WO2014052064A1 - Mesothelin antibodies and methods for eliciting potent antitumor activity - Google Patents
Mesothelin antibodies and methods for eliciting potent antitumor activity Download PDFInfo
- Publication number
- WO2014052064A1 WO2014052064A1 PCT/US2013/059883 US2013059883W WO2014052064A1 WO 2014052064 A1 WO2014052064 A1 WO 2014052064A1 US 2013059883 W US2013059883 W US 2013059883W WO 2014052064 A1 WO2014052064 A1 WO 2014052064A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- cancer
- mesothelin
- seq
- subject
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
- G01N33/57492—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites involving compounds localized on the membrane of tumor or cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/734—Complement-dependent cytotoxicity [CDC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
Definitions
- This disclosure concerns monoclonal antibodies, such as single-domain monoclonal antibodies, specific for mesothelin. This disclosure further concerns the use of such antibodies, such as for the detection and treatment of cancer.
- Mesothelin has been suggested as a therapeutic target because it is highly expressed in malignant mesotheliomas (Chang et al , Cancer Res 52: 181-186, 1992; Chang and Pastan, Proc Natl Acad Sci USA 93: 136-140, 1996) and other solid tumors, such as stomach cancer, squamous cell carcinomas, prostate cancer, pancreatic cancer, lung cancer, cholangiocarcinoma, breast cancer and ovarian cancer (Hassan et al , Clin. Cancer Res. 10:3937-3942, 2004; McGuire et al, N. Engl. J. Med. 334: 1-6, 1996; Argani et al. , Clin. Cancer Res.
- the mesothelin (MSLN) gene encodes a -70 kDa precursor protein that is processed to a -30 kDa N-terminal protein and a - 40 kDa C-terminal membrane-bound mature mesothelin (Hassan and Ho, Eur J Cancer 44:46-53, 2008).
- mAbs anti- mesothelin monoclonal antibodies
- SSIP immunotoxin and MORAb-009 (also known as amatuximab), which are currently being evaluated in clinical trials for mesothelioma and other cancers
- MORAb-009 also known as amatuximab
- SSIP is a recombinant immunotoxin consisting of a murine anti-mesothelin Fv fused to a truncated Pseudomonas exotoxin that mediates cell killing (Pastan and Hassan, Nat Rev Cancer 6:559-565, 2006).
- MORAb-009 a chimeric (mouse/human) antibody based on the murine SSI Fv, elicits antibody-dependent cell-mediated cytotoxicity (ADCC) on mesothelin-bearing tumor cells (Hassan et al., Cancer Immun 7:20, 2007).
- NCI National Cancer Institute
- HN1 human Fv was isolated from a phage display library and a fully human IgG was generated.
- An HN1 immunotoxin was also generated by fusing the HN1 Fv to a truncated Pseudomonas exotoxin A (PE38) (Ho et al , Int J Cancer 128:2020-2030, 2011).
- HN1 IgG binds to cell surface-associated mesothelin and kills cancer cells with very strong ADCC.
- the HN1 human antibody recognizes a conformational epitope overlapping the SSI site in mesothelin, indicating that HN1 can be developed as a fully human version of SSI -based mAbs (such as MORAb-009).
- SSI -based mAbs such as MORAb-009
- CDC is an important mechanism of cell killing for therapeutic antibodies (Weiner et al. , Nat Rev Immunol 10:317-327, 2010).
- the first approved mAb for cancer therapy, rituximab is partially dependent on CDC for its anti-tumor activity.
- its antitumor activity was completely abolished in Clq-deficient mice (Di Gaetano et al , J Immunol 171 : 1581-1587, 2003).
- Depletion of complement also decreased its activity in a xenograft model of B cell lymphoma (Cragg and Glennie, Blood 103:2738-2743, 2004).
- CDC may occur when the antibody binding site is close to the cell membrane (Pawluczkowycz et al. , J Immunol 183:749-758, 2009).
- ofatumumab which binds much closer to the cell membrane than rituximab, also has much higher CDC activity (Pawluczkowycz et al. , J Immunol 183:749-758, 2009).
- SDl and SD2 mesothelin-specific, human single-domain antibodies
- the SDl antibody binds a conformational epitope at the C-terminal end of human mesothelin and exhibits strong CDC activity, as well as ADCC, against mesothelin- expressing tumor cells.
- SD2 is specific for full-length human mesothelin, but does not bind a C- terminal mesothelin peptide of mesothelin.
- monoclonal antibodies comprising one or more (such as all three) CDRs of SDl or SD2.
- the antibodies provided herein include immunoglobulin molecules, such as IgG antibodies, as well as antibody fragments and single-domain (VH) antibodies.
- compositions including the antibodies that bind, for example specifically bind, to mesothelin, nucleic acid molecules encoding these antibodies, expression vectors comprising the nucleic acid molecules, and isolated host cells that express the nucleic acid molecules.
- immunoconjugates comprising the antibodies disclosed herein and an effector molecule, such as a toxin. Fusion proteins comprising the antibodies are also provided, such as fusion proteins comprising human Fc.
- the antibodies and compositions provided herein can be used for a variety of purposes, such as for confirming the diagnosis of a cancer that expresses mesothelin, for example
- a method of confirming the diagnosis of cancer in a subject by contacting a sample from the subject diagnosed with cancer with a monoclonal antibody that binds mesothelin, and detecting binding of the antibody to the sample.
- a monoclonal antibody that binds mesothelin An increase in binding of the antibody to the sample relative to binding of the antibody to a control sample confirms the cancer diagnosis.
- the method further includes contacting a second antibody that specifically recognizes the mesothelin-specific antibody with the sample, and detecting binding of the second antibody.
- a method of detecting a cancer that expresses mesothelin in a subject includes contacting a sample from the subject with a monoclonal antibody described herein, and detecting binding of the antibody to the sample. An increase in binding of the antibody to the sample relative to a control sample detects cancer in the subject.
- the methods further comprise contacting a second antibody that specifically recognizes the mesothelin-specific antibody with the sample, and detecting binding of the second antibody.
- a method of treating a subject having a mesothelin-expressing cancer for example mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma breast cancer (such as triple negative breast cancer) or ovarian cancer, by selecting a subject having a cancer that expresses mesothelin and administering to the subject a therapeutically effective amount of a monoclonal antibody specific for mesothelin, or an immunoconjugate, fusion protein or composition comprising the antibody.
- a monoclonal antibody specific for mesothelin or an immunoconjugate, fusion protein or composition comprising the antibody.
- Also provided is a method for inhibiting tumor growth or metastasis of a mesothelin- expressing cancer in a subject by selecting a subject having a cancer that expresses mesothelin and administering to the subject a therapeutically effective amount of an antibody, immunoconjugate, fusion protein or composition disclosed herein.
- FIGS. 1A-1D Generation of a human single-domain antibody to the C-terminal end of mesothelin.
- FIG. 1A Design of the peptide used for screening human antibodies by phage display technology. Three functional regions in membrane-bound mesothelin are proposed: Region I: 296-390; Region II: 391-486; Region III: 487-598 (of SEQ ID NO: 9). The three predicted N- linked glycans (Asn388, Asn488, and Asn515) on cell-surface mesothelin are indicated.
- the peptide used in the present study contains 50 residues at the C-terminal end of mesothelin (residues 539-588 of SEQ ID NO: 9).
- FIG. IB An engineered human antibody domain (VH) phage display library was used for four rounds of phage panning on the C-terminal mesothelin peptide (residues 539-588).
- FIG. 1C Monoclonal phage ELISA experiments were performed at the end of the fourth round of panning. The SD1 phage clone (Clone 1) was selected for further analysis because it bound both full-length mesothelin and the C-terminal peptide with strong signals.
- FIG. IB An engineered human antibody domain (VH) phage display library was used for four rounds of phage panning on the C-terminal mesothelin peptide (residues 539-588).
- FIG. 1C Monoclonal phage
- FIGS. 2A-2B Production and analysis of the SD1 human Fc fusion protein. (FIG. 2A)
- FIG. 2B Immunoprecipitation of endogenous mesothelin protein in A431/H9 (forced expression of mesothelin in epidermoid carcinoma A431 cell line) (Ho et al. , Clin Cancer Res
- NCI-H226 mesothelioma
- KMBC cholangiocarcinoma
- SD1 was used to immunoprecipitate endogenous mesothelin protein in the cell lysate.
- C an irrelevant VH single-domain human Fc fusion
- IP immunoprecipitation
- Input western blot on whole cell ly sates before immunoprecipitation.
- FIGS. 3A-3D Binding properties of SDl-hFc.
- FIGS. 3A-3D Binding properties of SDl-hFc.
- FIGS. 3A-3D Binding properties of SDl-hFc.
- FIGS. 3A-3D Binding properties of SDl-hFc.
- FIGS. 3A-3D Binding properties of SDl-hFc.
- FIG. 3A Direct ELISA.
- MSLN human mesothelin protein
- peptide but not mouse mesothelin
- FIG. 3B Competition ELISA.
- FIG. 3C The dissociation equilibrium KD of SDl-hFc to the human mesothelin protein was 13.58 nM and (FIG. 3D) 16.08 nM for the peptide.
- FIG. 4 Flow cytometry analysis of the SDl-hFc protein on mesothelin-expressing and control cancer cells.
- SDl-hFc bound the stable mesothelin cDNA transfected A431/H9 cell line and not the A431 cell line.
- the antibody also bound three out of four human cancer cell lines tested in the present study.
- OVCAR8 ovarian cancer
- NCI-H226 mesothelioma
- EKVX and L55
- NSCLC NSCLC
- KMBC Mz-ChA-1 and HuCCTl : cholangiocarcinoma.
- FIGS. 5A-5H SDl-hFc caused CDC and ADCC against mesothelin-expressing cancer cells.
- FIGS. 5 A, 5B CDC assays. A431/H9 (FIG. 5A) and NCI-H226 (FIG. 5B) cells were incubated with increasing concentrations of SDl-hFc in the presence of normal human serum
- Purified human NK cells were incubated with target cells A431/H9 (FIG. 5G) or NCI-H226 (FIG. 5H) at different E:T ratios with 50 ⁇ of SDl-hFc. CDC and
- ADCC activity were determined by LDH assay (*: p ⁇ 0.05).
- FIGS. 6A-6D Strong anti-tumor effect of SDl-hFc on tumor growth.
- A431/H9 cells were inoculated in the flank of nude mice to establish tumors of approximately 70 mm 3 in size. From day 7, mice were treated with SDl-hFc (50 mg/kg) or PBS every other day.
- FIG. 6B A431/H9 cells were incubated with 100 ⁇ g/mL of SDl-hFc in the presence of normal mouse serum (30% vol/vol) as a source of mouse complement. CDC activity was measured by LDH assay (*: p ⁇ 0.05).
- FIG. 6C A431/H9 cells were incubated with 100 ⁇ g/mL of SDl-hFc in the presence of purified mouse NK cells as a source of mouse effector cells. Mouse ADCC activity was measured by LDH assay (*: p ⁇ 0.05).
- FIGS. 7A-7B Production and analysis of the SDl-based recombinant immunotoxin.
- FIG. 7A SDS-PAGE analysis of purified SD1-PE38 (4 ⁇ g of protein per lane) under non-reducing condition. The purity of SD1-PE38 was greater than 95%. IT: immunotoxin.
- FIG. 7B WST-8 assays on A431/H9, A431 , NCI-H226, and KMBC cells treated with the SD1-PE38 immunotoxin.
- nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand.
- sequence Listing is submitted as an ASCII text file, created on September 11, 2013, 26.7 KB, which is incorporated by reference herein. In the accompanying sequence listing:
- SEQ ID NO: 1 is the nucleotide sequence of the SD1 single-domain antibody.
- SEQ ID NO: 2 is the amino acid sequence of the SD1 single-domain antibody.
- SEQ ID NO: 3 is the amino acid sequence of Pseudomonas exotoxin (PE).
- SEQ ID NO: 4 is the amino acid sequence of PE38.
- SEQ ID NO: 5 is the amino acid sequence of PE-LR.
- SEQ ID NO: 6 is the amino acid sequence of PE-LR/6X.
- SEQ ID NO: 7 is the amino acid sequence of PE with reduced immunogenicity.
- SEQ ID NO: 8 is the amino acid sequence of PE-LR/8M.
- SEQ ID NO: 9 is the amino acid sequence of human mesothelin.
- SEQ ID Nos: 10-13 are primer sequences.
- SEQ ID NO: 14 is the nucleotide sequence of the SD2 single-domain antibody.
- SEQ ID NO: 15 is the amino acid sequence of the SD2 single-domain antibody.
- Antibody A polypeptide ligand comprising at least a light chain or heavy chain immunoglobulin variable region which recognizes and binds (such as specifically recognizes and specifically binds) an epitope of an antigen, such as mesothelin, or a fragment thereof.
- Immunoglobulin molecules are composed of a heavy and a light chain, each of which has a variable region, termed the variable heavy (VH) region and the variable light (VL) region. Together, the VH region and the VL region are responsible for binding the antigen recognized by the antibody.
- VH variable heavy
- VL variable light
- Antibodies include intact immunoglobulins and the variants and portions of antibodies well known in the art, such as single-domain antibodies ⁇ e.g. VH domain antibodies), Fab fragments, Fab' fragments, F(ab)' 2 fragments, single chain Fv proteins ("scFv”), and disulfide stabilized Fv proteins ("dsFv”).
- a scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains.
- antibody also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies) and heteroconjugate antibodies (such as bispecific antibodies). See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, IL); Kuby, J., Immunology, 3 rd Ed., W. H. Freeman & Co., New York, 1997.
- a naturally occurring immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds.
- H heavy chain
- L light chain
- ⁇ lambda
- ⁇ kappa
- IgM immunoglobulin heavy chain classes
- Each heavy and light chain contains a constant region and a variable region, (the regions are also known as “domains”).
- the heavy and the light chain variable regions specifically bind the antigen.
- Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called “complementarity-determining regions” or "CDRs.”
- CDRs complementarity-determining regions
- the extent of the framework region and CDRs has been defined according to Kabat et al. (see, Kabat et al. , Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991) and the ImMunoGeneTics database (IMGT) (see, Lefranc, Nucleic Acids Res 29:207-9, 2001).
- the IMGT and Kabat databases are available online.
- the sequences of the framework regions of different light or heavy chains are relatively conserved within a species, such as humans.
- the framework region of an antibody that is the combined framework regions of the constituent light and
- the CDRs are primarily responsible for binding to an epitope of an antigen.
- the CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are often identified by the chain in which the particular CDR is located.
- a VH CDR3 (or H-CDR3) is located in the variable domain of the heavy chain of the antibody in which it is found
- a VL CDRl (or L-CDR1) is the CDR1 from the variable domain of the light chain of the antibody in which it is found.
