25, 28, 33 and 31/37, preferably SEQ ID NO: 24 and/or 25.
  • a combination of SEQ ID NO: 24 and 33 results in a composition containing epitopes that bind to seven class I alleles and seven class II alleles.
  • the composition may further comprise a peptide comprising, consisting of, or consisting essentially of SEQ ID NO: 221 or 222.
  • composition may comprise eight peptides comprising the following sequences: SEQ ID NOs: 24, 25, 26, 28, 30, 31, 32 and 33, and optionally a ninth peptide comprising SEQ ID NO: 222.
  • One of the peptides such as the peptide comprising SEQ ID NO: 28, may be substituted by a peptide comprising SEQ ID NO: 27 and/or one peptide may be substituted by a peptide comprising SEQ ID NO: 29.
  • One or more of the peptides may be substituted with a shorter peptide as described above, for example a peptide having at least 20 contiguous amino acids of the substituted peptide or with a peptide having at least 80% identity to the amino acid sequence of the substituted peptide across its entire length.
  • the composition comprises at least one peptide from HB V
  • the HB V polymerase peptide comprises at least one amino acid sequence within SEQ ID NO: 1, such as at least one sequence within SEQ ID NO: 5, 6, 14, 15, 24 or 25.
  • such peptides may comprise the amino acid sequence shown in one of SEQ ID NOs: 80, 81, 82, 83, 86, 87, 88, 89, 24 or 25.
  • HBV genotypes include genotypes A, B, C, D, E and F.
  • the long peptides may comprise epitopes from at least two HBV genotypes, such as A and D (the most highly prevalent genotypes in Europe) or B and C (the most highly prevalent genotypes in Asia). More preferably, the composition comprises epitopes from at least three HBV genotypes, such as for example, A, B and C, A, B and D, A, C and D or B, C and D.
  • the composition comprises epitopes from at least HBV genotypes A, B, C and D.
  • the composition may comprise epitopes to genotypes E, F and/or G. This may be determined by any suitable means, for example by using an in vitro PBMC assay as described herein.
  • the present invention provides a composition capable of eliciting an immune response in PBMC from two, three, four or all of: an individual infected with HBV genotype A, an individual infected with HBV genotype B, an individual infected with HBV genotype C, an individual infected with HBV genotype D and an individual infected with another HBV genotype.
  • a composition of the invention that is capable of eliciting an immune response in two, three or all of: an individual infected with HBV genotype A, an individual infected with HBV genotype B, an individual infected with HBV genotype C and an individual infected with HBV genotype D may comprise at least one peptide selected from at least two, preferably three or all of the following groups:
  • composition may further comprise a peptide comprising at least 15 contiguous amino acids of SEQ ID NO: 55 or SEQ ID NO: 71.
  • composition may comprise a peptide selected from at least two, preferably three or all of the following groups:
  • composition may further comprise a peptide comprising at least 15 contiguous amino acids of SEQ ID NO: 55 or SEQ ID NO: 71.
  • Suitable peptides comprising at least 15 amino acids of the specified sequences are described in more detail herein and include, in particular, the peptides of SEQ ID NOs: 24 to 38 mentioned in Table 4 and the peptides of SEQ ID NOs: 221 and 222.
  • the composition of the invention elicits an in vitro response in peripheral blood mononuclear cells (PBMC) from at least one individual chronically infected with HBV genotype A, one individual chronically infected with HBV genotype B, one individual chronically infected with HBV genotype C and one individual chronically infected with HBV genotype D.
  • PBMC peripheral blood mononuclear cells
  • the individuals may be of the same or different ethnicities, preferably from at least two different ethnicities.
  • the individuals may be of the same or different HLA subtypes, preferably at least two different HLA subtypes. Ethnicities
  • the invention provides a composition capable of eliciting an immune response in individuals of at least two, such as three or more different ethnicities. This can be assessed using an in vitro PBMC assay as described in the Examples.
  • the composition of the invention may be capable of eliciting an immune response in PBMC from two, three or all of: an Oriental or Indian individual infected with HBV, a Caucasian individual infected with HBV and an African or Arabic individual infected with HBV.
  • a composition of the invention that is capable of eliciting an immune response in two, three or all of: an Oriental or Indian individual infected with HBV, a Caucasian individual infected with HBV and an African or Arabic individual infected with HBV may comprise at least one peptide selected from at least two, preferably three or all of the following groups:
  • composition may further comprise a peptide comprising at least 15 contiguous amino acids of SEQ ID NO: 55 or SEQ ID NO: 71.
  • composition may comprise a peptide selected from at least two, preferably three or all of the following groups:
  • composition may further comprise a peptide comprising at least 15 contiguous amino acids of SEQ ID NO: 55 or SEQ ID NO: 71.
  • Suitable peptides comprising at least 15 amino acids of the specified sequences are described in more detail herein and include, in particular, the peptides of SEQ ID NOs: 24 to 38 mentioned in Table 4 and the peptides of SEQ ID NOs: 221 and 222.
  • HLA class I and class II molecules are polymorphic and their frequency varies between ethnic groups. Most of the polymorphism is located in the peptide-binding region, and as a result each variant is believed to bind a unique repertoire of peptide ligands. HLA polymorphism represents a major challenge for vaccine designers since HLA polymorphism is the basis for differential peptide binding. Moreover, specific HLA alleles are expressed at dramatically different frequencies in different ethnicities.
  • HLA molecules bind overlapping set of peptides, and therefore, may be grouped accordingly into supertypes (Lund et al (2004)
  • a supertype is defined as a family of different HLA molecules having similar peptide binding repertoire and consequently sharing overlapping sets of peptides. In other words, a peptide that binds to an HLA allele belonging to a given supertype is likely to present a binding activity to the other supertype members.
  • Binding capacity of the peptides for different HLA class II alleles can be determined using a heterologous competitive assay using a specific biotinylated tracer peptide for each HLA class II allele as described in Texier et al (2000) J Immunol 164:3177-3184, Texier et al (2001) Eur J Immunol 31 : 1837-1846 and Castelli et al (2002) J Immunol 169:6928-6934.
  • HLA-DR1 ( ⁇ 1 *01 :01; ⁇ 1 *01 :01), HLA-DR3
  • HLA-DR4 ( ⁇ 1 *01 :01; ⁇ 1 *01 :01), HLA-DR7
  • HLA-DR11 ( ⁇ 1 *01 :01; ⁇ 1 *07:01), HLA-DR11 ( ⁇ 1 *01 :01 ; ⁇ 1 * 11 :01), HLA-DR13
  • HLA-DR15 ( ⁇ 1 *01 :01; ⁇ 1 * 13 :01), HLA-DR15 ( ⁇ 1 *01 :01; ⁇ 1 * 15 :01), HLA-DR51
  • a peptide present in a composition of the invention typically binds to at least two, preferably at least three, of the nine major HLA class II alleles, such as to at least two, preferably at least three, of the seven HLA class II alleles described in Example 10.
  • One or more of the peptides present in the composition may bind to at least four, five, six, seven, eight or all of the nine major HLA class II alleles or to at least four, five, six or all of the seven HLA class II alleles described in Example 10.
  • the composition of the invention preferably comprises peptides that can bind to at least seven, at least eight or all nine of the major HLA class II alleles described above, such as to all of the seven HLA class II alleles described in Example 10.
  • the number of HLA class I binding registers contained in each peptide may be determined by determining the ability of the peptide to bind to a range of frequently occurring HLA class I molecules.