- An antibody that binds mesothelin, for example, will have a specific VH region and the VL region sequence, and thus specific CDR sequences.
- Antibodies with different specificities have different CDRs. Although it is the CDRs that vary from antibody to antibody, only a limited number of amino acid positions within the CDRs are directly involved in antigen binding. These positions within the CDRs are called specificity determining residues (SDRs).
- SDRs specificity determining residues
- References to "VH” or “VH” refer to the variable region of an immunoglobulin heavy chain, including that of an Fv, scFv, dsFv or Fab.
- References to "VL” or “VL” refer to the variable region of an immunoglobulin light chain, including that of an Fv, scFv, dsFv or Fab.
- a “monoclonal antibody” is an antibody produced by a single clone of B -lymphocytes or by a cell into which the light and/or heavy chain genes of a single antibody have been transfected.
- Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells.
- Monoclonal antibodies include humanized monoclonal antibodies.
- a “chimeric antibody” contains structural elements from two or more different antibody molecules, often from different animal species.
- a chimeric antibody can have framework residues from one species, such as human, and CDRs (which generally confer antigen binding) from another species, such as a murine antibody that specifically binds mesothelin.
- a “human” antibody (also called a “fully human” antibody) is an antibody that includes human framework regions and all of the CDRs from a human immunoglobulin.
- the framework and the CDRs are from the same originating human heavy and/or light chain amino acid sequence.
- frameworks from one human antibody can be engineered to include CDRs from a different human antibody.
- a “humanized” immunoglobulin is an immunoglobulin including a human framework region and one or more CDRs from a non-human (for example a mouse, rabbit, rat, or synthetic) immunoglobulin.
- the non-human immunoglobulin providing the CDRs is termed a "donor,” and the human immunoglobulin providing the framework is termed an "acceptor.”
- all the CDRs are from the donor immunoglobulin in a humanized immunoglobulin. Constant regions need not be present, but if they are, they must be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, such as about 95% or more identical.
- all parts of a humanized immunoglobulin, except possibly the CDRs are substantially identical to corresponding parts of natural human immunoglobulin sequences.
- a "humanized antibody” is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin.
- a humanized antibody binds to the same antigen as the donor antibody that provides the CDRs.
- the acceptor framework of a humanized immunoglobulin or antibody may have a limited number of substitutions by amino acids taken from the donor framework.
- Humanized or other monoclonal antibodies can have additional conservative amino acid substitutions which have substantially no effect on antigen binding or other immunoglobulin functions.
- Humanized immunoglobulins can be constructed by means of genetic engineering (see for example, U.S. Patent No. 5,585,089).
- Binding affinity Affinity of an antibody for an antigen.
- affinity is calculated by a modification of the Scatchard method described by Frankel et al. (Mol. Immunol. , 16: 101-106, 1979).
- binding affinity is measured by an antigen/antibody dissociation rate.
- a high binding affinity is measured by a competition radioimmunoassay.
- binding affinity is measured by ELISA.
- An antibody that "specifically binds" an antigen is an antibody that binds the antigen with high affinity and does not significantly bind other unrelated antigens.
- Breast cancer A type of cancer that forms in tissues of the breast, usually the ducts (tubes that carry milk to the nipple) and lobules (glands that make milk).
- Triple negative breast cancer refers to a type of breast cancer in which the cancer cells do not express estrogen receptors, progesterone receptors or significant levels of HER2/neu protein.
- Triple negative breast cancer is also called ER-negative PR-negative HER2/neu-negative breast cancer.
- Chemotherapeutic agent Any chemical agent with therapeutic usefulness in the treatment of diseases characterized by abnormal cell growth. Such diseases include tumors, neoplasms, and cancer as well as diseases characterized by hyperplastic growth such as psoriasis.
- a chemotherapeutic agent is an agent of use in treating mesothelioma or another tumor, such as stomach cancer, squamous cell carcinomas, prostate cancer, pancreatic cancer, lung cancer, cholangiocarcinoma breast cancer (such as triple negative breast cancer) or ovarian cancer.
- a chemotherapeutic agent is a radioactive compound.
- chemotherapy is the administration of more than one agent to treat cancer.
- One example is the administration of an antibody (or immunoconjugate) that binds mesothelin used in combination with a radioactive or chemical compound.
- Cholangiocarcinoma A type of cancer that develops in cells that line the bile ducts in the liver.
- Constant amino acid substitutions are those substitutions that do not substantially affect or decrease the affinity of a protein, such as an antibody to mesothelin.
- a monoclonal antibody that specifically binds mesothelin can include at most about 1 , at most about 2, at most about 5, at most about 10, or at most about 15 conservative substitutions and specifically bind a mesothelin polypeptide.
- the term "conservative variant” also includes the use of a substituted amino acid in place of an unsubstituted parent amino acid, provided that antibody specifically binds mesothelin. Non-conservative substitutions are those that reduce an activity or binding to mesothelin.
- Complementarity determining region Amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native Ig binding site.
- the light and heavy chains of an Ig each have three CDRs, designated L-CDRl, L-CDR2, L-CDR3 and H-CDR1, H-CDR2, H-CDR3, respectively.
- Placement in direct physical association includes both in solid and liquid form.
- Cytotoxicity The toxicity of a molecule, such as an immunotoxin, to the cells intended to be targeted, as opposed to the cells of the rest of an organism.
- toxicity refers to toxicity of an immunotoxin to cells other than those that are the cells intended to be targeted by the targeting moiety of the immunotoxin
- animal toxicity refers to toxicity of the immunotoxin to an animal by toxicity of the immunotoxin to cells other than those intended to be targeted by the immunotoxin.
- Degenerate variant refers to a polynucleotide encoding a mesothelin polypeptide or an antibody that binds mesothelin that includes a sequence that is degenerate as a result of the genetic code. There are 20 natural amino acids, most of which are specified by more than one codon. Therefore, all degenerate nucleotide sequences are included as long as the amino acid sequence of the mesothelin polypeptide or antibody that binds mesothelin encoded by the nucleotide sequence is unchanged.
- Diagnostic Identifying the presence or nature of a pathologic condition, such as, but not limited to, cancer. Diagnostic methods differ in their sensitivity and specificity.
- the "sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of true positives).
- the "specificity” of a diagnostic assay is one minus the false positive rate, where the false positive rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis.
- “Prognostic” is the probability of development (e.g., severity) of a pathologic condition, such as cancer or metastasis.
- Effector molecule The portion of a chimeric molecule that is intended to have a desired effect on a cell to which the chimeric molecule is targeted. Effector molecule is also known as an effector moiety (EM), therapeutic agent, or diagnostic agent, or similar terms.
- EM effector moiety
- Therapeutic agents include such compounds as nucleic acids, proteins, peptides, amino acids or derivatives, glycoproteins, radioisotopes, lipids, carbohydrates, or recombinant viruses.
- Nucleic acid therapeutic and diagnostic moieties include antisense nucleic acids, derivatized oligonucleotides for covalent cross-linking with single or duplex DNA, and triplex forming oligonucleotides.
- the molecule linked to a targeting moiety may be an encapsulation system, such as a liposome or micelle that contains a therapeutic composition such as a drug, a nucleic acid (such as an antisense nucleic acid), or another therapeutic moiety that can be shielded from direct exposure to the circulatory system.
- a targeting moiety such as an anti- mesothelin antibody
- an encapsulation system such as a liposome or micelle that contains a therapeutic composition such as a drug, a nucleic acid (such as an antisense nucleic acid), or another therapeutic moiety that can be shielded from direct exposure to the circulatory system.
- Diagnostic agents or moieties include radioisotopes and other detectable labels. Detectable labels useful for such purposes are also well known in the art, and include radioactive isotopes such as 35 S, n C, 13 N, 15 0, 18 F, 19 F, 99m Tc, 131 1, 3 H, 14 C, 15 N, 90 Y, 99 Tc, m In and 125 I, fluorophores, chemiluminescent agents, and enzymes.
- Epitope An antigenic determinant. These are particular chemical groups or peptide sequences on a molecule that are antigenic, i.e. that elicit a specific immune response. An antibody specifically binds a particular antigenic epitope on a polypeptide, such as mesothelin.
- Framework region Amino acid sequences interposed between CDRs. Framework regions include variable light and variable heavy framework regions. The framework regions serve to hold the CDRs in an appropriate orientation for antigen binding.
- Host cells Cells in which a vector can be propagated and its DNA expressed.
- the cell may be prokaryotic or eukaryotic.
- the term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. However, such progeny are included when the term "host cell" is used.
- Hybridoma A hybrid cell for the production of monoclonal antibodies.
- a hybridoma is produced by fusion of an antibody-producing cell (such as a B cell obtained from an immunized animal, for example a mouse, rat or rabbit) and a myeloma cell.
- Immune response A response of a cell of the immune system, such as a B cell, T cell, or monocyte, to a stimulus.
- the response is specific for a particular antigen (an "antigen-specific response").
- an immune response is a T cell response, such as a CD4 + response or a CD8 + response.
- the response is a B cell response, and results in the production of specific antibodies.
- Immunoconjugate A covalent linkage of an effector molecule to an antibody or functional fragment thereof.
- the effector molecule can be a detectable label or an immunotoxin.
- toxins include, but are not limited to, abrin, ricin, Pseudomonas exotoxin (PE, such as PE35, PE37, PE38, and PE40), diphtheria toxin (DT), botulinum toxin, or modified toxins thereof, or other toxic agents that directly or indirectly inhibit cell growth or kill cells.
- PE and DT are highly toxic compounds that typically bring about death through liver toxicity. PE and DT, however, can be modified into a form for use as an immunotoxin.
- PE Pseudomonas exotoxin
- DT diphtheria toxin
- botulinum toxin or modified toxins thereof, or other toxic agents that directly or indirectly inhibit cell growth or kill cells.
- PE and DT are highly toxic compounds that typically bring about death through liver toxicity
- a "chimeric molecule” is a targeting moiety, such as a ligand or an antibody, conjugated (coupled) to an effector molecule.
- conjugated or “linked” refers to making two polypeptides into one contiguous polypeptide molecule.
- an antibody is joined to an effector molecule.
- an antibody joined to an effector molecule is further joined to a lipid or other molecule to a protein or peptide to increase its half-life in the body.
- the linkage can be either by chemical or recombinant means.
- the linkage is chemical, wherein a reaction between the antibody moiety and the effector molecule has produced a covalent bond formed between the two molecules to form one molecule.
- a peptide linker (short peptide sequence) can optionally be included between the antibody and the effector molecule.
- immunoconjugates were originally prepared from two molecules with separate functionalities, such as an antibody and an effector molecule, they are also sometimes referred to as "chimeric molecules.”
- Isolated An "isolated" biological component, such as a nucleic acid, protein (including antibodies) or organelle, has been substantially separated or purified away from other biological components in the environment (such as a cell) in which the component naturally occurs, i.e., other chromosomal and extra-chromosomal DNA and RNA, proteins and organelles.
- Nucleic acids and proteins that have been “isolated” include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.
- Label A detectable compound or composition that is conjugated directly or indirectly to another molecule, such as an antibody or a protein, to facilitate detection of that molecule.
- labels include fluorescent tags, enzymatic linkages, and radioactive isotopes.
- a "labeled antibody” refers to incorporation of another molecule in the antibody.
- the label is a detectable marker, such as the incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods).
- marked avidin for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods.
- Various methods of labeling polypeptides and glycoproteins are known in the art and may be used.
- labels for polypeptides include, but are not limited to, the following: radioisotopes or radionucleotides (such as 5 S, n C, 13 N, 15 0, 18 F, 19 F, 99m Tc, 131 1, 3 H, 14 C, 15 N, 90 Y, 99 Tc, m In and 125 I), fluorescent labels (such as fluorescein isothiocyanate (FITC), rhodamine, lanthanide phosphors), enzymatic labels (such as horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase),
- radioisotopes or radionucleotides such as 5 S, n C, 13 N, 15 0, 18 F, 19 F, 99m Tc, 131 1, 3 H, 14 C, 15 N, 90 Y, 99 Tc, m In and 125 I
- fluorescent labels such as fluorescein isothiocyanate (FITC), rh
- chemiluminescent markers biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (such as a leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags), or magnetic agents, such as gadolinium chelates.
- labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
- Linker In some cases, a linker is a peptide within an antibody binding fragment (such as an Fv fragment) which serves to indirectly bond the variable heavy chain to the variable light chain. "Linker” can also refer to a peptide serving to link a targeting moiety, such as an antibody, to an effector molecule, such as a cytotoxin or a detectable label.
- polypeptides into one contiguous polypeptide molecule, or to covalently attaching a radionuclide or other molecule to a polypeptide, such as an scFv.
- the terms include reference to joining a ligand, such as an antibody moiety, to an effector molecule.
- the linkage can be either by chemical or recombinant means.
- “Chemical means” refers to a reaction between the antibody moiety and the effector molecule such that there is a covalent bond formed between the two molecules to form one molecule.
- Lung cancer Cancer that forms in tissues of the lung, usually in the cells lining air passages.
- the two main types are small cell lung cancer and non-small cell lung cancer (NSCLC). These types are diagnosed based on how the cells look under a microscope.
- Mammal This term includes both human and non-human mammals. Similarly, the term “subject” includes both human and veterinary subjects.
- the human mesothelin protein is synthesized as a 70 kD precursor which is then proteolytically processed.
- the 30 kD amino terminus of mesothelin is secreted and is referred to as megakaryocyte potentiating factor (Yamaguchi et al , J. Biol. Chem. 269:805 808, 1994).
- the 40 kD carboxyl terminus remains bound to the membrane as mature mesothelin (Chang et ah, Natl. Acad. Sci. USA 93: 136 140, 1996).
- Exemplary nucleic acid and amino acid sequences of mesothelin are as described in PCT Publication No. WO 97/25,068; U.S.
- Mesothelioma A type of neoplasm derived from the lining cells of the pleura and peritoneum which grows as a thick sheet covering the viscera, and is composed of spindle cells or fibrous tissue which may enclose gland-like spaces lined by cuboidal cells. Mesotheliomas often originate in the tissue lining the lung, heart or abdomen. In some cases, mesotheliomas are caused by exposure to asbestos.
- MORAb-009 A chimeric (mouse/human) monoclonal IgG/ ⁇ with high affinity and specificity for mesothelin.
- the VH and VL regions of mouse anti-mesothelin scFv were obtained by panning a phage display library made from splenic mRNA of a mouse immunized with mesothelin cDNA on mesothelin-positive cells.
- the VH and VL regions were grafted in frame with human IgGl and kappa constant regions (Hassan and Ho, Eur J Cancer 44(l):46-53, 2008).