  • HLA class I binding may be measured using the Prolmmune REVEAL® MHC-peptide Binding Assay (Prolmmune Ltd, Oxford, UK).
  • the REVEALTM MHC peptide-binding assay measures the ability of each peptide to stabilize the ternary MHC-peptide complex for HLA-A*0101, HLA-A*0201, HLA- A*0301, HLA-A*2402, HLA-B*0702, HLA-B*0801, HLA-B*3501 representative of main HLA class I supertypes.
  • Each tested peptide is given a score relative to a pass/fail control peptide and also compared to a positive control peptide.
  • HLA class I molecules bind short peptides having length varying from 8 to 11 amino acids.
  • 102 short peptides (27 x 8-mers, 26 x 9-mers, 25 x 10-mers & 24 x 11-mers) could be derived from a 35-mer peptide sequences.
  • binding assays can be conducted using only nonamer peptides (the most frequent length for HLA class I binding peptides) with a good prediction score based on publically available algorithms.
  • HLA class I alleles are highly represented in human populations and (2) they belong to well-defined HLA supertypes (http ://bi oi nform atics . nro dp . org/ : HLA-A*0101, HLA-A*0201, HLA-A*0301, HLA-A*2402, HLA-B*0702, HLA- B*0801, HLA-B*3501 and HLA-A* 1101.
  • a peptide present in the composition of the invention typically comprises shorter peptides that bind to at least one, preferably at least two or at least three of these HLA class I alleles, such as to the first seven class I alleles listed above and preferably to the seven HLA class I alleles mentioned in Example 9.
  • One or more of the peptides present in the composition may comprise shorter peptides that bind to at least four, five, six or all of the seven HLA class I alleles.
  • the composition of the invention preferably comprises peptides that comprise shorter peptides that can bind to at least five, at least six or all seven of the HLA class I alleles described above.
  • a pharmaceutical composition of the invention typically comprises one or more peptides comprising one or more T-cell epitopes that bind to different MHC alleles to give broad population coverage.
  • the composition may comprise peptides known or predicted to contain one or more MHC binding motif related to highly frequent MHC alleles in a specific ethnic group or across multiple ethnic groups.
  • the composition may comprise one or more promiscuous CD4+ and CD8+ T-cell epitopes that bind to more than one allelic variant.
  • the combination of peptide sequences in the composition provides T-cell epitopes that bind to different HLA subtypes.
  • the composition of the invention elicits a response in vitro in peripheral blood mononuclear cells (PBMC) from at least two individuals with different HLA subtypes.
  • PBMC peripheral blood mononuclear cells
  • the composition may elicit an immune response in at least three, four, five, six or seven individuals each having a different HLA genotype, who may be Individuals of different ethnicities.
  • the fluorocarbon can comprise one or more chains derived from
  • perfluorocarbon or mixed fluorocarbon/hydrocarbon radicals may be saturated or unsaturated, each chain having from 3 to 30 carbon atoms.
  • the chains in the fluorocarbon attachment are typically saturated or unsaturated, preferably saturated.
  • the chains in the fluorocarbon attachment may be linear or branched, but preferably are linear. Each chain typically has from 3 to 30 carbon atoms, from 5 to 25 carbon atoms, or from 8 to 20 carbon atoms.
  • a reactive group, or ligand for example -CO-, - H-, S, O or any other suitable group is included in the vector.
  • the use of such ligands for achieving covalent linkages is well known in the art.
  • the reactive group may be located at any position on the fluorocarbon vector.
  • Coupling of the fluorocarbon vector to the peptide may be achieved through functional groups such as -OH, -SH, -COOH and - H 2 , naturally present or introduced onto any site of the peptide.
  • functional groups such as -OH, -SH, -COOH and - H 2 , naturally present or introduced onto any site of the peptide. Examples of such linkages include amide, hydrazone, disulphide, thioether and oxime bonds.
  • a spacer element (peptidic or non-peptidic) can be incorporated to permit cleavage of the peptide from the fluorocarbon element for processing within an antigen-presenting cell and to optimize steric presentation of the peptide.
  • the spacer can also be incorporated to assist in the synthesis of the molecule and to improve its stability and/or solubility. Examples of spacers include polyethylene glycol (PEG) or amino acids such as lysine or arginine that may be cleaved by proteolytic enzymes.
  • the C m F n -C y H x moiety is linear.
  • the fluorocarbon vector is derived from 2H, 2H, 3H, 3H- perfluoroundecanoic acid of the following formula:
  • a preferred fluorocarbon attachment is the linear saturated moiety
  • fluorocarbon attachments have the following formulae: C6Fi3(CH 2 ) 2 -, C 7 Fi5(CH 2 ) 2 -, C9Fi9(CH 2 ) 2 -, CioF 2 i(CH 2 ) 2 -, C 5 Fn(CH 2 )3-, C6Fi3(CH 2 )3-, C 7 Fi 5 (CH 2 ) 3 -, C 8 Fi 7 (CH 2 ) 3 - and C9Fi9(CH 2 ) 3 - which are derived from
  • TThhuuss TThhuuss, ffoorr eexxaammppllee,, aa nnuummbbeerr ooff tthhee fflluuoorriinnee aattoommss mmaayy bbee rreeppllaacceedd wwiitthh ootthheerr hhaallooggeenn aattoommss suucchh aass cchhlloorriinnee,, bbrroommiinnee oorr iiooddiinnee..
  • compositions described herein comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more immunogenic peptides optionally each covalently linked to its own fluorocarbon vector.
  • the present invention also provides a peptide that is useful in a composition of the invention.
  • the peptide may be any one of the peptides described above.
  • the invention provides a peptide of up to 40, 50 or 60 amino acids in length comprising one of the sequences shown in SEQ ID NOs: 24 to 33 and 221 or a sequence that is at least 80% identical, such as at least 85%>, 90%, 95% or 98% identical, to one of the sequences shown in SEQ ID NOs: 24 to 33 and 221.
  • the peptide may include additional amino acids as described above.
  • the invention provides a peptide having the sequence shown in one of SEQ ID NOs: 34 to 38 and 222.
  • Particularly preferred peptides of the invention comprise, consist essentially of, or consist of the sequences shown in SEQ ID NOs: 24, 25, 28, 30, 31, 32, 33, 34, 36, 37 and 38.
  • the invention also provides highly conserved immunogenic peptides from the terminal domain of HBV polymerase.
  • These peptides may be any of the HBV polymerase peptides described above with reference to the compositions of the invention.
  • Such peptides are typically from 15 to 60 amino acids in length comprise at least 15 contiguous amino acids of SEQ ID NO: 1 or 2 and elicit an immune response in vitro in PBMC from at least one individual chronically infected with HBV.
  • the peptide may be coupled to a carrier as described above.
  • the peptide of the invention is covalently linked to a fluorocarbon vector.
  • the fluorocarbon vector may be as described above.
  • the composition of the invention may comprise an additional immunogen.
  • the immunogen may be a B-cell antigen.
  • the B-cell antigen can serve to stimulate an antibody response to HBV.
  • a pharmaceutical composition of the invention can, for example, comprise one or more fluorocarbon-linked peptides, which can stimulate a T- cell response, and a B-cell antigen.
  • Suitable immunogens that act as B-cell antigens include protein antigens such as hepatitis B surface antigen (HBsAg) or hepatitis B core antigen (HBcAg or HBeAg)
  • the present invention provides a composition comprising two or more peptides, such as fluorocarbon-linked peptides, further comprising an adjuvant and/or optionally a pharmaceutically acceptable carrier or excipient.
  • the excipient may be a stabilizer or bulking agent necessary for efficient lyophilisation. Examples include sorbitol, mannitol, polyvinylpyrrolidone and mixtures thereof, preferably mannitol.
  • Other excipients that may be present include preservatives such as antioxidants, lubricants, cryopreservatives and binders well known in the art.