- Neoplasia malignancy, cancer or tumor: A neoplasm is an abnormal growth of tissue or cells that results from excessive cell division. Neoplastic growth can produce a tumor. The amount of a tumor in an individual is the "tumor burden" which can be measured as the number, volume, or weight of the tumor. A tumor that does not metastasize is referred to as "benign.” A tumor that invades the surrounding tissue and/or can metastasize is referred to as "malignant.” Examples of hematological tumors include leukemias, including acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblastic,
- chronic leukemias such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia
- polycythemia vera lymphoma
- Hodgkin's disease non-Hodgkin's lymphoma (indolent and high grade forms)
- multiple myeloma Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
- solid tumors such as sarcomas and carcinomas
- solid tumors include fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, and other sarcomas, synovioma, mesothelioma, cholangiocarcinoma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, lymphoid malignancy, pancreatic cancer, breast cancer, lung cancers, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, papillary thyroid carcinoma, pheochromocytomas sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma,
- oligodendroglioma menangioma, melanoma, neuroblastoma and retinoblastoma.
- the caner is mesothelioma, stomach cancer, squamous cell carcinomas, prostate cancer, pancreatic cancer, lung cancer, cholangiocarcinoma, breast cancer or ovarian cancer.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter such as the CMV promoter
- operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
- Ovarian cancer Cancer that forms in tissues of the ovary (one of a pair of female reproductive glands in which the ova, or eggs, are formed). Most ovarian cancers are either ovarian epithelial carcinomas (cancer that begins in the cells on the surface of the ovary) or malignant germ cell tumors (cancer that begins in egg cells).
- Pancreatic cancer A disease in which malignant (cancer) cells are found in the tissues of the pancreas. Also called exocrine cancer.
- Pharmaceutical agent A chemical compound or composition capable of inducing a desired therapeutic or prophylactic effect when properly administered to a subject or a cell.
- compositions and formulations suitable for pharmaceutically acceptable carriers are conventional. Remington's Pharmaceutical Sciences, by E.W. Martin, Mack Publishing Co., Easton, PA, 15th Edition, 1975, describes compositions and formulations suitable for
- parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
- pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
- physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like
- solid compositions such as powder, pill, tablet, or capsule forms
- conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate.
- compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- non-toxic auxiliary substances such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- Preventing a disease refers to inhibiting the full development of a disease.
- Treating refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop, such as a reduction in tumor burden or a decrease in the number of size of metastases.
- “Ameliorating” refers to the reduction in the number or severity of signs or symptoms of a disease, such as cancer.
- Prostate cancer Cancer that forms in tissues of the prostate (a gland in the male reproductive system found below the bladder and in front of the rectum). Prostate cancer usually occurs in older men.
- a purified peptide preparation is one in which the peptide or protein is more enriched than the peptide or protein is in its natural environment within a cell.
- a preparation is purified such that the protein or peptide represents at least 50% of the total peptide or protein content of the preparation.
- Substantial purification denotes purification from other proteins or cellular components.
- a substantially purified protein is at least 60%, 70%, 80%, 90%, 95% or 98% pure.
- a substantially purified protein is 90% free of other proteins or cellular components.
- a recombinant nucleic acid is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or by the artificial manipulation of isolated segments of nucleic acids, for example, by genetic engineering techniques.
- Recombinant toxins Chimeric proteins in which a cell targeting moiety is fused to a toxin (Pastan et al. , Science, 254: 1173-1177, 1991). If the cell targeting moiety is the Fv portion of an antibody, the molecule is termed a recombinant immunotoxin (Chaudhary et al. , Nature, 339:394- 397, 1989). The toxin moiety is genetically altered so that it cannot bind to the toxin receptor present on most normal cells. Recombinant immunotoxins selectively kill cells which are recognized by the antigen binding domain. These recombinant toxins and immunotoxins can be used to treat cancer, for example, a cancer in which mesothelin is expressed.
- Sample A biological specimen containing genomic DNA, RNA (including mRNA), protein, or combinations thereof, obtained from a subject. Examples include, but are not limited to, peripheral blood, tissue, cells, urine, saliva, tissue biopsy, fine needle aspirate, surgical specimen, and autopsy material.
- a sample includes a tumor biopsy, such as a tumor biopsy.
- Sequence identity The similarity between amino acid or nucleic acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a polypeptide or nucleic acid molecule will possess a relatively high degree of sequence identity when aligned using standard methods.
- BLAST Basic Local Alignment Search Tool
- NCBI National Center for Biotechnology Information
- blastp blastn
- blastx blastx
- tblastn tblastx
- Homologs and variants of a VL or a VH of an antibody that specifically binds mesothelin or a fragment thereof are typically characterized by possession of at least about 75%, for example at least about 80%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of the antibody using the NCBI Blast 2.0, gapped blastp set to default parameters.
- the Blast 2 sequences function is employed using the default BLOSUM62 matrix set to default parameters, (gap existence cost of 11, and a per residue gap cost of 1).
- the alignment should be performed using the Blast 2 sequences function, employing the PAM30 matrix set to default parameters (open gap 9, extension gap 1 penalties). Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence.
- Squamous cell carcinoma A malignant neoplasm derived from stratified squamous epithelium, but which may also occur in sites such as bronchial mucosa where glandular or columnar epithelium is normally present. Squamous cell carcinoma is the most common type of skin cancer.
- SS1P A recombinant immunotoxin consisting of an anti-mesothelin Fv (the same Fv as MORAb-009) linked to a truncated Pseudomonas exotoxin that mediates cell killing (Chowdhury and Pastan, Nat Biotechnol 17:568-572, 1999; Pastan et al, Nat Rev Cancer 6:559-565, 2006).
- SS1P also known as CAT-5001
- CAT-5001 is cytotoxic to cell lines expressing mesothelin, causes complete regression of mesothelin expressing tumor xenografts in nude mice, and is cytotoxic to cells obtained from human cancer patients (Hassan et al. , Clin Cancer Res 10:3937-3942, 2001 ; Hassan et al, Clin Cancer Res 8:3520-3526, 2002).
- Stomach cancer Cancer that forms in tissues lining the stomach. Also called gastric cancer.
- Subject Living multi-cellular vertebrate organisms, a category that includes both human and veterinary subjects, including human and non-human mammals.
- Therapeutically effective amount A quantity of a specific substance sufficient to achieve a desired effect in a subject being treated. For instance, this can be the amount necessary to inhibit or suppress growth of a tumor. In one embodiment, a therapeutically effective amount is the amount necessary to eliminate, reduce the size, or prevent metastasis of a tumor. When administered to a subject, a dosage will generally be used that will achieve target tissue concentrations (for example, in tumors) that has been shown to achieve a desired in vitro effect.
- Toxin A molecule that is cytotoxic for a cell.
- Toxins include abrin, ricin, Pseudomonas exotoxin (PE), diphtheria toxin (DT), botulinum toxin, saporin, restrictocin or gelonin, or modified toxins thereof.
- PE and DT are highly toxic compounds that typically bring about death through liver toxicity.
- PE and DT can be modified into a form for use as an immunotoxin by removing the native targeting component of the toxin (such as domain la of PE or the B chain of DT) and replacing it with a different targeting moiety, such as an antibody.
- a nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell.
- a vector may include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication.
- a vector may also include one or more selectable marker genes and other genetic elements known in the art.
- Monoclonal antibodies against mesothelin are currently being evaluated for the treatment of mesothelioma and multiple other forms of cancer, and show great promise for clinical development for solid cancers.
- Antibodies against mesothelin have been shown to act via immunotoxin-based inhibition of tumor growth and induction of antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- CDC complement-dependent cytotoxicity
- phage display antibody engineering technology and synthetic peptide screening to identify SD1 , a human single-domain antibody to mesothelin.
- SD1 recognizes a conformational epitope at the C-terminal end (residues 539-588 of SEQ ID NO: 9) of mesothelin close to the cell surface. Also identified was SD2, a single-domain antibody that recognizes full-length mesothelin.
- SD1 as a potential therapeutic agent, a recombinant human Fc (SDl-hFc) fusion protein was generated.
- the SDl-hFc protein exhibits strong CDC activity, in addition to ADCC, against mesothelin-expressing tumor cells.
- SD1 is the first human single-domain antibody targeting mesothelin-expressing tumors. The results disclosed herein demonstrate that SD1 can be used as a therapeutic agent for cancer and exhibits significant advantages over current antibody therapy targeting mesothelin- expressing tumors.
- SD1 and SD2 human single-domain antibodies specific for mesothelin.
- SD1 recognizes a conformational epitope at the C-terminal end of mesothelin.
- SD1 When fused to human Fc, SD1 elicits strong CDC and ADCC against mesothelin-expressing tumor cells.
- SDl-hFc significantly inhibits tumor growth in vivo in a mouse xenograft model of mesothelin-expressing cancer.
- SD2 recognizes full-length mesothelin, but does not bind a C-terminal fragment of mesothelin.
- the nucleotide and amino acid sequences of SD1 and SD2 are shown below.
- SD1 nucleotide sequence SEQ ID NO: 1:
- the VH domain of the antibody comprises at least a portion of the amino acid sequence set forth herein as SEQ ID NO: 2 or SEQ ID NO: 15, such as one or more (such as all three) CDR sequences from SEQ ID NO: 2 or SEQ ID NO: 15 as determined by IMGT.
- the antibodies comprise one or more (such as all three) CDR sequences from SEQ ID NO: 2 or SEQ ID NO: 15, as determined using the Kabat method.
- the VH domain of the antibody comprises amino acid residues 26-
- the VH domain of the antibody comprises amino acid residues 31-35, 51-66 and 99-102 of SEQ ID NO: 2.
- the VH domain of the antibody is at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 2.
- the amino acid sequence of the VH domain of the antibody comprises or consists of SEQ ID NO: 2.
- the VH domain of the antibody comprises amino acid residues 26- 33, 51-57 and 96-111 of SEQ ID NO: 15. In other embodiments, the VH domain of the antibody comprises amino acid residues 31-35, 50-65 and 99-106 of SEQ ID NO: 15. In some examples, the VH domain of the antibody is at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 15. In particular examples, the amino acid sequence of the VH domain of the antibody comprises or consists of SEQ ID NO: 15.
- the monoclonal antibody that binds, such as specifically binds, mesothelin is a single domain antibody.
- the monoclonal antibody that binds, such as specifically binds, mesothelin is a Fab fragment, a Fab' fragment, a F(ab)' 2 fragment, a single chain variable fragment (scFv), or a disulfide stabilized variable fragment (dsFv).
- the antibody is an immunoglobulin molecule.
- the antibody is an IgG.
- the monoclonal antibody is chimeric or synthetic.
- the disclosed antibodies bind mesothelin (soluble or cell-surface mesothelin) with a dissociation constant (Kd) of about 20 nM or less, such as about 18 nM or less,
- the monoclonal antibodies bind mesothelin with a binding affinity of about 20 nM, about 19 nM, about
- the monoclonal antibodies disclosed herein can be labeled, such as with a fluorescent, enzymatic, or radioactive label.
- Immunoconjugates comprising the monoclonal antibodies disclosed herein and an effector molecule are also provided.
- the effector molecule can be, for example, a toxin or a detectable label.
- the immunoconjugate comprises a VH domain disclosed herein (such as a VH domain comprising the CDR sequences of SD1 or SD2, or comprising the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 15), and a toxin, such as PE or a variant therefore, such as PE38.
- the immunoconjugate comprises the SD1 or SD2 VH fused to PE38.
- the toxin is PE38 comprising the amino acid sequence of SEQ ID NO: 4. Examples of immunoconjugates are discussed in greater detail in section VI below.
- fusion proteins comprising an antibody disclosed herein and a heterologous protein.
- the heterologous protein is an Fc protein.
- the Fc protein is a human Fc protein, such as human IgGyl Fc.
- compositions comprising a therapeutically effective amount of a disclosed antibody, immunoconjugate or fusion protein and a pharmaceutically acceptable carrier.
- nucleotide sequence encoding the VH domain of the monoclonal antibody comprises at least a portion of SEQ ID NO: 1 , such as the portion encoding one or more CDRs of the antibody.
- the VH domain of the monoclonal antibody is encoded by a sequence comprising SEQ ID NO: 1.
- nucleotide sequence encoding the VH domain of the monoclonal antibody comprises at least a portion of SEQ ID NO: 14, such as the portion encoding one or more CDRs of the antibody.
- the VH domain of the monoclonal antibody is encoded by a sequence comprising SEQ ID NO: 14.
- the isolated nucleic acid molecule is operably linked to a promoter.
- expression vectors comprising the isolated nucleic acid molecules disclosed herein.
- Isolated host cells comprising the nucleic acid molecules or vectors are also provided herein.
- the host cell is a T cell, such as a cytotoxic T lymphocyte (CTL).
- CTL cytotoxic T lymphocyte
- the monoclonal antibodies disclosed herein can be of any isotype.
- the monoclonal antibody can be, for example, an IgM or an IgG antibody, such as IgGior an IgG 2 .
- the class of antibody that specifically binds mesothelin can be switched with another (for example, IgG can be switched to IgM), according to well-known procedures. Class switching can also be used to convert one IgG subclass to another, such as from IgGi to IgG 2 .
- Antibody fragments are also encompassed by the present disclosure, such as single-domain antibodies (e.g. , VH domain antibodies), Fab, F(ab') 2 , and Fv. These antibody fragments retain the ability to selectively bind with the antigen. These fragments include:
- Fab the fragment which contains a monovalent antigen-binding fragment of an antibody molecule, can be produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain;
- Fab' the fragment of an antibody molecule can be obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule;
- Fv a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains
- Single chain antibody such as scFv
- scFv Single chain antibody
- a dimer of a single chain antibody (scFV 2 ), defined as a dimer of a scFV (also known as a "miniantibody”);
- VH single-domain antibody an antibody fragment consisting of a heavy chain variable domain.
- antibody fragments can be prepared by proteolytic hydrolysis of the antibody or by expression in a host cell (such as E. coli) of DNA encoding the fragment.
- Antibody fragments can be obtained by pepsin or papain digestion of whole antibodies by conventional methods.
- antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab') 2 .
- This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab' monovalent fragments.
- an enzymatic cleavage using pepsin produces two monovalent Fab' fragments and an Fc fragment directly (see U.S. Patent No. 4,036,945 and U.S. Patent No. 4,331,647).
- cleaving antibodies such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical, or genetic techniques may also be used, so long as the fragments bind to the antigen that is recognized by the intact antibody.
- conservative variants of the antibodies can be produced. Such conservative variants employed in antibody fragments, such as dsFv fragments or in scFv fragments, will retain critical amino acid residues necessary for correct folding and stabilizing between the V H and the V L regions, and will retain the charge characteristics of the residues in order to preserve the low pi and low toxicity of the molecules. Amino acid substitutions (such as at most one, at most two, at most three, at most four, or at most five amino acid substitutions) can be made in the V H and/or the V L regions to increase yield. Conservative amino acid substitution tables providing functionally similar amino acids are well known to one of ordinary skill in the art. The following six groups are examples of amino acids that are considered to be conservative substitutions for one another:
- Immunoconjugates include, but are not limited to, molecules in which there is a covalent linkage of a therapeutic agent to an antibody.