  • An adjuvant is an agent that is able to modulate the immune response directed to a co-administered antigen while having few if any direct effects when given on its own. Such adjuvants may be capable of potentiating the immune response in terms of magnitude and/or cytokine profile.
  • adjuvants include: natural or synthetically derived refinements of natural components of bacteria such as Freund's adjuvant & its derivatives, muramyldipeptide (MDP) derivatives, CpG,
  • monophosphoryl lipid A monophosphoryl lipid A
  • adjuvant or potentiating agents such as saponins, aluminium salts and cytokines
  • oil in water adjuvants water-in-oil adjuvants
  • immunostimulating complex (ISCOMs) immunostimulating complex
  • liposomes formulated nano and micro- particles
  • bacterial toxins and toxoids inulin, particularly gamma inulin
  • TLR agonists TLR agonists.
  • the adjuvant may be selected from the group consisting of:
  • Peptidoglycan such as TDM, MDP, muramyl dipeptide, Murabutide
  • alum solution such as aluminium hydroxide, ADJUMERTM (polyphosphazene) or aluminium phosphate gel
  • glucans algammulin
  • surfactants such as squalane, Tween 80, Pluronic or squalene
  • calcium phosphate gel bacterial toxins or toxoids (such as cholera holotoxin, cholera-toxin- Al -protein- A-D-fragment fusion protein, sub-unit B of the cholera toxin, or block copolymers)
  • cytokine-containing liposomes water-in-oil adjuvants (such as Freund's complete adjuvant, Freund's incomplete adjuvant or Montanide such as ISA 51 or ISA 720); oil-in-water adjuvants (such as MF-59); inulin- based adjuvants; cytokines (
  • compositions of the invention can be prepared by:
  • solubilising at least one peptide such as a fluorocarbon-linked peptide
  • a fluorocarbon-linked peptide in acetic acid or in other solvents as a first step in formulating a pharmaceutical product.
  • solvents that may be used to disperse one or more of the fluorocarbon-linked peptides in the blend include phosphate buffered saline (PBS), propan-2-ol, tert-butanol, acetone and other organic solvents.
  • the peptide or fluorocarbon-linked peptide used as a starting material is typically desiccated.
  • Peptides and fluorocarbon-linked peptides that comprise peptides shorter than 20 amino acids and/or that have fewer than 50% hydrophobic residues can be solubilised in a solvent other than acetic acid.
  • Acetic acid is typically used where the peptide has more than 20 amino acids and/or has more than 50% hydrophobic residues.
  • the concentration of fluorocarbon-linked peptide in the solution typically is from about 0.1 mM to about 10 mM, such as about 0.5 mM, 1 mM, 2 mM, 2.5 mM or 5 mM.
  • An example of a suitable concentration is about 10 mg/mL.
  • the input components may be blended homogenously together to the desired ratios with any aggregates dispersed, rendered sterile and presented in a suitable format for administration.
  • Such examples could include the introduction of a vortexing and/or sonication post-blending or post-dilution stage to facilitate solubilisation.
  • Other permutations of the manufacturing process flow could include sterile filtration being performed at an earlier stage of the process or the omission of lyophilisation to permit a liquid final presentation.
  • the solubilised peptides or fluorocarbon-linked peptides are blended to create a mixture of peptides or fluorocarbon-linked peptides.
  • the optional adjuvant and/or one or more pharmaceutically acceptable excipients can also be added to the solubilised peptide/fluorocarbon-linked peptide or mixture of peptides/fluorocarbon-linked peptides.
  • fluorocarbon-linked peptides are mixed with the excipient and/or adjuvant.
  • the solution of fluorocarbon-linked peptide(s) may be diluted.
  • the blend may be diluted in water.
  • the solution containing the peptides or fluorocarbon-linked peptides is preferably sterilised. Sterilisation is particularly preferred where the formulation is intended for systemic use. Any suitable means of sterilisation may be used, such as UV sterilisation or filter sterilisation. Preferably, filter sterilisation is used. Sterile filtration may include a 0.45 ⁇ filter followed by a 0.22 ⁇ sterilizing grade filter train.
  • Sterilisation may be carried out before or after addition of any excipients and/or adjuvants.
  • composition of the invention may be in dried, such as lyophilized, form.
  • the composition of the invention may be an aqueous solution, for example an aqueous solution formed by dissolving a lyophilisate or other dried formulation in an aqueous medium.
  • the aqueous solution is typically pH neutral.
  • Drying the formulation facilitates long-term storage. Any suitable drying method may be used. Lyophilisation is preferred but other suitable drying methods may be used, such as vacuum drying, spray-drying, spray freeze-drying or fluid bed drying. The drying procedure can result in the formation of an amorphous cake within which the peptides or fluorocarbon-linked peptides are incorporated.
  • the sterile composition may be lyophilized.
  • Lyophilisation can be achieved by freeze-drying.
  • Freeze-drying typically includes freezing and then drying.
  • the fluorocarbon-linked peptide mixture may be frozen for 2 hours at -80°C and freeze-dried in a freeze drying machine for 24 hours.
  • compositions of the invention may be solid compositions.
  • the fluorocarbon-linked peptide composition may be obtained in a dry powder form.
  • a cake resulting from lyophilisation can be milled into powder form.
  • a solid composition according to the invention thus may take the form of free-flowing particles.
  • the solid composition typically is provided as a powder in a sealed vial, ampoule or syringe. If for inhalation, the powder can be provided in a dry powder inhaler.
  • the solid matrix can alternatively be provided as a patch.
  • a powder may be compressed into tablet form.
  • the dried, for example, lyophilized, peptide or fluorocarbon-linked peptide composition may be reconstituted prior to administration.
  • substitution is understood to mean dissolution of the dried vaccine product prior to use.
  • the immunogenic peptide for example, the fluorocarbon-linked peptide product
  • the formulation is typically reconstituted in the aqueous phase, for example by adding Water for Injection, histidine buffer solution (such as 28mM L-histidine buffer), sodium bicarbonate, Tris-HCl or phosphate buffered saline (PBS).
  • the reconstituted formulation is typically dispensed into sterile containers, such as vials, syringes or any other suitable format for storage or administration.
  • composition may be stored in a container, such as a sterile vial or syringe, prior to use.
  • the invention provides the composition of the invention for use in the treatment of the human or animal body by therapy.
  • the composition of the invention is provided for use in a method of treating or preventing HBV infection.
  • the composition of the invention elicits an immune response that may also be useful in HBV prophylaxis.
  • the composition of the invention is preferably for use as a therapeutic vaccine to treat individuals infected with HBV.
  • the composition of the invention is particularly useful in the treatment of patients with persistent chronic HBV infection, but may also be used to treat immune tolerant patients or inactive chronic carriers.
  • the present invention provides a therapeutic vaccine as a disruptive technology for the treatment of chronic HBV (CHB).
  • CHB chronic HBV
  • the compositions of the invention enhance antiviral T-cell responses leading to spontaneous immune control of HBV infection. This allows cessation of antiviral NUC therapy and could potentially also lead to serological cure of HBV infection.
  • HBsAg decline is used as a predictor of long term improved clinical outcome.
  • HBsAg levels can be linked to the number of HBV- infected hepatocytes and are determined by transcriptional activity of intrahepatic cccDNA controlled by various cytokines. Treatment using a composition of the invention may lead to HBsAg loss or HBsAg seroconversion.
  • the peptides and compositions of the invention are particularly useful in treating NUC -treated CHB patients.
  • the peptides also represent an affordable treatment for HBeAg-positive patients in developing countries who may not be able to afford long- term NUC treatment.
  • Vaccination of NUC -treated, HBV-DNA suppressed, HBeAg- negative patients in particular with the peptide compositions of the invention facilitates and accelerates HBsAg clearance.
  • HBeAg-positive patients may also be treated.
  • the compositions of the invention may also be used to treat inactive carriers of HBV.
  • Hepatitis B virus (HBV) infection is a major cause of liver-related morbidity and mortality.
  • the compositions of the invention are provided for use in the treatment of liver failure, end-stage liver disease and hepatocellular carcinoma.
  • compositions of the invention are useful in the vaccination of patients with hepatitis delta (HDV), the most severe form of viral hepatitis, for whom no approved therapy is available and which only occurs as a co-infection in HBsAg-positive individuals.
  • HDV hepatitis delta
  • the invention also provides the use of the pharmaceutical composition of the invention in the manufacture of a medicament for treating or preventing HBV infection, particularly CHB, for treating or preventing liver failure, end-stage liver disease or hepatocellular carcinoma, or for treating or preventing HDV.
  • the invention provides a method of treating or preventing HBV infection in a subject in need thereof, said method comprising administering to said subject a prophylactic or therapeutic amount of a composition of the present invention.
  • composition of the invention may be administered in combination with a second therapeutic or prophylactic agent.
  • the second agent may comprise a further immunogen (such as a globular antigen or a recombinant or naturally occurring antigen), to further stimulate an immune response, for example to stimulate a humoral immune response where the fluorocarbon-linked peptide stimulates a cellular immune response, to HBV.
  • a further immunogen such as a globular antigen or a recombinant or naturally occurring antigen
  • an immune response for example to stimulate a humoral immune response where the fluorocarbon-linked peptide stimulates a cellular immune response, to HBV.
  • the second agent can be a B-cell antigen.
  • Suitable B-cell antigens include HBsAg, HBcAg and HBeAg.
  • the second agent is an agent known for use in an existing HBV therapeutic treatment.
  • the existing HBV therapeutic agent may be an interferon, such as interferon-alpha, or NUC, such as entecavir and tenofovir.
  • the HBV therapeutic treatment may be a treatment that blocks suppressive cell types. Agents useful in such blocking treatments include anti-PDl blocking antibodies, anti-PDIL blocking antibodies, anti-LAG3 blocking antibodies, anti-TEVB blocking antibodies, anti-CTLA4 blocking antibodies and cyclophosphamide.
  • composition of the invention may be contemporaneous or separated by time.
  • the composition of the invention may be administered before, together with or after the second therapeutic agent.
  • compositions of the invention can be administered to a human or animal subject in vivo using a variety of known routes and techniques.
  • the composition may be provided as an injectable solution, suspension or emulsion and administered via parenteral, subcutaneous, oral, epidermal, intradermal, intramuscular, interarterial, intraperitoneal, intravenous injection using a conventional needle and syringe, or using a liquid jet injection system.
  • the composition may be administered topically to skin or mucosal tissue, such as nasally, intratrachealy, intestinally, sublingually, rectally or vaginally, or provided as a finely divided spray suitable for respiratory or pulmonary administration.
  • the compositions are administered intramuscularly.
  • composition can be administered to a subject in an amount that is compatible with the dosage composition and that will be prophylactically and/or therapeutically effective.
  • administration of the composition of the invention may be for either "prophylactic” or "therapeutic" purpose.
  • therapeutic includes any one or more of the following: the prevention of infection or reinfection; the reduction or elimination of symptoms; and the reduction or complete elimination of a pathogen. Treatment may be effected prophylactically (prior to infection) or therapeutically (following infection).
  • compositions may be formulated for any suitable route and means of administration.
  • Pharmaceutically acceptable carriers or diluents include those used in compositions suitable for oral, ocular, rectal, nasal, topical (including buccal and sublingual), vaginal or parenteral (including subcutaneous, intramuscular, intravenous, intradermal, transdermal) administration.
  • compositions may be administered in any suitable form, for example as a liquid, solid or aerosol.
  • oral formulations may take the form of emulsions, syrups or solutions or tablets or capsules, which may be enterically coated to protect the active component from degradation in the stomach.
  • Nasal formulations may be sprays or solutions.
  • Transdermal formulations can be adapted for their particular delivery system and may comprise patches.
  • Formulations for injection may be solutions or suspensions in distilled water or another pharmaceutically acceptable solvent or suspending agent.
  • the appropriate dosage of the prophylactic or therapeutic vaccine to be administered to a patient will be determined in the clinic. However, as a guide, a suitable human dose, which may be dependent upon the preferred route of
  • administration may be from 1 to 1000 ⁇ g, such as about 100 ⁇ g, 200 ⁇ g or 500 ⁇ g.
  • Multiple doses may be required to achieve an immunological or clinical effect, which, if required, will be typically administered between 2 to 12 weeks apart. Where boosting of the immune response over longer periods is required, repeat doses 1 month to 5 years apart may be applied.
  • Example 1 Assessment of ex vivo immunogenicity of HBV-derived short peptide pools in human PBMC
  • Cryopreserved PBMC from 17 subjects were obtained from CTL Technologies. These subjects conformed to the following criteria: Good general health, Unvaccinated to HBV, HBV surface antigen-negative, HBV core antibody-negative, HIV-negative and HCV-negative
  • PBMC peripheral blood mononuclear cells
  • lxlO 6 cells/mL concentration of lxlO 6 cells/mL for a total of 11 days.
  • Cells were stimulated with a peptide pool containing 144 overlapping HBV-derived short peptides (SEQ ID NOs: 73 to 210 and SEQ ID NOs: 214 to 219), ranging in length from 15-20 amino acids and in overlap from 10 to 13 amino acids, at a final concentration of O. ⁇ g/peptide/mL.
  • IL-2 and IL-15 were added to the cultures to final concentrations of 10 IU/mL and lOng/mL respectively.
  • cells were washed twice in CM and cultured with 10 IU/mL IL-2 for 1 additional day.
  • cells were washed twice in CM, counted and incorporated in a human IFNy ELISpot assay or intracellular cytokine staining.
  • ELISpot plates were incubated for 18h at 37°C, 5% C0 2 in a humidified environment. Plates were then washed and incubated with ⁇ (1 :80) of biotinylated anti-human ⁇ detection mAb (R&D Systems) for 2h at room temperature. Following washing, plates were incubated with a streptavidin- conjugated alkaline phosphatase (1 :80) for lh followed by a substrate (30min) according to the manufacturer's instructions (R&D Systems). The developed spots were counted using an automated plate counting system (CTL Europe).
  • CTL Europe automated plate counting system
  • the plate was incubated at 37°C in a 5% C0 2 incubator for 20h.
  • PMA/Ionomycin was added to respective wells and Golgi plug was added to all wells.
  • the cells were harvested and washed with PBS + 0.1% BSA (wash buffer) and stained with anti-CD3, anti-CD4 and anti-CD8 (BD Biosciences) for 30 minutes at 4°C. After another wash, the cells were fixed and permeabilised with ⁇ . of BD Cytofix/Cytoperm solution for 20 minutes at 4°C, followed by two washes with lx BD Perm/Wash solution.