- a therapeutic agent is an agent with a particular biological activity directed against a particular target molecule or a cell bearing a target molecule.
- therapeutic agents can include various drugs such as vinblastine, daunomycin and the like, cytotoxins such as native or modified Pseudomonas exotoxin or Diphtheria toxin, encapsulating agents (such as liposomes) which themselves contain pharmacological compositions, radioactive agents such as 125 1, 32 P, 14 C, 3 H and 35 S and other labels, target moieties and ligands.
- the choice of a particular therapeutic agent depends on the particular target molecule or cell, and the desired biological effect.
- the therapeutic agent can be a cytotoxin that is used to bring about the death of a particular target cell (such as a tumor cell).
- the therapeutic agent can be conjugated to a non-lethal pharmacological agent or a liposome containing a non-lethal pharmacological agent.
- nucleic acids encoding antibodies and conjugates and fusion proteins thereof.
- Effector molecules can be linked to an antibody of interest using any number of means known to those of skill in the art. Both covalent and noncovalent attachment means may be used.
- the procedure for attaching an effector molecule to an antibody varies according to the chemical structure of the effector.
- Polypeptides typically contain a variety of functional groups; such as carboxylic acid (COOH), free amine (-NH 2 ) or sulfhydryl (-SH) groups, which are available for reaction with a suitable functional group on an antibody to result in the binding of the effector molecule.
- the antibody is derivatized to expose or attach additional reactive functional groups. The derivatization may involve attachment of any of a number of known linker molecules.
- the linker can be any molecule used to join the antibody to the effector molecule.
- the linker is capable of forming covalent bonds to both the antibody and to the effector molecule.
- Suitable linkers are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers.
- the linkers may be joined to the constituent amino acids through their side groups (such as through a disulfide linkage to cysteine) or to the alpha carbon amino and carboxyl groups of the terminal amino acids.
- immunoconjugates will comprise linkages that are cleavable in the vicinity of the target site.
- Cleavage of the linker to release the effector molecule from the antibody may be prompted by enzymatic activity or conditions to which the immunoconjugate is subjected either inside the target cell or in the vicinity of the target site.
- the antibodies or antibody fragments disclosed herein can be derivatized or linked to another molecule (such as another peptide or protein).
- another molecule such as another peptide or protein.
- the antibody or antibody fragment (such as a VH domain) is fused to a heterologous protein, for example an Fc protein.
- the antibodies or portion thereof is derivatized such that the binding to the target antigen is not affected adversely by the derivatization or labeling.
- the antibody can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (for example, a bispecific antibody or a diabody), a detection agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- One type of derivatized antibody is produced by cross-linking two or more antibodies (of the same type or of different types, such as to create bispecific antibodies).
- Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (such as m-maleimidobenzoyl-N-hydroxysuccinimide ester) or
- An antibody that binds (for example specifically binds) mesothelin or a fragment thereof can be labeled with a detectable moiety.
- useful detection agents include fluorescent compounds, including fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-l- napthalenesulfonyl chloride, phycoerythrin, lanthanide phosphors and the like.
- Bioluminescent markers are also of use, such as luciferase, Green fluorescent protein (GFP), Yellow fluorescent protein (YFP).
- An antibody can also be labeled with enzymes that are useful for detection, such as horseradish peroxidase, ⁇ - galactosidase, luciferase, alkaline phosphatase, glucose oxidase and the like.
- enzymes that are useful for detection
- an antibody When an antibody is labeled with a detectable enzyme, it can be detected by adding additional reagents that the enzyme uses to produce a reaction product that can be discerned. For example, when the agent horseradish peroxidase is present the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is visually detectable.
- An antibody may also be labeled with biotin, and detected through indirect measurement of avidin or streptavidin binding. It should be noted that the avidin itself can be labeled with an enzyme or a fluorescent label.
- An antibody may be labeled with a magnetic agent, such as gadolinium.
- Antibodies can also be labeled with lanthanides (such as europium and dysprosium), and manganese.
- Paramagnetic particles such as superparamagnetic iron oxide are also of use as labels.
- An antibody may also be labeled with a predetermined polypeptide epitopes recognized by a secondary reporter (such as leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags).
- labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
- An antibody can also be labeled with a radiolabeled amino acid.
- the radiolabel may be used for both diagnostic and therapeutic purposes.
- the radiolabel may be used to detect mesothelin by x-ray, emission spectra, or other diagnostic techniques.
- Examples of labels for polypeptides include, but are not limited to, the following radioisotopes or radionucleo tides: 3 H, 14 C, 15 N, 35 S, 90 Y, "Tc, m In, 125 I, m l.
- An antibody can also be derivatized with a chemical group such as polyethylene glycol (PEG), a methyl or ethyl group, or a carbohydrate group. These groups may be useful to improve the biological characteristics of the antibody, such as to increase serum half-life or to increase tissue binding.
- PEG polyethylene glycol
- methyl or ethyl group a methyl or ethyl group
- carbohydrate group a chemical group such as polyethylene glycol (PEG), a methyl or ethyl group, or a carbohydrate group.
- Toxins can be employed with the monoclonal antibodies described herein to produce immunotoxins.
- Exemplary toxins include ricin, abrin, diphtheria toxin and subunits thereof, as well as botulinum toxins A through F. These toxins are readily available from commercial sources (for example, Sigma Chemical Company, St. Louis, MO). Contemplated toxins also include variants of the toxins described herein (see, for example, see, U.S. Patent Nos. 5,079,163 and 4,689,401).
- the toxin is Pseudomonas exotoxin (PE) (U.S. Patent No. 5,602,095).
- Pseudomonas exotoxin refers to a full-length native (naturally occurring) PE or a PE that has been modified. Such modifications can include, but are not limited to, elimination of domain la, various amino acid deletions in domains lb, II and III, single amino acid substitutions and the addition of one or more sequences at the carboxyl terminus (for example, see Siegall et al. , /. Biol. Chem. 264: 14256-14261, 1989).
- PE employed with the monoclonal antibodies described herein can include the native sequence, cytotoxic fragments of the native sequence, and conservatively modified variants of native PE and its cytotoxic fragments.
- Cytotoxic fragments of PE include those which are cytotoxic with or without subsequent proteolytic or other processing in the target cell. Cytotoxic fragments of PE include PE40, PE38, and PE35.
- Cytotoxic fragments of PE include PE40, PE38, and PE35.
- the PE is PE38, comprising the following amino acid sequence:
- PE-LR protease-resistant PE variants and PE variants with reduced immunogenicity
- PE-LR protease-resistant PE variants and PE variants with reduced immunogenicity
- PE-LR protease-resistant PE variants and PE variants with reduced immunogenicity
- PE-LR protease-resistant PE variants and PE variants with reduced immunogenicity
- PE-LR protease-resistant PE variants and PE variants with reduced immunogenicity
- the PE is a variant that is resistant to lysosomal degradation, such as PE-
- the PE is a variant designated PE-LR/6X (PCT Publication No. WO 2011/032022) having the following amino acid sequence:
- the PE variant is PE with reducing immunogenicity, such as a PE with the following sequence:
- the PE is a variant designated PE-LR/8M (PCT Publication No. WO 2011/032022) having the following amino acid sequence:
- substitutions of PE are defined herein by reference to the amino acid sequence of full- length PE set forth herein as SEQ ID NO: 3. Substitutions of PE are described herein by reference to the amino acid residue present at a particular position, followed by the amino acid with which that residue has been replaced in the particular substitution.
- the positions of the amino acid sequence of a particular embodiment of a PE are referred to herein as the positions of the amino acid sequence of the particular embodiment, or as the positions as defined by SEQ ID NO: 3.
- substitutions refer to a replacement of an amino acid residue in the amino acid sequence of a particular embodiment of a PE corresponding to the indicated position of the 613- amino acid sequence of SEQ ID NO: 3 with the understanding that the actual positions in the respective amino acid sequence may be different.
- the two or more substitutions may be the same or different - each amino acid residue of the two or more amino acid residues being substituted can be substituted with the same or different amino acid residue unless explicitly indicated otherwise.
- Modification of PE may occur in any previously described variant, including cytotoxic fragments of PE (for example, PE38, PE-LR and PE-LR/8M).
- Modified PEs may include any substitution(s), as described above, for one or more amino acid residues within one or more T-cell epitopes and/or B cell epitopes of PE.
- the antibodies described herein can also be used to target any number of different diagnostic or therapeutic compounds to cells expressing mesothelin on their surface.
- an antibody of the present disclosure can be attached directly or via a linker to a drug that is to be delivered directly to cells expressing cell-surface mesothelin. This can be done for therapeutic, diagnostic or research purposes.
- Therapeutic agents include such compounds as nucleic acids, proteins, peptides, amino acids or derivatives, glycoproteins, radioisotopes, lipids, carbohydrates, or recombinant viruses.
- Nucleic acid therapeutic and diagnostic moieties include antisense nucleic acids, derivatized oligonucleotides for covalent cross-linking with single or duplex DNA, and triplex forming oligonucleotides.
- the molecule linked to an anti-mesothelin antibody can be an encapsulation system, such as a liposome or micelle that contains a therapeutic composition such as a drug, a nucleic acid (for example, an antisense nucleic acid), or another therapeutic moiety that is preferably shielded from direct exposure to the circulatory system.
- a therapeutic composition such as a drug, a nucleic acid (for example, an antisense nucleic acid), or another therapeutic moiety that is preferably shielded from direct exposure to the circulatory system.
- Means of preparing liposomes attached to antibodies are well known to those of skill in the art (see, for example, U.S. Patent No. 4,957,735; Connor et al. , Pharm. Ther. 28:341-365, 1985).
- Antibodies described herein can also be covalently or non-covalently linked to a detectable label.
- Detectable labels suitable for such use include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means.
- Useful labels include magnetic beads, fluorescent dyes (for example, fluorescein isothiocyanate, Texas red, rhodamine, green fluorescent protein, and the like), radiolabels (for example, 3 H, 125 1, 35 S, 14 C, or 32 P), enzymes (such as horseradish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (such as polystyrene, polypropylene, latex, and the like) beads.
- fluorescent dyes for example, fluorescein isothiocyanate, Texas red, rhodamine, green fluorescent protein, and the like
- radiolabels for example, 3 H, 125 1,
- radiolabels may be detected using photographic film or scintillation counters
- fluorescent markers may be detected using a photodetector to detect emitted illumination
- Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
- compositions include one or more of the disclosed antibodies that bind (for example specifically bind) mesothelin in a carrier.
- Compositions comprising fusion proteins, immunoconjugates or immunotoxins are also provided.
- the compositions can be prepared in unit dosage forms for administration to a subject. The amount and timing of administration are at the discretion of the treating clinician to achieve the desired outcome.
- the antibody can be formulated for systemic or local (such as intra-tumor) administration. In one example, the antibody is formulated for parenteral administration, such as intravenous administration.
- compositions for administration can include a solution of the antibody dissolved in a pharmaceutically acceptable carrier, such as an aqueous carrier.
- a pharmaceutically acceptable carrier such as an aqueous carrier.
- aqueous carriers can be used, for example, buffered saline and the like. These solutions are sterile and generally free of undesirable matter.
- These compositions may be sterilized by conventional, well known sterilization techniques.
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
- concentration of antibody in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the subject's needs.
- a typical pharmaceutical composition for intravenous administration includes about 0.1 to
- Antibodies may be provided in lyophilized form and rehydrated with sterile water before administration, although they are also provided in sterile solutions of known concentration. The antibody solution is then added to an infusion bag containing 0.9% sodium chloride, USP, and in some cases administered at a dosage of from 0.5 to 15 mg/kg of body weight.
- an infusion bag containing 0.9% sodium chloride, USP, and in some cases administered at a dosage of from 0.5 to 15 mg/kg of body weight.
- Antibodies can be administered by slow infusion, rather than in an intravenous push or bolus.
- a higher loading dose is administered, with subsequent, maintenance doses being administered at a lower level. For example, an initial loading dose of 4 mg/kg may be infused over a period of some 90 minutes, followed by weekly maintenance doses for 4-8 weeks of 2 mg/kg infused over a 30 minute period if the previous dose was well tolerated.
- Controlled release parenteral formulations can be made as implants, oily injections, or as particulate systems.
- protein delivery systems see, Banga, A.J.,
- Particulate systems include microspheres, microparticles, microcapsules, nanocapsules, nanospheres, and nanoparticles.
- Microcapsules contain the therapeutic protein, such as a cytotoxin or a drug, as a central core. In microspheres the therapeutic is dispersed throughout the particle.
- Particles, microspheres, and microcapsules smaller than about 1 ⁇ are generally referred to as nanoparticles, nanospheres, and nanocapsules, respectively.
- Capillaries have a diameter of approximately 5 ⁇ so that only nanoparticles are administered intravenously.
- Microparticles are typically around 100 ⁇ in diameter and are administered subcutaneously or intramuscularly. See, for example, Kreuter, J., Colloidal Drug Delivery Systems, J. Kreuter, ed., Marcel Dekker, Inc., New York, NY, pp. 219-342 (1994); and Tice & Tabibi, Treatise on Controlled Drug Delivery, A. Kydonieus, ed., Marcel Dekker, Inc. New York, NY, pp. 315-339, (1992). Polymers can be used for ion-controlled release of the antibody compositions disclosed herein. Various degradable and nondegradable polymeric matrices for use in controlled drug delivery are known in the art (Langer, Accounts Chem. Res.
- the block copolymer, polaxamer 407 exists as a viscous yet mobile liquid at low temperatures but forms a semisolid gel at body temperature. It has been shown to be an effective vehicle for formulation and sustained delivery of recombinant interleukin-2 and urease (Johnston et al, Pharm. Res. 9:425-434, 1992; and Pec et al, J. Parent. Sci. Tech. 44(2):58-65, 1990).
- hydroxyapatite has been used as a microcarrier for controlled release of proteins (Ijntema et al, Int. J. Pharm.112:215-224, 1994).
- liposomes are used for controlled release as well as drug targeting of the lipid-capsulated drug (Betageri et al, Liposome Drug Delivery Systems, Technomic Publishing Co., Inc., Lancaster, PA (1993)).
- Numerous additional systems for controlled delivery of therapeutic proteins are known (see U.S. Patent No. 5,055,303; U.S. Patent No. 5,188,837; U.S. Patent No. 4,235,871 ; U.S. Patent No. 4,501,728; U.S. Patent No.
- the antibodies, compositions, fusion proteins and immunoconjugates disclosed herein can be administered to slow or inhibit the growth of tumor cells or inhibit the metastasis of tumor cells, such as mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, breast cancer (such as triple negative breast cancer) or ovarian cancer.