  • HBV genotype could not be determined using this method.
  • IMMUNIS® HBV genotype enzyme immunoassay (EIA) kit was subsequently employed. This assay used four genotype-dependent epitopes in the PreS2 region of the HBsAg, with genotypes being determined serologically by positive/negative
  • the initial step in identifying regions of interest in the HBV proteome was the comparison of ⁇ ELISpot responses of PBMC from HBV-uninfected, unvaccinated healthy subjects with those from chronic HBV-infected HBeAg negative - inactive carrier subjects in sustained control phase of the disease and chronic HBV-infected HBeAg negative subjects under treatment.
  • PBMC were restimulated overnight with pools of these short peptides representing specific regions of interest within the HBV polymerase, core, X and surface antigens respectively. IFNy responses to these peptide pools were then assessed using a human ⁇ ELISpot assay.
  • Pools representing a number of antigenic regions were found to stimulate IFNy responses which were specific to the chronic HBV subjects. Specifically, stimulation with pools representing terminal regions of the HBV polymerase (pool 2 & pool 3) and regions of the HBV core (pools 14-17) resulted in the greatest magnitude and population coverage of ⁇ responses in the HBV-infected subjects ( Figure 1). To a lesser extent, pools 4 to 9 and pools 11 to 13 also tend to promote HBV-specific T-cell responses.
  • HBV-specific responses to short peptide pools infecting HBV genotype was determined for each subject. This was determined by means of HBV surface antigen epitope assessment in plasma samples. IFNy responses of PBMC from both immune control and treated HBV-infected subjects were subsequently grouped according to HBV genotypes A, B, C and D. Some subjects were not classified into these genotypes due to the sensitivity limitations of the assay and possible rare sera being assessed. These subjects were therefore not included in this assessment. Response profiles between the four genotypes showed similarities in that the regions showing the greatest magnitude of ⁇ responses were generally in the terminal polymerase and core regions of the HBV proteome ( Figure 2). Pools 2, 3, 10, 12, 14, 15, 16 and 17 appear to provide responses against multiple genotypes.
  • Example 2 Assessment of ex vivo immunogenicity of HBV-derived Densigen- associated short peptide pools in human PBMC
  • Cryopreserved PBMC from 17 subjects were obtained from CTL Technologies. These subjects conformed to the following criteria: Good general health, Unvaccinated to HB V, HBV surface antigen-negative, HBV core antibody-negative, HIV-negative and HCV-negative
  • PBMC peripheral blood mononuclear cells
  • lxlO 6 cells/mL concentration of lxlO 6 cells/mL for a total of 11 days.
  • Cells were stimulated with a peptide pool containing 144 overlapping HBV-derived short peptides (SEQ ID NO: 73 to 210 and SEQ ID NO: 142 to 147), ranging in length from 15-20 amino acids and in overlap from 10 to 13 amino acids, at a final concentration of O. ⁇ g/peptide/mL.
  • IL-2 and IL-15 were added to the cultures to final concentrations of 10 IU/mL and lOng/mL respectively.
  • cells were washed twice in CM and cultured with 10 IU/mL IL-2 for 1 additional day.
  • On Day 1 cells were washed twice in CM, counted and incorporated in a human IFNy ELISpot assay or intracellular cytokine staining.
  • ELISpot plates were incubated for 18h at 37°C, 5% C0 2 in a humidified environment. Plates were then washed and incubated with ⁇ (1 :80) of biotinylated anti-human IFNy detection mAb (R&D Systems) for 2h at room
  • Intracellular cytokine staining (ICS) assay Cells were plated in a 96 well round bottom plate at 5xl0 5 PBMC/well with stimulation from HBV-derived peptide pools at final concentrations of
  • the plate was incubated at 37°C in a 5% C0 2 incubator for 20h.
  • PMA/Ionomycin was added to respective wells and Golgi plug was added to all wells.
  • the cells were harvested and washed with PBS + 0.1% BSA (wash buffer) and stained with anti-CD3, anti-CD4 and anti-CD8 (BD Biosciences) for 30 minutes at 4°C. After another wash, the cells were fixed and permeabilised with ⁇ . of BD
  • HBV genotype could not be determined using this method.
  • IMMUNIS® HBV genotype enzyme immunoassay (EIA) kit was subsequently employed. This assay used four genotype-dependent epitopes in the PreS2 region of the HBsAg, with genotypes being determined serologically by positive/negative
  • 35- 40mer regions of interest were identified. These regions were further assessed with a view to using 35-40mer peptides in a vaccine. Further assessment involved redesign of short peptide pools previously used for restimulation following short-term culture. Terminal short peptides extending beyond the 35-40mer regions of interest were removed from pools in order to more accurately reflect the peptides that would be used in a vaccine. Following short-term culture with the peptide library, as before, these short peptide pools were then used for restimulation in human IFNy ELISpot and ICS assays.
  • IFNy ELISpot responses to pools 24 to 46 were grouped according to infecting HBV genotype ( Figure 6). Pool 27, 28, 29, 32, 35, 36 each give a predominant responses against genotype C. Pools 25 and 26 give a predominant response against genotype D. Pools 30 and 31 give a predominant response against genotype B. Pools 38, 42, 43 and 44 give a predominant response against genotype A. Some pools tend to promote responses against more than one genotype: two genotypes for pools 26, 32, 33, 36 and 43, three genotypes for pools 37, 38, 41 and 42 or even four genotypes for pool 25.
  • IFNy ELISpot responses to pools 24 to 46 were grouped according to infecting
  • African/Arabic African/Arabic
  • Peptides having the amino acid sequences shown in SEQ ID NOs: 24, 25, 28, 33, 34, 36, 37 and 38 and 222 were synthesised by FMOC (fluorenylmethyloxycarbonyl chloride) solid-phase synthesis.
  • the fluorocarbon chain (C 8 Fi 7 (CH 2 ) 2 COOH) was then incorporated on the epsilon-chain of an additional N-terminal lysine of each peptide to derive the fluorocarbon-linked peptide.
  • Purified fluorocarbon-linked peptides or unmodified peptides were obtained through cleavage in the presence of trifiuoroacetic acid (TFA) and a final purification by reverse phase-high performance liquid chromatography (RP-FIPLC). All preparations had a purity of 90% or greater.
  • F A-P 113 K(F A)- VGPLTVNEKRRLKLIMP ARF YPNVTKYLPLDKGIK- H 2 (SEQ ID NO: 24);
  • F A-P 151 K(F A)-PEHVVNHYFQTRHYLHTLWK AGILYKRETTRS ASF-NH 2 (SEQ ID NO: 25);
  • FA-P376 K(FA)-KLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAISSVVRR-NH 2 (SEQ ID NO: 28);
  • FA-P877 K(FA)-PPAYRPPNAPILSTLPETTVVRRRGRSPRRR-NH 2 (SEQ ID NO: 33);
  • FA-P1266(K) K(FA)-KKKGPLLVLQAGFFLLTRILTIPQSLDSW WTSLNFLKKK- NH 2 (SEQ ID NO: 222)
  • NP113 VGPLTVNEKRRLKLFMPARFYPNVTKYLPLDKGIK (SEQ ID NO: 24); NP151 : PEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASF (SEQ ID NO: 25); NP376: KLHL YSHPIILGFRKIPMGVGL SPFLL AQF T S AI S S VVRR (SEQ ID NO: 28);
  • NP753(K) KKKEFGATVELLSFLPSDFFPSVRDLLDTASALYRKKK (SEQ ID NO: 36);
  • NP856(K) LTF GRET VLEYL VSF GVWIRTPP A YRPPN APIL S TKKK (SEQ ID NO: 38);
  • NP877 PPAYRPPNAPILSTLPETTVVRRRGRSPRRR ( SEQ ID NO: 33);
  • NP797(K) SPHHTALRQAILSWGELMTLATWVGSNLEDPASRDKKK (SEQ ID NO: 37);
  • NP1266(K) KKKGPLLVLQ AGFFLLTRILTIPQ SLD SWWTSLNFLKKK (SEQ ID NO: 222).
  • SEQ ID NO: 222 SEQ ID NO: 223.
  • a vaccine candidate, FP02.1, composed of the nine fluorocarbon-conjugated HBV-derived peptides prepared as described in Example 3 were formulated as described below. Conditions for peptide solubilization are described in Table 5.
  • each of the nine fluorocarbon-conjugated peptides was weighed in a 5ml glass vial. Each peptide was then solubilised with 2 to 12% acetic acid in water solutions to achieve a peptide concentration of lOmg. Peptide solutions (3.9ml for each peptide) were blended in a 150ml sterile container before 3.9ml of 10% acetic acid solution in water was added. After stirring with a magnetic stirrer for 2 minutes, 39mL of 9.0% mannitol in water solution was added. After stirring with a magnetic stirrer for a further 2 minutes, the solution was filtered using a 0.22 ⁇ 33mm Millex filter.