- tumor cells such as mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, breast cancer (such as triple negative breast cancer) or ovarian cancer.
- a therapeutically effective amount of an antibody is administered to a subject in an amount sufficient to inhibit growth, replication or metastasis of cancer cells, or to inhibit a sign or a symptom of the cancer.
- Suitable subjects may include those diagnosed with a cancer that expresses mesothelin, such as, but not limited to, mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, triple native breast cancer or ovarian cancer.
- a cancer that expresses mesothelin such as, but not limited to, mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, triple native breast cancer or ovarian cancer.
- provided herein is a method of treating a subject with cancer by selecting a subject having a cancer that expresses mesothelin and administering to the subject a therapeutically effective amount of an antibody, composition, fusion protein or immunoconjugate disclosed herein.
- Also provided herein is a method of inhibiting tumor growth or metastasis by selecting a subject having a cancer that expresses mesothelin and administering to the subject a therapeutically effective amount of an antibody, composition, fusion protein or immunoconjugate disclosed herein.
- a therapeutically effective amount of a mesothelin-specific antibody, fusion protein, composition or immunoconjugate will depend upon the severity of the disease and the general state of the patient's health.
- a therapeutically effective amount of the antibody is that which provides either subjective relief of a symptom(s) or an objectively identifiable improvement as noted by the clinician or other qualified observer.
- Administration of the antibodies, fusion proteins and immunoconjugates (or compositions thereof) disclosed herein can also be accompanied by administration of other anti-cancer agents or therapeutic treatments (such as surgical resection of a tumor). Any suitable anti-cancer agent can be administered in combination with the antibodies, compositions, fusion proteins and
- anti-cancer agents include, but are not limited to, chemotherapeutic agents, such as, for example, mitotic inhibitors, alkylating agents, antimetabolites, intercalating antibiotics, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, anti-survival agents, biological response modifiers, anti-hormones (e.g. anti- androgens) and anti-angiogenesis agents.
- chemotherapeutic agents such as, for example, mitotic inhibitors, alkylating agents, antimetabolites, intercalating antibiotics, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, anti-survival agents, biological response modifiers, anti-hormones (e.g. anti- androgens) and anti-angiogenesis agents.
- Other anti-cancer treatments include radiation therapy and other antibodies that specifically target cancer cells.
- alkylating agents include nitrogen mustards (such as
- mechlorethamine cyclophosphamide, melphalan, uracil mustard or chlorambucil
- alkyl sulfonates such as busulfan
- nitrosoureas such as carmustine, lomustine, semustine, streptozocin, or dacarbazine
- Non-limiting examples of antimetabolites include folic acid analogs (such as methotrexate), pyrimidine analogs (such as 5-FU or cytarabine), and purine analogs, such as mercaptopurine or thioguanine.
- folic acid analogs such as methotrexate
- pyrimidine analogs such as 5-FU or cytarabine
- purine analogs such as mercaptopurine or thioguanine.
- Non- limiting examples of natural products include vinca alkaloids (such as vinblastine, vincristine, or vindesine), epipodophyllotoxins (such as etoposide or teniposide), antibiotics (such as dactinomycin, daunorubicin, doxorubicin, bleomycin, plicamycin, or mitomycin C), and enzymes (such as L-asparaginase).
- vinca alkaloids such as vinblastine, vincristine, or vindesine
- epipodophyllotoxins such as etoposide or teniposide
- antibiotics such as dactinomycin, daunorubicin, doxorubicin, bleomycin, plicamycin, or mitomycin C
- enzymes such as L-asparaginase
- miscellaneous agents include platinum coordination complexes (such as cis-diamine-dichloroplatinum II also known as cisplatin), substituted ureas (such as hydroxyurea), methyl hydrazine derivatives (such as procarbazine), and adrenocrotical suppressants (such as mitotane and aminoglutethimide).
- platinum coordination complexes such as cis-diamine-dichloroplatinum II also known as cisplatin
- substituted ureas such as hydroxyurea
- methyl hydrazine derivatives such as procarbazine
- adrenocrotical suppressants such as mitotane and aminoglutethimide
- Non- limiting examples of hormones and antagonists include adrenocorticosteroids (such as prednisone), progestins (such as hydroxyprogesterone caproate, medroxyprogesterone acetate, and magestrol acetate), estrogens (such as diethylstilbestrol and ethinyl estradiol), antiestrogens (such as tamoxifen), and androgens (such as testerone proprionate and fluoxymesterone).
- adrenocorticosteroids such as prednisone
- progestins such as hydroxyprogesterone caproate, medroxyprogesterone acetate, and magestrol acetate
- estrogens such as diethylstilbestrol and ethinyl estradiol
- antiestrogens such as tamoxifen
- androgens such as testerone proprionate and fluoxymesterone
- chemotherapy drugs examples include Adriamycin, Alkeran, Ara-C, BiCNU, Busulfan, CCNU, Carboplatinum, Cisplatinum, Cytoxan, Daunorubicin, DTIC, 5-FU, Fludarabine, Hydrea, Idarubicin, Ifosfamide, Methotrexate, Mithramycin, Mitomycin, Mitoxantrone, Nitrogen Mustard, Taxol (or other taxanes, such as docetaxel), Velban, Vincristine, VP- 16, while some more newer drugs include Gemcitabine (Gemzar), Herceptin, Irinotecan (Camptosar, CPT-11),
- Leustatin Leustatin, Navelbine, Rituxan STI-571, Taxotere, Topotecan (Hycamtin), Xeloda (Capecitabine), Zevelin and calcitriol.
- Non- limiting examples of immunomodulators that can be used include AS- 101 (Wyeth- Ayerst Labs.), bropirimine (Upjohn), gamma interferon (Genentech), GM-CSF (granulocyte macrophage colony stimulating factor; Genetics Institute), IL-2 (Cetus or Hoffman-LaRoche), human immune globulin (Cutter Biological), IMREG (from Imreg of New Jersey, La.), SK&F 106528, and TNF (tumor necrosis factor; Genentech).
- Another common treatment for some types of cancer is surgical treatment, for example surgical resection of the cancer or a portion of it.
- surgical treatment for example surgical resection of the cancer or a portion of it.
- radiotherapy for example administration of radioactive material or energy (such as external beam therapy) to the tumor site to help eradicate the tumor or shrink it prior to surgical resection.
- mesothelin expression is detected in a biological sample.
- the sample can be any sample, including, but not limited to, tissue from biopsies, autopsies and pathology specimens.
- Biological samples also include sections of tissues, for example, frozen sections taken for histological purposes.
- Biological samples further include body fluids, such as blood, serum, plasma, sputum, spinal fluid or urine.
- a biological sample is typically obtained from a mammal, such as a human or non-human primate.
- a method of determining if a subject has cancer by contacting a sample from the subject with a monoclonal antibody disclosed herein; and detecting binding of the antibody to the sample.
- An increase in binding of the antibody to the sample as compared to binding of the antibody to a control sample identifies the subject as having cancer.
- a method of confirming a diagnosis of cancer in a subject by contacting a sample from a subject diagnosed with cancer with a monoclonal antibody disclosed herein; and detecting binding of the antibody to the sample.
- An increase in binding of the antibody to the sample as compared to binding of the antibody to a control sample confirms the diagnosis of cancer in the subject.
- the monoclonal antibody is directly labeled.
- the methods further include contacting a second antibody that specifically binds the monoclonal antibody with the sample; and detecting the binding of the second antibody.
- An increase in binding of the second antibody to the sample as compared to binding of the second antibody to a control sample detects cancer in the subject or confirms the diagnosis of cancer in the subject.
- the cancer is mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, triple negative breast cancer or ovarian cancer, or any other type of cancer that expresses mesothelin.
- control sample is a sample from a subject without cancer.
- sample is a blood or tissue sample.
- the antibody that binds (for example specifically binds) mesothelin is directly labeled with a detectable label.
- the antibody that binds (for example, specifically binds) mesothelin (the first antibody) is unlabeled and a second antibody or other molecule that can bind the antibody that specifically binds mesothelin is labeled.
- a second antibody is chosen that is able to specifically bind the specific species and class of the first antibody. For example, if the first antibody is a human IgG, then the secondary antibody may be an anti-human-IgG.
- Suitable labels for the antibody or secondary antibody include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, magnetic agents and radioactive materials.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase.
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin.
- Non- limiting examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin.
- a non-limiting exemplary luminescent material is luminol; a non-limiting exemplary a magnetic agent is gadolinium, and non-limiting exemplary radioactive labels include 125 I, 131 I, 35 S or 3 H.
- mesothelin can be assayed in a biological sample by a competition immunoassay utilizing mesothelin standards labeled with a detectable substance and an unlabeled antibody that specifically binds mesothelin.
- a competition immunoassay utilizing mesothelin standards labeled with a detectable substance and an unlabeled antibody that specifically binds mesothelin.
- the biological sample, the labeled mesothelin standards and the antibody that specifically bind mesothelin are combined and the amount of labeled mesothelin standard bound to the unlabeled antibody is determined.
- the amount of mesothelin in the biological sample is inversely proportional to the amount of labeled mesothelin standard bound to the antibody that specifically binds mesothelin.
- the antibody that specifically binds mesothelin may be used to detect the production of mesothelin in cells in cell culture.
- the antibody can be used to detect the amount of mesothelin in a biological sample, such as a tissue sample, or a blood or serum sample.
- the mesothelin is cell-surface mesothelin.
- the mesothelin is soluble mesothelin (e.g. mesothelin in a cell culture supernatant or soluble mesothelin in a body fluid sample, such as a blood or serum sample).
- kits for detecting mesothelin in a biological sample such as a blood sample or tissue sample.
- a biological sample such as a blood sample or tissue sample.
- a biopsy can be performed to obtain a tissue sample for histological examination.
- a blood sample can be obtained to detect the presence of soluble mesothelin protein or fragment.
- Kits for detecting a polypeptide will typically comprise a monoclonal antibody that specifically binds mesothelin, such as any of the antibodies disclosed herein.
- an antibody fragment such as an scFv fragment, a VH domain, or a Fab is included in the kit.
- the antibody is labeled (for example, with a fluorescent, radioactive, or an enzymatic label).
- kits in one embodiment, includes instructional materials disclosing means of use of an antibody that binds mesothelin.
- the instructional materials may be written, in an electronic form (such as a computer diskette or compact disk) or may be visual (such as video files).
- the kits may also include additional components to facilitate the particular application for which the kit is designed.
- the kit may additionally contain means of detecting a label (such as enzyme substrates for enzymatic labels, filter sets to detect fluorescent labels, appropriate secondary labels such as a secondary antibody, or the like).
- the kits may additionally include buffers and other reagents routinely used for the practice of a particular method. Such kits and appropriate contents are well known to those of skill in the art.
- the diagnostic kit comprises an immunoassay.
- the method of detecting mesothelin in a biological sample generally includes the steps of contacting the biological sample with an antibody which specifically reacts, under immunologically reactive conditions, to a mesothelin polypeptide.
- the antibody is allowed to specifically bind under immunologically reactive conditions to form an immune complex, and the presence of the immune complex (bound antibody) is detected directly or indirectly.
- the antibodies can be conjugated to other compounds including, but not limited to, enzymes, magnetic beads, colloidal magnetic beads, haptens, fluorochromes, metal compounds, radioactive compounds or drugs.
- the antibodies can also be utilized in immunoassays such as but not limited to radioimmunoassays (RIAs), ELISA, or immunohistochemical assays.
- the antibodies can also be used for fluorescence activated cell sorting (FACS).
- FACS employs a plurality of color channels, low angle and obtuse light-scattering detection channels, and impedance channels, among other more sophisticated levels of detection, to separate or sort cells (see U.S. Patent No. 5, 061,620). Any of the monoclonal antibodies that bind mesothelin, as disclosed herein, can be used in these assays.
- the antibodies can be used in a conventional
- immunoassay including, without limitation, an ELISA, an RIA, FACS, tissue
- CTLs Cytotoxic T Lymphocytes
- CARs chimeric antigen receptors
- CARs include a binding moiety, an extracellular hinge and spacer element, a transmembrane region and an endodomain that performs signaling functions (Cartellieri et al, J Biomed Biotechnol 2010:956304, 2010).
- the binding moiety is an antigen binding fragment of a monoclonal antibody, such as a scFv.
- the endodomain can consist of a signaling chain having an immunoreceptor tyrosine-based activation motif (IT AM), such as or FceRIy.
- IT AM immunoreceptor tyrosine-based activation motif
- the endodomain further includes the intracellular portion of at least one additional co- stimulatory domain, such as CD28 and/or CD137.
- CTLs expressing CARs can be used to target a specific cell type, such as a tumor cell.
- the monoclonal antibodies disclosed herein can be used to engineer CTLs that express a CAR containing an antigen-binding fragment of a mesothelin-specific antibody, thereby targeting the engineered CTLs to mesothelin-expressing tumor cells.
- Engineered T cells have previously used for adoptive therapy for some types of cancer (see, for example, Park et al, Mol Ther 15(4):825- 833, 2007).
- the use of T cells expressing CARs is more universal than standard CTL-based immunotherapy because CTLs expressing CARs are HLA unrestricted and can therefore be used for any patient having a tumor that expressed the target antigen.
- CARs comprising a mesothelin-specific antibody binding fragment, such as a scFv.
- CTLs expressing CARs comprised of a mesothelin-specific antibody binding fragment can be used for the treatment of cancers that express mesothelin, such as mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, breast cancer (such as triple negative breast cancer) or ovarian cancer.
- kits for treating a subject with cancer by selecting a subject having a cancer that expresses mesothelin, and administering to the subject a therapeutically effective amount of the CTLs expressing the mesothelin-targeted CARs.
- Bispecific antibodies are recombinant proteins comprised of antigen-binding fragments of two different monoclonal antibodies. Thus, bispecific antibodies bind two different antigens. Bispecific antibodies can be used for cancer immunotherapy by simultaneously targeting both CTLs (such as a CTL receptor component such as CD3) and a tumor antigen.
- CTLs such as a CTL receptor component such as CD3
- the mesothelin- specific monoclonal antibodies disclosed herein can be used to generate bispecific antibodies that target both mesothelin and CTLs, thereby providing a means to treat mesothelin-expressing cancers.
- bispecific monoclonal antibodies comprising a mesothelin-specific monoclonal antibody, or antigen-binding fragment thereof.
- the bispecific monoclonal antibody further comprises a monoclonal antibody, or antigen-binding fragment thereof, that specifically binds a component of the T cell receptor, such as CD3.
- isolated nucleic acid molecules and vectors encoding the bispecific antibodies, and host cells comprising the nucleic acid molecules or vectors.
- Bispecific antibodies comprising a mesothelin- specific antibody, or antigen-binding fragment thereof, can be used for the treatment of cancers that express mesothelin, such as mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, breast cancer (such as triple negative breast cancer) or ovarian cancer.
- cancers that express mesothelin such as mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, breast cancer (such as triple negative breast cancer) or ovarian cancer.
- methods of treating a subject with cancer by selecting a subject having a cancer that expresses mesothelin, and administering to the subject a therapeutically effective amount of the mesothelin-targeting bispecific antibody.
- CCA Human cholangiocarcinoma
- KMBC Human cholangiocarcinoma
- HuCCT-1 Human cholangiocarcinoma
- A431 epidermal carcinoma
- NCI-H226 mesothelioma
- EKVX human non-small cell lung cancer, or NSCLC
- OVCAR-8 ovarian cancer
- L55 NSCLC
- the HEK-293F cell line (Invitrogen, Carlsbad, CA) was grown in FreeStyleTM serum-free medium (Invitrogen). All cell lines were passaged only a few times (less than 1 month) after thawing of initial frozen stocks, which were generated right after obtaining cell lines, to reduce total number of passages to less than 15. All cell lines were tested and authenticated by morphology and growth rate and were Mycoplasma free.
- VH antibody domain library An engineered human (VH) antibody domain library named m81 showed an estimated diversity of 2.5xl0 10 (Chen et al , J Mol Biol 382:779-789, 2008).
- the phage library was subjected to four rounds of panning on human mesothelin or the C- terminal mesothelin peptide following a standard lab protocol (Ho et al , J Biol Chem 280:607-617, 2005; Ho and Pastan, Methods Mol Biol 525:293-308, 2009). Randomly picked clones at the end of each round of panning were analyzed for antigen binding by phage enzyme-linked
- the VH region encoding the SD1 human antibody domain fused with human IgGyl Fc and FLAG/His tag was PCR amplified with two primers (Forward: GTC ATC ACA ACT TCG ATA TCG CGG TGC AGC GGT GCA GTC TGG GGG AGG CTT GGT A; SEQ ID NO: 10; reverse: GAA GTT GTG ATG ACT CCG GAG CCC TTA TCG TCA TCG TCC TTG TAG TCG CCG TGG; SEQ ID NO: 11).
- the PCR product was inserted into the EcoRY and BspEl sites
- pVRC8400 (Barouch et al, J Virol 79:8828-8834, 2005; Ofek et al, J Virol 84:2955-2962, 2010).
- the final plasmid (named pMH148) was transfected into HEK-293F cells and the protein was purified using protein A column (GE healthcare, Piscataway, NJ).
- a stable cell line was established by transfecting HEK-293F (Invitrogen) cells with pMH148.
- the stable line produced the SDl-hFc fusion protein with a high expression level (>70 mg/L) in culture supernatant.
- Cell lysate (1.5 mg) was incubated with 50 ⁇ g of SD1 or an irrelevant human single-domain antibody in 500 ⁇ of RIPA buffer (Cell signaling, Boston, MA) and rotated overnight at 4°C. Thirty ⁇ of protein A beads were added (Sigma, St. Louis, MO) and rotated at 4°C for 2 hours. Beads were spun down and washed with RIPA buffer. Immune complexes were released from the beads after 5 minutes of boiling in 100 ⁇ of 2x loading buffer. Western blot analysis was performed following a standard lab protocol (Yu et al, J Cancer 1: 141-149, 2010).
- A431/H9 or NCI-H226 cells were suspended at lxlO 6 cells/ml and incubated with different concentration of SDl-hFc, control human IgG or the HN1 human IgG on ice for 1 hour. After washing, the cells were incubated with 20 ⁇ g/ml purified Clq (Complement Technologies, Tyler, TN) at 37C° for 0.5 hour.
- the cells were washed again and then incubated with FITC-labeled sheep anti-human Clq mAb (AbD Serotec, Raleigh, NC) for 0.5 hour on ice. At the end of the incubation, cells were washed and analyzed using a FACSCalibur.
- ADCC assay was performed using an LDH detection kit (Roche, Mannheim, Germany) according to a standard protocol (Ho et al. , ⁇ nt J Cancer 128:2020-2030, 2011). CDC activity of SDl-hFc was also measured by LDH-releasing assay. Briefly, cells were incubated with SDl-hFc for 1 hour in DMEM culture medium in a 5% C0 2 incubator at 37°C, followed by addition of normal human serum (20% vol/vol) or freshly drawn mouse serum ( 30% vol/vol) as a source of complement. Normal human sera were provided by the Department of Transfusion Medicine, NIH Clinical Center (Bethesda, MD).
- Tumor experiments evaluating SDl-hFc were conducted using A431/H9 xenografts in nude mice following a well-established NCI protocol (Hassan et al , Cancer Immun 7:20, 2007).
- Four to six week old female athymic nude mice were housed in micro-isolation cages during the course of the experiment.
- Three million A431/H9 cells were inoculated subcutaneously into the right flank of the mice.
- Tumor dimensions were determined using calipers and the tumor volume (mm 3 ) was calculated by the formula: length x (width) 2 x 0.5. Treatment was initiated when tumors reached approximately 70 mm 3 in size.
- the SD1 antibody domain from selected phagemids was PCR amplified using two primers (forward: GTC ATC ACA ACT TCC ATA TGC AGG TGC AGC TGG TGC AGT CT, SEQ ID NO: 12; and reverse: GAA GTT GTG ATG ACA AGC TTT GGC CGC ACT TGA GGA GAC GGT GAC CAG GGT TC; SEQ ID NO: 13) that introduced Ndel and Hmd-III restriction sites (underlined). The products of the reaction were cloned into pRB98.
- the final expression plasmid (named pMH149) was used for the production of recombinant immunotoxins as previously described (Pastan and Ho, "Recombinant immunotoxins for Treating Cancer," in Antibody Engineering, Volume II, New York: Springer; 2010, pages 127-146).
- Cell proliferation inhibition assay
- Example 2 A human single-domain antibody elicits potent anti-tumor activity by targeting an epitope in mesothelin close to the cancer cell surface
- This example describes the identification and characterization of a human single-domain antibody specific for a C-terminal epitope of human mesothelin.
- a C-terminal mesothelin peptide was designed for screening a library of small-size binders (VHs).
- the human mesothelin (MSLN) gene encodes a precursor protein of 622 amino acids (GenBank accession no. AY743922).
- the N-terminal signal peptide (residues: 1-33) and the C-terminal GPI anchor addition signal (predicted cleavage site: Ser598) are removed and the latter is replaced with a GPI anchor.
- the GPI cleavage site was predicted as Ser598. Initially the intent was to make a 50-amino acid peptide (residues 549-598) corresponding to the predicted C-terminal end, however, synthesis failed after aggregation issues possibly due to the hydrophobic property of the peptide. A new peptide was designed (residues 539-588 of SEQ ID NO: 9;
- VQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLQGGIPNGYLV 10 amino acids away from the GPI cleavage site of mesothelin (FIG. 1A).
- the new peptide was used for phage panning with an engineered human antibody domain phage display library (Chen et al. , J Mol Biol 382:779-789, 2008) (Table 1).
- Phage clone SD1 was selected for further analysis because it bound not only the peptide but also full-length mesothelin (FIG. 1C).
- the same single-domain antibody phage library was screened on human mesothelin, but only clone SD2 was enriched and specific for full-length human mesothelin, but not the peptide (FIG. ID).
- Phage titer after each round of panning was shown as plaque forming units (pfu).
- SD1 As a potential therapeutic, it was converted into a clinically relevant molecule: a human Fc (hFc) fusion protein (FIG. 2A).
- the SDl-hFc human protein was generated by fusing the human VH into the CH 2 and CH3 in the constant region of human IgG heavy chain ⁇ .
- a stable cell line was established with a high expression level (>70 mg/L) in the culture supernatant of HEK-293F cells.
- SDl -hFc is an antibody-like dimeric molecule (without the light chain) and is approximately 100 kDa estimated on SDS-PAGE under non-reducing condition. Therefore, the SDl human antibody domain was successfully isolated against the C-terminal end of mesothelin by phage display, and a human Fc fusion (SDl-hFc) was produced based on the SDl VH for potential clinical applications.
- the SDl human antibody binds cancer cell surface-associated mesothelin
- SDl -hFc or an irrelevant human VH single-domain hFc fusion protein as a control was used to perform Western blot and pull-down assays using cancer cell lysates.
- Initial Western blot analysis of various cancer cell lysates using SDl-hFc could not detect a mesothelin band under reducing condition even in high mesothelin-expressing cell lines such as A431/H9 and NCI-H226, indicating that SDl-hFc did not recognize denatured mesothelin protein.
- pull-down assays to detect endogenous mesothelin proteins in solution, as shown in FIG. 2B, the SDl -hFc protein successfully pulled down mature mesothelin protein from three different cancer cell lines
- NCI-H226 and KMBC are native human cancer cell lines.
- A431/H9 was an engineered A431 line overexpressing mesothelin on the cell surface (Ho et al , Clin Cancer Res 1 1 :3814-3820, 2005).
- the molecular weight of mature mesothelin ( ⁇ 40 kDa) was consistent with previous studies (Yu et al , J Cancer 1 : 141 -149, 2010; Ho et al , Clin Cancer Res 13: 1571 -1575, 2007).
- the SDl -hFc protein bound both full-length human mesothelin protein and mesothelin peptide (FIG. 3A), and did not bind full-length mouse mesothelin protein, BSA or other irrelevant proteins.
- SS1P and HN1 bind only full- length human mesothelin, not the C-terminal peptide.
- SDl-hFc binds to human mesothelin protein with dissociate equilibrium (KD) of 13.59 nM, and to the peptide with a KD of 16.08 nM.
- KD dissociate equilibrium
- the equilibrium constants and Scatchard plots were determined by using Prism (version 3.02) for Windows (GraphPad software, San Diego, CA) (Kaneko et al , J Biol Chem 284:3739-3749, 2009).
- SDl-hFc binds native mesothelin molecules on human tumor cells.
- Flow cytometric analysis was performed on a panel of mesothelin-expressing cancer cells and the average number of mesothelin sites per cell was experimentally measured using the QuantiBRITE fluorescence quantitation system (Table 2).
- the SDl-hFc protein binds A431/ H9, but not A431 , indicating that SD1 binding on cell surface-associated mesothelin is highly specific (FIG. 4).
- the binding of SDl-hFc on a panel of native human tumor cell lines was also tested.
- mesothelin is highly expressed in malignant mesothelioma, ovarian cancer (Chang et al , Cancer Res 52: 181-186, 1992), lung adenocarcinoma (Ho et al., Clin Cancer Res 13: 1571-1575, 2007) and
- SDl-hFc exerted potent CDC activity by killing 40% of A431/H9 (FIG. 5 A) and more than 30% of NCI-H226 mesothelioma cell lines (FIG. 5B) and showed no activity on the mesothelin- negative A431 cell line.
- An irrelevant control antibody showed no activity at the same concentrations.
- MORAb-009 a chimeric antibody that is currently being evaluated in clinical trials, shows no significant CDC activity against tumor cells (Hassan et ah , Cancer Immun 7:20, 2007). It has been suggested that mesothelin-bound MORAb- 009 may be too far from the cell surface for the complement membrane attack complex (MAC) to be effective. By targeting a mesothelin epitope close to the cell surface, mesothelin-bound SDl- hFc may cause effective complement MAC on the cancer cell surface.
- MAC complement membrane attack complex
- ADCC activity of SDl-hFc against tumor cells was tested. High levels of cytotoxicity were found using SDl-hFc with human peripheral blood mononuclear cells (PBMC) at different concentrations. SD1 exhibited significant ADCC activity against both A431/H9 cells (FIG. 5E) and NCI-H226 mesothelioma cells (FIG. 5F). No activity was found on mesothelin- negative A431 cells. ADCC activity of SDl-hFc against tumor cells using purified human NK cells was also tested.
- PBMC peripheral blood mononuclear cells
- mice bearing tumor xenografts were used following an established protocol used to evaluate MORAb-009 in preclinical studies (Hassan et al , Cancer Immun 7:20, 2007). From day 7, athymic nude mice bearing A431/H9 tumors were treated with 50 mg/kg of SDl-hFc (FIG. 6A). The number of mesothelin sites in A431/H9 is comparable to that of malignant mesothelioma cells endogenously expressing mesothelin and their implantation in mice consistently results in aggressive tumor growth.
- CDC plays an important role in its potent tumor growth inhibition in mice.
- SD1 an engineered antibody domain that recognizes an epitope at the C-terminal end of mesothelin, by phage display technology. This epitope does not overlap with epitopes of any current therapeutic antibodies (SSlP/MORAb-009 and HN1) that are in preclinical and clinical development for mesothelin-targeted therapy.
- SD1 shows strong in vitro and in vivo anti-tumor activity.
- the SDl-hFc protein shows strong CDC activity against mesothelin-expressing cancer cells.
- the SDl- hFc protein exhibits potent tumor growth inhibition.
- the results disclosed herein indicate that SD1 represents a new class of anti-mesothelin mAbs and can be used as a therapeutic antibody for mesothelin-targeted therapy.
- the SD1 domain was isolated by phage panning on a C-terminal 50-residue peptide of mesothelin. It was demonstrated that the antibody binds native mesothelin proteins in cancer cells by flow cytometry and pull-down assays. It does not bind denatured mesothelin proteins on Western blot, indicating the SD1 domain binds a conformational epitope of mesothelin close to the cancer cell surface. This region has never been accessed by any known anti-mesothelin antibodies (including SSlP/MORAb-009 and HN1). It is believed that it is an important strategy to develop an antibody targeting this region.
- CDC is one of the most powerful cell killing mechanisms of therapeutic antibodies against tumors, but may require an antibody binding site close to the cell membrane (Pawluczkowycz et al. , J Immunol 183:749-758, 2009).
- the present data demonstrate that CDC triggered by SDl-hFc depends on the specific new epitope because HN1 (specific for the N-terminus of mesothelin, Region I, far from the cell surface) does not exhibit CDC activity and cannot recruit Clq to cancer cells.
- HN1 specific for the N-terminus of mesothelin, Region I, far from the cell surface
- mesothelin antibodies e.g. , MORAb-009/amatuximab, SS1P, HN1 recognize Region I.
- Naturally occurring single-domain antibodies such as camelid VHHs and shark VNARs have been suggested as a novel class of therapeutics for cancer immunotherapy. Due to the likelihood of immunogenicity in humans, these animal antibodies may not be used directly for some clinical applications. Therefore, human single-domain VHs are attractive candidates for cancer therapy. However, human VHs are typically prone to aggregation (Arbabi-Ghahroudi et al. , Methods Mol Biol 502:341-364, 2009). In the present study, the SDl VH was fused to the CH 2 and C3 ⁇ 4 of human IgGyl and to produce SDl-hFc as a dimeric IgG-like protein in mammalian HEK- 293F cells.
- a recombinant immunotoxin based on SDl was also produced, which could inhibit proliferation of mesothelin-positive tumor cells in a dose-dependent manner (Table 2 and FIGS. 7A-7B). All the recombinant proteins were properly folded for in vitro and in vivo assays.