  • Example 5 Preferred HBV peptides and mixtures are immunogenic in chronic HBV carriers irrespective of the disease stage, the genotype of the HBV virus and the ethnicity of the subjects.
  • PBMC peripheral blood mononuclear cells
  • peptide was used at a final concentration of 0. ⁇ g/peptide/mL.
  • IL-2 and IL-15 were added to the cultures to final concentrations of 10 IU/mL and lOng/mL respectively.
  • cells were washed twice in CM and cultured with 10 IU/mL IL-2 for 1 additional day.
  • cells were washed twice in CM, counted and incorporated in a human IFNy (interferon-gamma) ELISpot assay or intracellular cytokine staining.
  • Cells from short-term culture were plated in a 96 well round bottom plate at 5xl0 5 PBMC/well with stimulation from 9 HBV-derived long peptides (NPl 13, NP151, NP277(K), NP376, NP753(K), NP797(K), NP856(K), NP877 and NP1266(K)) at final concentrations of 5 ⁇ g/mL.
  • the plate was incubated at 37°C in a 5% C02 incubator for 20h.
  • PMA/Ionomycin was added to respective wells and Golgi plug was added to all wells.
  • the cells were harvested and washed with PBS + 0.1% BSA (wash buffer) and stained with anti-CD3, anti-CD4 and anti-CD8 (BD Biosciences) for 30 minutes at 4°C. After another wash, the cells were fixed and permeabilised with ⁇ . of BD Cytofix/Cytoperm solution for 20 minutes at 4°C, followed by two washes with lx BD Perm/Wash solution. Finally, cells were stained with ant-IL-2-FITC, anti-IFNy-PE and anti-TNFa PerCP-Cy5.5 (BD Biosciences for 30 minutes at 4°C. Samples were acquired on a FACSCanto II flow cytometer (BD Biosciences). Gating was based on media stimulated samples for each subject.
  • HBV genotype could not be determined using this method.
  • IMMUNIS® HBV genotype enzyme immunoassay (EIA) kit was subsequently employed. This assay used four genotype-dependent epitopes in the PreS2 region of the HBsAg, with genotypes being determined serologically by positive/negative
  • Peptides NPl 13, NP151, NP376, NP753(K), NP797(K), NP856(K) and NP877 promote the highest responses across all four genotypes A, B, C & D compared to peptides NP2777(K) and NP1226(K).
  • PI 13 promotes the highest T cell response across all four genotypes compared to all other peptides.
  • Figure 12 shows that all peptides promote T cell responses across all ethnic groups tested.
  • Peptides NPl 13, NP151, NP376, NP753(K), NP797(K), NP856(K) and NP877 promote the highest responses across all three ethnic groups compared to NP277(K) and NP1266(K).
  • Example 6 Superiority of the Fluorocarbon-conjugated peptides compared to unconjugated peptides in their ability to promote T cell responses in vivo
  • mice of FP02.1 (containing nine fluorocarbon- conjugated peptides) was compared to NP02.1 (containing nine equivalent
  • splenocytes were stimulated in vitro with 5 ⁇ g/mL/peptide of nine individual peptides for 18 hours in an ELISpot assay.
  • the number of IFNy + spot forming cells (SFC) was counted. Plates then were washed with PBS, incubated with an IFNy detection peroxidase-labelled antibody, followed by a substrate, according to the manufacturer's instructions.
  • the developed spots were counted using an automated plate counting system (CTL Europe) to quantify the number of IFNy+ SFCs.
  • CTL Europe automated plate counting system
  • Example 7 Fluorocarbon-conjugated peptides promote a CTL/CD8+ T cell response
  • Splenocytes were stimulated in vitro with either a CTL epitope derived from peptide NPl 13 (CTL1 KYLPLDKGI) or a CTL epitope derived from NPl 51 (CTL 2 HYFQTRHYL) at concentrations ranging from 10 1 to 10 "9 ⁇ g/ml for 18 hours in an ELISpot assay.
  • CTL1 KYLPLDKGI CTL epitope derived from peptide NPl 13
  • CTL 2 HYFQTRHYL CTL epitope derived from NPl 51
  • FP02.1 promotes T cell responses against CTL epitopes restricted by MHC class I molecules after a single immunisation.
  • Example 9 Preferred HBV peptides and combinations contain epitopes having the ability to bind to a broad range of HLA class I molecules
  • the Prolmmune REVEAL binding assay was used to determine the ability of short peptides of nine amino-acids (derived from the FIBV long peptides NP113, P151, P277(K), P376, P753(K), P797(K), P856(K), P877 and NP1266(K)) to bind to one or more MHC class I alleles and stabilize the MHC-peptide complex. Detection is based on the presence or absence of the native conformation of the MHC-peptide complex.
  • the highly frequent HLA class I alleles (HLA-A*0201, A*0301, A* l 101, A*2402, B*0702, B*0801, and B*3501) were selected.
  • Binding to MHC molecules was compared to that of a known T-cell epitope, a positive control peptide, with very strong binding properties. All potential nonamers for each HBV peptides (NP113, P151, P277(K), P376, P753(K), P797(K), P856(K), P877 and P1266(K)) except those containing extra-lysines not present in the consensus HBV sequences were synthesised at a purity >90%. The score of the test peptide is reported quantitatively as a percentage of the signal generated by the positive control peptide, and the peptide is indicated as having a putative pass or fail result. Good binders are considered to be those peptides with scores 45% of the positive control as defined by Prolmmune. Results
  • All long HBV peptides contain at least six epitopes having the ability to bind to at least 4 alleles. Any combination of six long peptides contains nonamer epitopes having the ability to bind to all alleles tested.
  • HLA alleles peptide A*0201 A*0301 A*1101 A*2402 B*0702 B*0801 B*3501
  • Example 10 Preferred HBV peptides and combinations contain epitopes having the ability to bind to a broad range of HLA class II molecules
  • the Prolmmune REVEAL® MHC-peptide binding assay was used to determine the ability of each HBV long peptide ( P113, P151, P277(K), P376, P753(K),
  • HLA-DR1 ( ⁇ xl*01:01; ⁇ 1*01:01), HLA-DR15 ( ⁇ xl*01:01; ⁇ 1*15:01), HLA-DR3 ( ⁇ xl*01:01; ⁇ 1*01:01), HLA-DR4 ( ⁇ xl*01:01; ⁇ 1*04:01), HLA-DR11 ( ⁇ 1*01:01;
  • HLA-DR13 ⁇ 1*01:01; ⁇ 1*13:01
  • HLA-DR7 ⁇ 1*01:01; ⁇ 1*07:01
  • HLA class II alleles across the range of HLA class II alleles.
  • P113, P151 and P376 bind to more than 3 different HLA class II alleles.
  • PI 13 binds to a total 6 alleles. The combination of peptides NP113 and P877 binds to all HLA class II alleles tested.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Communicable Diseases (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Mycology (AREA)
  • Biotechnology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/GB2013/053410 2012-12-24 2013-12-20 Vaccines against hepatitis b virus Ceased WO2014102540A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
JP2015548778A JP6811014B2 (ja) 2012-12-24 2013-12-20 B型肝炎ウイルスに対するワクチン
KR1020237003896A KR102625645B1 (ko) 2012-12-24 2013-12-20 B형 간염 바이러스에 대한 백신
DK13814593.3T DK2935313T3 (da) 2012-12-24 2013-12-20 Vacciner mod hepatitis B-virus
ES13814593T ES2906110T3 (es) 2012-12-24 2013-12-20 Vacunas contra el virus de la Hepatitis B
KR1020227003308A KR102497063B1 (ko) 2012-12-24 2013-12-20 B형 간염 바이러스에 대한 백신
CN201380067602.2A CN104903343A (zh) 2012-12-24 2013-12-20 抗乙型肝炎病毒的疫苗
KR1020157020103A KR102358621B1 (ko) 2012-12-24 2013-12-20 B형 간염 바이러스에 대한 백신
EA201591213A EA201591213A1 (ru) 2012-12-24 2013-12-20 Вакцины против вируса гепатита b
CA2895459A CA2895459A1 (en) 2012-12-24 2013-12-20 Vaccines against hepatitis b virus
EP21201879.0A EP3995146A1 (en) 2012-12-24 2013-12-20 Vaccines against hepatitis b virus
US14/655,041 US10300132B2 (en) 2012-12-24 2013-12-20 Vaccines against hepatitis B virus
PL13814593T PL2935313T3 (pl) 2012-12-24 2013-12-20 Szczepionki przeciwko wirusowi zapalenia wątroby typu b
EP13814593.3A EP2935313B1 (en) 2012-12-24 2013-12-20 Vaccines against hepatitis b virus
US16/423,149 US11382969B2 (en) 2012-12-24 2019-05-27 Vaccines against Hepatitis B virus
US17/861,189 US11918645B2 (en) 2012-12-24 2022-07-09 Vaccines against hepatitis B virus