- the first human single-domain antibody against mesothelin-expressing tumors was generated and shown to have potent anti-tumor activity in vitro and in vivo by targeting an epitope close the cancer cell surface via CDC and ADCC. Such a binding site has not been accessed by any known anti-mesothelin antibodies currently in preclinical or clinical studies.
- Example 3 Mesothelin-specific monoclonal antibodies for detecting cancer in a subject or confirming the diagnosis of cancer in a subject
- This example describes the use of mesothelin-specific monoclonal antibodies, such as the monoclonal antibodies disclosed herein (for example, SDl or SD2, or a monoclonal antibody comprising the CDR sequences of SDl or SD2) for the detection of cancer in a subject.
- This example further describes the use of these antibodies to confirm the diagnosis of cancer in a subject.
- a blood sample is obtained from the patient diagnosed with, or suspected of having a mesothelin-positive cancer (i.e. , a cancer that overexpresses mesothelin, such as mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, triple negative breast cancer or ovarian cancer).
- a blood sample taken from a patient that does not have cancer can be used as a control.
- An ELISA is performed to detect the presence of soluble mesothelin in the blood sample.
- Proteins present in the blood samples are immobilized on a solid support, such as a 96-well plate, according to methods well known in the art (see, for example, Robinson et al , Lancet 362: 1612- 1616, 2003).
- a solid support such as a 96-well plate
- mesothelin-specific monoclonal antibody directly labeled with a fluorescent marker is applied to the protein-immobilized plate.
- the plate is washed in an appropriate buffer, such as PBS, to remove any unbound antibody and to minimize non-specific binding of antibody. Fluorescence can be detected using a fluorometric plate reader according to standard methods.
- An increase in fluorescence intensity of the patient sample, relative to the control sample, indicates the anti-mesothelin antibody specifically bound proteins from the blood sample, thus detecting the presence of mesothelin protein in the sample. Detection of mesothelin protein in the patient sample indicates the patient has a mesothelin-positive cancer, or confirms diagnosis of cancer in the subject.
- Example 4 Mesothelin-specific monoclonal antibodies for the treatment of cancer
- mesothelin-specific monoclonal antibodies such as the monoclonal antibodies disclosed herein (for example, SD1 or SD2, or a monoclonal antibody comprising the CDR sequences of SD1 or SD2), for the treatment of cancers that exhibit overexpression of mesothelin (referred to herein as a "mesothelin-positive" cancer), including, but not limited to mesothelioma, prostate cancer, lung cancer, stomach cancer, squamous cell carcinoma, pancreatic cancer, cholangiocarcinoma, triple negative breast cancer or ovarian cancer.
- Patients diagnosed with a mesothelin-positive cancer can be treated according to standard procedures in the art (see, for example, Hassan et al. , Proc. Am. Soc. Clin. Oncol. 21 :29a, 2002; Kreiman et al. , Proc. Am. Soc. Clinl Oncol. 21 :22b, 2002).
- patients diagnosed with a mesothelin-positive cancer are administered an immunoconjugate comprising a mesothelin-specific monoclonal antibody linked to Pseudomonas exotoxin (PE).
- PE Pseudomonas exotoxin
- Preparation of PE immunoconjugates has been described (see, for example, U.S. Patent No. 7,081,518 and U.S. Patent Application Publication No. 2005/0214304).
- patients diagnosed with a mesothelin-positive cancer are administered SD1 or an SD1- hFc fusion protein, which is capable of inducing both CDC and ADCC and can thereby mediate tumor cell killing without being linked to a toxin.
- SDl, SDl-hFc or the immunoconjugate is administered by intravenous bolus injection every other day for a total of three to six doses.
- the SDl, SDl-hFc or immunoconjugate is administered by continuous intravenous infusion over the course of ten days.
- the dose of SDl, SDl-hFc or immunoconjugate administered to a patient varies depending on the weight and gender of the patient, and mode and time course of administration. Following treatment, patients are evaluated for cancer progression (including tumor growth and metastasis) and other clinical signs of illness.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Cell Biology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Oncology (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Hospice & Palliative Care (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| HK16100885.0A HK1213000B (en) | 2012-09-27 | 2013-09-16 | Mesothelin antibodies and methods for eliciting potent antitumor activity |
| JP2015534544A JP6307085B2 (ja) | 2012-09-27 | 2013-09-16 | メソテリン抗体および強力な抗腫瘍活性を惹起するための方法 |
| CA2885761A CA2885761C (en) | 2012-09-27 | 2013-09-16 | Mesothelin antibodies and methods for eliciting potent antitumor activity |
| AU2013324049A AU2013324049B2 (en) | 2012-09-27 | 2013-09-16 | Mesothelin antibodies and methods for eliciting potent antitumor activity |
| CN201380060415.1A CN104955845B (zh) | 2012-09-27 | 2013-09-16 | 间皮素抗体和引起有效的抗肿瘤活性的方法 |
| US14/428,771 US9416190B2 (en) | 2012-09-27 | 2013-09-16 | Mesothelin antibodies and methods for eliciting potent antitumor activity |
| EP13766859.6A EP2900695B1 (en) | 2012-09-27 | 2013-09-16 | Mesothelin antibodies and methods for eliciting potent antitumor activity |
| ES13766859.6T ES2666131T3 (es) | 2012-09-27 | 2013-09-16 | Anticuerpos de mesotelina y métodos para provocar una potente actividad antitumoral |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261706396P | 2012-09-27 | 2012-09-27 | |
| US61/706,396 | 2012-09-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014052064A1 true WO2014052064A1 (en) | 2014-04-03 |
Family
ID=49237710
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/059883 Ceased WO2014052064A1 (en) | 2012-09-27 | 2013-09-16 | Mesothelin antibodies and methods for eliciting potent antitumor activity |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US9416190B2 (OSRAM) |
| EP (1) | EP2900695B1 (OSRAM) |
| JP (1) | JP6307085B2 (OSRAM) |
| CN (1) | CN104955845B (OSRAM) |
| AU (1) | AU2013324049B2 (OSRAM) |
| CA (1) | CA2885761C (OSRAM) |
| ES (1) | ES2666131T3 (OSRAM) |
| WO (1) | WO2014052064A1 (OSRAM) |
Cited By (58)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016133829A1 (en) * | 2015-02-17 | 2016-08-25 | Full Spectrum Genetics, Inc. | Novel sd1 binding compounds and uses thereof |
| WO2017032293A1 (zh) * | 2015-08-21 | 2017-03-02 | 科济生物医药(上海)有限公司 | 抗间皮素全人抗体以及靶向间皮素的免疫效应细胞 |
| WO2017196847A1 (en) | 2016-05-10 | 2017-11-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Variable new antigen receptor (vnar) antibodies and antibody conjugates targeting tumor and viral antigens |
| WO2017214182A1 (en) | 2016-06-07 | 2017-12-14 | The United States Of America. As Represented By The Secretary, Department Of Health & Human Services | Fully human antibody targeting pdi for cancer immunotherapy |
| WO2018026533A1 (en) | 2016-08-02 | 2018-02-08 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Monoclonal antibodies targeting glypican-2 (gpc2) and use thereof |
| WO2018119279A1 (en) | 2016-12-21 | 2018-06-28 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Human monoclonal antibodies specific for flt3 and uses thereof |
| US20180280438A1 (en) * | 2017-03-24 | 2018-10-04 | Lentigen Technology, Inc. | Compositions and Methods for Treating Cancer with Anti-CD33 Immunotherapy |
| WO2018213064A1 (en) | 2017-05-19 | 2018-11-22 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Human monoclonal antibody targeting tnfer2 for cancer immunotherapy |
| WO2018213612A1 (en) * | 2017-05-18 | 2018-11-22 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mesothelin polypeptides and proteins |
| EP3421489A1 (en) * | 2012-03-23 | 2019-01-02 | The United States of America, as represented by The Secretary, Department of Health and Human Services | Anti-mesothelin chimeric antigen receptors |
| WO2019006280A1 (en) | 2017-06-30 | 2019-01-03 | Lentigen Technology, Inc. | HUMAN MONOCLONAL ANTIBODIES SPECIFIC TO CD33 AND METHODS OF USE |
| WO2019005208A1 (en) | 2017-06-30 | 2019-01-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | ANTIBODIES TO HUMAN MESOTHELIN AND USES IN ANTICANCER THERAPY |
| WO2019043026A1 (en) * | 2017-08-30 | 2019-03-07 | INSERM (Institut National de la Santé et de la Recherche Médicale) | ANTI-MESOTHELIC RADIOMARQUATED SINGLE DOMAIN ANTIBODIES SUITABLE FOR IMAGING AND TREATING CANCERS |
| WO2019094482A1 (en) | 2017-11-10 | 2019-05-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric antigen receptors targeting tumor antigens |
| WO2020014482A1 (en) | 2018-07-12 | 2020-01-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Affinity matured cd22-specific monoclonal antibody and uses thereof |
| WO2020033430A1 (en) | 2018-08-08 | 2020-02-13 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | High affinity monoclonal antibodies targeting glypican-2 and uses thereof |
| WO2020043152A1 (en) | 2018-08-29 | 2020-03-05 | Nanjing Legend Biotech Co., Ltd. | Anti-mesothelin chimeric antigen receptor (car) constructs and uses thereof |
| US10640569B2 (en) | 2013-12-19 | 2020-05-05 | Novartis Ag | Human mesothelin chimeric antigen receptors and uses thereof |
| WO2020146182A1 (en) | 2019-01-08 | 2020-07-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Cross-species single domain antibodies targeting mesothelin for treating solid tumors |
| WO2020154150A1 (en) | 2019-01-22 | 2020-07-30 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | High affinity monoclonal antibodies targeting glypican-1 and methods of use |
| EP3445787B1 (en) * | 2016-10-07 | 2020-12-02 | TCR2 Therapeutics Inc. | Compositions and methods for t-cell receptors reprogramming using fusion proteins |
| EP3621648A4 (en) * | 2017-05-12 | 2021-01-20 | Harpoon Therapeutics, Inc. | TRISPECIFIC PROTEINS MSLN AND METHOD OF USE |
| WO2021081052A1 (en) | 2019-10-22 | 2021-04-29 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | High affinity nanobodies targeting b7h3 (cd276) for treating multiple solid tumors |
| US11180563B2 (en) | 2020-02-21 | 2021-11-23 | Harpoon Therapeutics, Inc. | FLT3 binding proteins and methods of use |
| WO2022010798A1 (en) * | 2020-07-06 | 2022-01-13 | Kiromic BioPharma, Inc. | Mesothelin isoform binding molecules and chimeric pd1 receptor molecules, cells containing the same and uses thereof |
| WO2022093745A1 (en) | 2020-10-26 | 2022-05-05 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies targeting sars coronavirus spike protein and uses thereof |
| US11413340B2 (en) | 2015-12-22 | 2022-08-16 | Novartis Ag | Mesothelin chimeric antigen receptor (CAR) and antibody against PD-L1 inhibitor for combined use in anticancer therapy |
| US11453716B2 (en) | 2016-05-20 | 2022-09-27 | Harpoon Therapeutics, Inc. | Single domain serum albumin binding protein |
| WO2022232612A1 (en) | 2021-04-29 | 2022-11-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Lassa virus-specific nanobodies and methods of their use |
| WO2022261017A1 (en) | 2021-06-09 | 2022-12-15 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Cross species single domain antibodies targeting pd-l1 for treating solid tumors |
| US11535668B2 (en) | 2017-02-28 | 2022-12-27 | Harpoon Therapeutics, Inc. | Inducible monovalent antigen binding protein |
| US11607453B2 (en) | 2017-05-12 | 2023-03-21 | Harpoon Therapeutics, Inc. | Mesothelin binding proteins |
| US11623958B2 (en) | 2016-05-20 | 2023-04-11 | Harpoon Therapeutics, Inc. | Single chain variable fragment CD3 binding proteins |
| WO2023076881A1 (en) | 2021-10-26 | 2023-05-04 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies targeting the s2 subunit of sars-cov-2 spike protein |
| US11783913B2 (en) | 2019-06-27 | 2023-10-10 | Scipher Medicine Corporation | Methods of treating a subject suffering from rheumatoid arthritis with alternative to anti-TNF therapy based in part on a trained machine learning classifier |
| US11807692B2 (en) | 2018-09-25 | 2023-11-07 | Harpoon Therapeutics, Inc. | DLL3 binding proteins and methods of use |
| WO2024050524A1 (en) | 2022-09-01 | 2024-03-07 | University Of Georgia Research Foundation, Inc. | Compositions and methods for directing apolipoprotein l1 to induce mammalian cell death |
| WO2024050399A1 (en) | 2022-09-01 | 2024-03-07 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies targeting hpv e6/e7 oncogenic peptide/mhc complexes |
| US11965012B2 (en) | 2015-05-18 | 2024-04-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11987620B2 (en) | 2018-03-16 | 2024-05-21 | Scipher Medicine Corporation | Methods of treating a subject with an alternative to anti-TNF therapy |
| US12103976B2 (en) | 2018-07-12 | 2024-10-01 | Invox Pharma Limited | Fc binding fragments comprising a CD137 antigen-binding site |
| WO2024238346A1 (en) | 2023-05-12 | 2024-11-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies that specifically bind the s2 subunit of sars-cov-2 spike protein and compositions and uses thereof |
| EP4477269A2 (en) | 2015-09-20 | 2024-12-18 | The United States of America, as Represented By the Secretary, Department of Health and Human Services | Monoclonal antibodies specific for fibroblast growth factor receptor 4 (fgfr4) and methods of their use |
| US12187798B2 (en) | 2016-06-20 | 2025-01-07 | Invox Pharma Limited | LAG-3 binding members |