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1223386.2 2012-12-24
GBGB1223386.2A GB201223386D0 (en) 2012-12-24 2012-12-24 Vaccine

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/655,041 A-371-Of-International US10300132B2 (en) 2012-12-24 2013-12-20 Vaccines against hepatitis B virus
US16/423,149 Division US11382969B2 (en) 2012-12-24 2019-05-27 Vaccines against Hepatitis B virus

Publications (1)

Publication Number Publication Date
WO2014102540A1 true WO2014102540A1 (en) 2014-07-03

Family

ID=47682590

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2013/053410 Ceased WO2014102540A1 (en) 2012-12-24 2013-12-20 Vaccines against hepatitis b virus

Country Status (12)

Country Link
US (3) US10300132B2 (https=)
EP (2) EP3995146A1 (https=)
JP (3) JP6811014B2 (https=)
KR (3) KR102625645B1 (https=)
CN (2) CN104903343A (https=)
CA (1) CA2895459A1 (https=)
DK (1) DK2935313T3 (https=)
EA (1) EA201591213A1 (https=)
ES (1) ES2906110T3 (https=)
GB (1) GB201223386D0 (https=)
PL (1) PL2935313T3 (https=)
WO (1) WO2014102540A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016020538A1 (en) * 2014-08-08 2016-02-11 Transgene Sa Hbv vaccine and antibody combination therapy to treat hbv infections
WO2017220463A1 (en) 2016-06-20 2017-12-28 Isa Pharmaceuticals B.V. Formulation of a peptide vaccine
EP3727441A1 (en) * 2017-12-19 2020-10-28 Janssen Sciences Ireland Unlimited Company Methods and apparatus for the delivery of hepatitis b virus (hbv) vaccines
WO2021110919A1 (en) 2019-12-07 2021-06-10 Isa Pharmaceuticals Treatment of diseases related to hepatitis b virus
US20220175913A1 (en) * 2020-01-09 2022-06-09 Virion Therapeutics, Llc Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
WO2023085956A1 (en) * 2021-11-09 2023-05-19 Avalia Immunotherapies Limited Novel therapeutic vaccines

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB0408164D0 (en) * 2004-04-13 2004-05-19 Immune Targeting Systems Ltd Antigen delivery vectors and constructs
GB201022147D0 (en) * 2010-12-31 2011-02-16 Immune Targeting Systems Its Ltd Formulation
GB201223386D0 (en) * 2012-12-24 2013-02-06 Immune Targeting Systems Its Ltd Vaccine
CN106610423A (zh) * 2015-10-26 2017-05-03 复旦大学 评价疫苗疗效的细胞免疫学检测试剂盒及其储存方法
WO2017207814A1 (en) 2016-06-02 2017-12-07 Ultimovacs As A vaccine in combination with an immune checkpoint inhibitor for use in treating cancer
JP2021520414A (ja) * 2018-04-04 2021-08-19 アルティミューン インコーポレーティッド T細胞を誘発するワクチン組成物の組合せ及びその使用
CN113939527B (zh) * 2019-01-11 2025-10-28 新加坡科技研究局 Hla-a*11:01限制性乙型肝炎病毒(hbv)肽用于鉴别hbv特异性cd8+ t细胞的用途
US20220324916A1 (en) * 2019-06-18 2022-10-13 Janssen Sciences Ireland Unlimited Company Hepatitis B Virus (HBV) Vaccines and Uses Thereof
EP4021923A1 (en) * 2019-08-29 2022-07-06 VIR Biotechnology, Inc. Hepatitis b virus vaccines
MX2022015206A (es) * 2020-06-08 2023-01-05 Hoffmann La Roche Anticuerpos anti-hbv y metodos de uso.

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993003753A1 (en) * 1991-08-26 1993-03-04 The Scripps Research Institute Peptides for inducing cytotoxic t-lymphocyte responses to hepatitis b virus
WO1995003777A1 (en) * 1993-08-02 1995-02-09 The Scripps Research Institute Peptides for inducing cytotoxic t lymphocyte responses to hepatitis b virus

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6607727B1 (en) * 1991-08-26 2003-08-19 The Scripps Research Institute Peptides for inducing cytotoxic T lymphocyte responses to hepatitus B virus
JP2004508320A (ja) * 2000-09-08 2004-03-18 エピミューン インコーポレイテッド ペプチドおよび核酸組成物を用いるb型肝炎ウイルスに対する細胞性免疫応答の誘導
GB0408164D0 (en) * 2004-04-13 2004-05-19 Immune Targeting Systems Ltd Antigen delivery vectors and constructs
US10076570B2 (en) * 2009-08-07 2018-09-18 Transgene S.A. Composition for treating HBV infection
GB201022147D0 (en) 2010-12-31 2011-02-16 Immune Targeting Systems Its Ltd Formulation
GB201223386D0 (en) * 2012-12-24 2013-02-06 Immune Targeting Systems Its Ltd Vaccine

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993003753A1 (en) * 1991-08-26 1993-03-04 The Scripps Research Institute Peptides for inducing cytotoxic t-lymphocyte responses to hepatitis b virus
WO1995003777A1 (en) * 1993-08-02 1995-02-09 The Scripps Research Institute Peptides for inducing cytotoxic t lymphocyte responses to hepatitis b virus

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
CAO T. ET AL.: "Characterization of HLA DR13-restricted CD4+T cell epitopes of hepatitis B core antigen associated with self-limited, acute hepatitis B.", J. GEN. VIROL., vol. 83, 2002, pages 3023 - 3033, XP002720154 *
DATABASE UniProt [Online] 1 March 2001 (2001-03-01), "SubName: Full=Precore/core protein;", XP002720153, retrieved from EBI accession no. UNIPROT:Q9DH31 Database accession no. Q9DH31 *

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016020538A1 (en) * 2014-08-08 2016-02-11 Transgene Sa Hbv vaccine and antibody combination therapy to treat hbv infections
WO2017220463A1 (en) 2016-06-20 2017-12-28 Isa Pharmaceuticals B.V. Formulation of a peptide vaccine
EP3552623A1 (en) 2016-06-20 2019-10-16 ISA Pharmaceuticals B.V Formulation of a peptide vaccine
EP3727441A1 (en) * 2017-12-19 2020-10-28 Janssen Sciences Ireland Unlimited Company Methods and apparatus for the delivery of hepatitis b virus (hbv) vaccines
CN111867624A (zh) * 2017-12-19 2020-10-30 杨森科学爱尔兰无限公司 乙型肝炎病毒(hbv)疫苗的递送方法和装置
WO2021110919A1 (en) 2019-12-07 2021-06-10 Isa Pharmaceuticals Treatment of diseases related to hepatitis b virus
US20220175913A1 (en) * 2020-01-09 2022-06-09 Virion Therapeutics, Llc Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
US20230063089A1 (en) * 2020-01-09 2023-03-02 Virion Therapeutics, Llc Adenoviral vectors encoding hepatitis b viral antigens fused to herpes virus glycoprotein d and methods of using the same
US11850282B2 (en) * 2020-01-09 2023-12-26 Virion Therapeutics, Llc Adenoviral vectors encoding hepatitis B viral antigens fused to herpes virus glycoprotein D and methods of using the same
US12605444B2 (en) * 2020-01-09 2026-04-21 Virion Therapeutics, Llc Adenoviral vectors encoding hepatitis B viral antigens fused to herpes virus glycoprotein D and methods of using the same
WO2023085956A1 (en) * 2021-11-09 2023-05-19 Avalia Immunotherapies Limited Novel therapeutic vaccines

Also Published As

Publication number Publication date
KR20220019846A (ko) 2022-02-17
KR102358621B1 (ko) 2022-02-03
JP7235785B2 (ja) 2023-03-08
EP2935313B1 (en) 2021-11-24
GB201223386D0 (en) 2013-02-06
KR20150098676A (ko) 2015-08-28
US20230090379A1 (en) 2023-03-23
KR102497063B1 (ko) 2023-02-06
US20160106830A1 (en) 2016-04-21
JP7187237B2 (ja) 2022-12-12
US10300132B2 (en) 2019-05-28
EP3995146A1 (en) 2022-05-11
ES2906110T3 (es) 2022-04-13
US11382969B2 (en) 2022-07-12
JP6811014B2 (ja) 2021-01-13
US11918645B2 (en) 2024-03-05
CN104903343A (zh) 2015-09-09
PL2935313T3 (pl) 2022-05-02
KR20230021771A (ko) 2023-02-14
CA2895459A1 (en) 2014-07-03
JP2016505589A (ja) 2016-02-25
DK2935313T3 (da) 2022-02-28
US20200016263A1 (en) 2020-01-16
KR102625645B1 (ko) 2024-01-15
EA201591213A1 (ru) 2016-02-29
JP2021098711A (ja) 2021-07-01
EP2935313A1 (en) 2015-10-28
CN114028553A (zh) 2022-02-11
JP2019034946A (ja) 2019-03-07

Similar Documents

Publication Publication Date Title
US11918645B2 (en) Vaccines against hepatitis B virus
JP3738395B2 (ja) Hla−制限型b型肝炎ウィルスのctlエピトープ
AU2001282706B2 (en) HIV peptides from conserved in gag p17 and 924 and their application in E.G. vaccines
EP3041493A1 (en) Oncology vaccine
AU2016201589B2 (en) Peptide adjuvants
HK40067424A (en) Pharmaceutical compositions comprising combination of immunogenic peptides
Iglesias et al. Anti-HIV-1 and anti-HBV immune responses in mice after parenteral and nasal co-administration of a multiantigenic formulation
CN101309931B (zh) 包含截短的hbc核心蛋白和基于皂苷的佐剂的疫苗
US20230263881A1 (en) Vaccine compositions for SARS-related coronaviruses and methods of use
Wang et al. CpG oligodeoxynucleotide-adjuvanted fusion peptide derived from HBcAg epitope and HIV-Tat may elicit favorable immune response in PBMCs from patients with chronic HBV infection in the immunotolerant phase
BR112015015198B1 (pt) Composição farmacêutica, e, vetor de fluorcarbono
WO2023060220A1 (en) Methods of immunization against coronavirus

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13814593

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2895459

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2015548778

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015015198

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2013814593

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20157020103

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201591213

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 14655041

Country of ref document: US

ENP Entry into the national phase

Ref document number: 112015015198

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150623