| US12195544B2 (en) | 2018-09-21 | 2025-01-14 | Harpoon Therapeutics, Inc. | EGFR binding proteins and methods of use |
| WO2025019228A1 (en) | 2023-07-20 | 2025-01-23 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Fully human monoclonal antibodies and chimeric antigen receptors against cd276 for the treatment of solid tumors |
| US12247074B2 (en) | 2018-07-12 | 2025-03-11 | Invox Pharma Limited | Antibody molecules |
| US12252537B2 (en) | 2018-07-12 | 2025-03-18 | Invox Pharma Limited | Antibody molecules that bind CD137 and OX40 |
| EP4263612A4 (en) * | 2020-12-18 | 2025-04-02 | Bioardis LLC | Mesothelin binding molecules and uses thereof |
| US12269859B2 (en) | 2016-12-02 | 2025-04-08 | Angeles Therapeutics, Inc. | Synthetic immune receptors and methods of use thereof |
| US12297283B2 (en) | 2018-07-12 | 2025-05-13 | Invox Pharma Limited | Fc binding fragments comprising an OX40 antigen-binding site |
| US12319739B2 (en) | 2018-07-12 | 2025-06-03 | Invox Pharma Limited | Mesothelin and CD137 binding molecules |
| US12325742B2 (en) | 2018-07-12 | 2025-06-10 | Invox Pharma Limited | Anti-mesothelin antibodies |
| US12344672B2 (en) | 2018-07-12 | 2025-07-01 | Invox Pharma Limited | Antibody molecules that bind PD-L1 and CD137 |
| US12371504B2 (en) | 2017-10-13 | 2025-07-29 | Harpoon Therapeutics, Inc. | Trispecific proteins and methods of use |
| EP4333983A4 (en) * | 2021-05-07 | 2025-07-30 | Kiromic Biopharma Inc | MESOTHELIN ISOFORM-BINDING MOLECULES AND CHIMERIC PD1 RECEPTOR MOLECULES, CELLS CONTAINING THEM AND USES THEREOF |
| WO2025171238A1 (en) | 2024-02-07 | 2025-08-14 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Monoclonal antibodies that bind the juxta-membrane region of mesothelin and uses thereof |
| US12415860B2 (en) | 2018-05-14 | 2025-09-16 | Harpoon Therapeutics, Inc. | Binding moiety for conditional activation of immunoglobulin molecules |
Families Citing this family (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140004121A1 (en) | 2012-06-27 | 2014-01-02 | Amgen Inc. | Anti-mesothelin binding proteins |
| EP3327037B1 (en) * | 2012-08-21 | 2019-10-09 | The U.S.A. as represented by the Secretary, Department of Health and Human Services | Mesothelin domain-specific monoclonal antibodies and use thereof |
| WO2014100615A1 (en) | 2012-12-20 | 2014-06-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
| KR20190080992A (ko) | 2015-05-21 | 2019-07-08 | 하푼 테라퓨틱스, 인크. | 삼중특이성 결합 단백질 및 사용 방법 |
| US12144850B2 (en) | 2016-04-08 | 2024-11-19 | Purdue Research Foundation | Methods and compositions for car T cell therapy |
| PL3461261T3 (pl) | 2016-05-20 | 2025-11-12 | Harpoon Therapeutics, Inc. | Białka wiążące jednołańcuchowy fragment zmienny CD3 |
| AU2017306432A1 (en) | 2016-08-02 | 2019-03-21 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| WO2018048975A1 (en) | 2016-09-09 | 2018-03-15 | Bristol-Myers Squibb Company | Use of an anti-pd-1 antibody in combination with an anti-mesothelin antibody in cancer treatment |
| CA3044593A1 (en) | 2016-11-22 | 2018-05-31 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| KR20210087108A (ko) | 2016-11-23 | 2021-07-09 | 하푼 테라퓨틱스, 인크. | 전립선 특이 막 항원 결합 단백질 |
| MX2019006045A (es) | 2016-11-23 | 2019-11-11 | Harpoon Therapeutics Inc | Proteinas triespecificas dirigidas a psma y metodos de uso. |
| CA3051481A1 (en) | 2017-02-07 | 2018-08-16 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Phospholipid ether (ple) car t cell tumor targeting (ctct) agents |
| ES3010559T3 (en) | 2017-02-28 | 2025-04-03 | Endocyte Inc | Compositions and methods for car t cell therapy |
| WO2018232020A1 (en) | 2017-06-13 | 2018-12-20 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| IL315737A (en) | 2017-10-13 | 2024-11-01 | Harpoon Therapeutics Inc | B-cell maturation antigen-binding proteins |
| KR101966362B1 (ko) * | 2017-10-20 | 2019-04-05 | 주식회사 녹십자 | 항-msln 항체 및 이를 포함하는 암 치료용 약학적 조성물 |
| WO2019118760A1 (en) * | 2017-12-13 | 2019-06-20 | Inovio Pharmaceuticals, Inc. | Cancer vaccines targeting mesothelin and uses thereof |
| CN108129566B (zh) * | 2017-12-31 | 2021-05-11 | 中国科学院武汉病毒研究所 | 靶向间皮素的c-型单域抗体及其制备方法与应用 |
| JP7549303B2 (ja) | 2018-01-22 | 2024-09-11 | エンドサイト・インコーポレイテッド | Car t細胞の使用方法 |
| CN111936518A (zh) | 2018-02-06 | 2020-11-13 | 西雅图儿童医院(Dba西雅图儿童研究所) | 对fl-ple标记的肿瘤表现出最佳的t细胞功能的荧光素特异性car |
| CN112105382A (zh) | 2018-02-23 | 2020-12-18 | 恩多塞特公司 | 用于car t细胞疗法的顺序方法 |
| KR20210022004A (ko) * | 2018-06-18 | 2021-03-02 | 안위타 바이오사이언시스, 인코포레이티드 | 항-메소텔린 작제물 및 이의 용도 |
| BR112021003416A2 (pt) | 2018-08-30 | 2021-05-18 | TCR2 Therapeutics Inc. | composições e métodos para reprogramação de tcr usando proteínas de fusão |
| CN109406765B (zh) * | 2018-10-23 | 2022-02-01 | 大连博格林生物科技有限公司 | 细胞增殖与毒性检测试剂盒 |
| CN113874396B (zh) * | 2019-03-29 | 2024-01-05 | 株式会社绿十字 | 包含抗间皮素抗体、抗cd3抗体或抗egfr抗体的融合蛋白、包含所述融合蛋白的双特异性或三特异性抗体,及其用途 |
| PE20230467A1 (es) * | 2019-11-07 | 2023-03-14 | Eisai Randd Man Co Ltd | Conjugados de anticuerpo y farmaco de eribulina anti-mesotelina y metodos de uso |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| WO2023051414A1 (zh) * | 2021-09-30 | 2023-04-06 | 北恒医疗有限公司 | 靶向间皮素的抗体及其用途 |
| TW202321296A (zh) | 2021-10-06 | 2023-06-01 | 美商鏈接免疫療法公司 | 抗間皮素抗原結合分子及其用途 |
| PE20241177A1 (es) * | 2021-10-14 | 2024-05-28 | Teneobio Inc | Proteinas de union a la mesotelina y usos de las mismas |
| EP4416292A2 (en) | 2021-10-14 | 2024-08-21 | Arsenal Biosciences, Inc. | Immune cells having co-expressed shrnas and logic gate systems |
| CA3240254A1 (en) | 2021-12-17 | 2023-06-22 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mesothelin polypeptides, proteins, and chimeric antigen receptors |
| CN119874940A (zh) * | 2021-12-29 | 2025-04-25 | 上海细胞治疗集团股份有限公司 | 抗间皮素纳米抗体嵌合抗原受体及其应用 |
| WO2024102954A1 (en) | 2022-11-10 | 2024-05-16 | Massachusetts Institute Of Technology | Activation induced clipping system (aics) |
| CN116003638B (zh) * | 2023-01-20 | 2023-09-05 | 北京基因启明生物科技有限公司 | 一种有效杀伤胆管型肝癌的CAR-iNKT细胞技术 |
| EP4662244A1 (en) * | 2023-02-06 | 2025-12-17 | Université d'Aix Marseille | Anti-mesothelin nanobodies, constructs and conjugates |
| CN121038806A (zh) | 2023-04-25 | 2025-11-28 | 阿森纳生物科学公司 | 用于转录调控的新颖受体 |
| CN116751300A (zh) * | 2023-06-15 | 2023-09-15 | 上海斯丹赛生物技术有限公司 | 抗间皮素重链单域抗体及其在癌症治疗中的应用 |
| WO2025063790A1 (ko) * | 2023-09-20 | 2025-03-27 | 주식회사 유씨아이테라퓨틱스 | 항-메소텔린 항체 및 이의 용도 |
| WO2025143287A1 (ko) * | 2023-12-27 | 2025-07-03 | 서울대학교산학협력단 | 메소텔린에 특이적인 항체 및 이의 용도 |
| WO2025235862A1 (en) | 2024-05-10 | 2025-11-13 | Inndura Therapeutics Inc. | A modified immune cell receptor comprising a target-binding domain and the extracellular domain of cd16a |
Citations (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4036945A (en) | 1976-05-03 | 1977-07-19 | The Massachusetts General Hospital | Composition and method for determining the size and location of myocardial infarcts |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4689401A (en) | 1986-03-06 | 1987-08-25 | Cetus Corporation | Method of recovering microbially produced recombinant ricin toxin a chain |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US4892827A (en) | 1986-09-24 | 1990-01-09 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant pseudomonas exotoxins: construction of an active immunotoxin with low side effects |
| US4902505A (en) | 1986-07-30 | 1990-02-20 | Alkermes | Chimeric peptides for neuropeptide delivery through the blood-brain barrier |
| US4957735A (en) | 1984-06-12 | 1990-09-18 | The University Of Tennessee Research Corporation | Target-sensitive immunoliposomes- preparation and characterization |
| US5004697A (en) | 1987-08-17 | 1991-04-02 | Univ. Of Ca | Cationized antibodies for delivery through the blood-brain barrier |
| US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
| US5055303A (en) | 1989-01-31 | 1991-10-08 | Kv Pharmaceutical Company | Solid controlled release bioadherent emulsions |
| US5061620A (en) | 1990-03-30 | 1991-10-29 | Systemix, Inc. | Human hematopoietic stem cell |
| US5079163A (en) | 1985-03-29 | 1992-01-07 | Cetus Corporation | Recombinant ricin toxin fragments |
| US5188837A (en) | 1989-11-13 | 1993-02-23 | Nova Pharmaceutical Corporation | Lipsopheres for controlled delivery of substances |
| US5254342A (en) | 1991-09-30 | 1993-10-19 | University Of Southern California | Compositions and methods for enhanced transepithelial and transendothelial transport or active agents |
| US5268164A (en) | 1990-04-23 | 1993-12-07 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5271961A (en) | 1989-11-06 | 1993-12-21 | Alkermes Controlled Therapeutics, Inc. | Method for producing protein microspheres |
| US5413797A (en) | 1992-03-12 | 1995-05-09 | Alkermes Controlled Therapeutics, Inc. | Controlled release ACTH containing microspheres |
| US5512658A (en) | 1990-05-11 | 1996-04-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Pseudomonas exotoxins (PE) and conjugates thereof having lower animal toxicity with high cytocidal activity through substitution of positively charged amino acids |
| US5514670A (en) | 1993-08-13 | 1996-05-07 | Pharmos Corporation | Submicron emulsions for delivery of peptides |
| US5534496A (en) | 1992-07-07 | 1996-07-09 | University Of Southern California | Methods and compositions to enhance epithelial drug transport |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5602095A (en) | 1992-06-18 | 1997-02-11 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Recombinant pseudomonas exotoxin with increased activity |
| US5608039A (en) | 1990-10-12 | 1997-03-04 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Single chain B3 antibody fusion proteins and their uses |
| WO1997025068A2 (en) | 1996-01-05 | 1997-07-17 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Mesothelin antigen and methods and kits for targeting it |
| WO1999051643A1 (en) | 1998-04-03 | 1999-10-14 | The Penn State Research Foundation | Mutagenized il13-based chimeric molecules |
| US20050214304A1 (en) | 1997-12-01 | 2005-09-29 | The Government of the United States, as represented by The Secretary of Health & Human | Antibodies, including FV molecules, and immunoconjugates having high binding affinity for mesothelin and methods for their use |
| US7081518B1 (en) | 1999-05-27 | 2006-07-25 | The United States Of America As Represented By The Department Of Health And Human Services | Anti-mesothelin antibodies having high binding affinity |
| WO2007016150A2 (en) | 2005-07-29 | 2007-02-08 | THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY OF HEALTH AND HUMAN SERVICES NATIONAL INSTITUTES OF HEALTH | Mutated pseudomonas exotoxins with reduced antigenicity |
| WO2009032954A1 (en) | 2007-09-04 | 2009-03-12 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Deletions in domain ii of pseudomonas exotoxin a that reduce non-specific toxicity |
| WO2010111282A1 (en) * | 2009-03-24 | 2010-09-30 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Anti-mesothelin antibodies |
| WO2011032022A1 (en) | 2009-09-11 | 2011-03-17 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Improved pseudomonas exotoxin a with reduced immunogenicity |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2008308956B2 (en) * | 2007-10-01 | 2013-03-14 | Bristol-Myers Squibb Company | Human antibodies that bind mesothelin, and uses thereof |
| JP5608091B2 (ja) * | 2007-11-26 | 2014-10-15 | バイエル・インテレクチュアル・プロパティ・ゲゼルシャフト・ミット・ベシュレンクテル・ハフツング | 抗メソセリン抗体およびその使用 |
| WO2009120769A1 (en) * | 2008-03-27 | 2009-10-01 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Human anti-mesothelin monoclonal antibodies |
| AR076284A1 (es) * | 2009-04-29 | 2011-06-01 | Bayer Schering Pharma Ag | Inmunoconjugados de antimesotelina y usos de los mismos |
| JPWO2011074621A1 (ja) * | 2009-12-18 | 2013-04-25 | 株式会社医学生物学研究所 | メソセリン(msln)に対する抗体及びその用途 |
| PH12013501201A1 (en) * | 2010-12-09 | 2013-07-29 | Univ Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| EP3327037B1 (en) * | 2012-08-21 | 2019-10-09 | The U.S.A. as represented by the Secretary, Department of Health and Human Services | Mesothelin domain-specific monoclonal antibodies and use thereof |
-
2013
- 2013-09-16 US US14/428,771 patent/US9416190B2/en active Active
- 2013-09-16 JP JP2015534544A patent/JP6307085B2/ja active Active
- 2013-09-16 CA CA2885761A patent/CA2885761C/en active Active
- 2013-09-16 WO PCT/US2013/059883 patent/WO2014052064A1/en not_active Ceased
- 2013-09-16 CN CN201380060415.1A patent/CN104955845B/zh active Active
- 2013-09-16 ES ES13766859.6T patent/ES2666131T3/es active Active
- 2013-09-16 EP EP13766859.6A patent/EP2900695B1/en active Active
- 2013-09-16 AU AU2013324049A patent/AU2013324049B2/en active Active
Patent Citations (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4036945A (en) | 1976-05-03 | 1977-07-19 | The Massachusetts General Hospital | Composition and method for determining the size and location of myocardial infarcts |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4957735A (en) | 1984-06-12 | 1990-09-18 | The University Of Tennessee Research Corporation | Target-sensitive immunoliposomes- preparation and characterization |
| US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
| US5079163A (en) | 1985-03-29 | 1992-01-07 | Cetus Corporation | Recombinant ricin toxin fragments |
| US4689401A (en) | 1986-03-06 | 1987-08-25 | Cetus Corporation | Method of recovering microbially produced recombinant ricin toxin a chain |
| US4902505A (en) | 1986-07-30 | 1990-02-20 | Alkermes | Chimeric peptides for neuropeptide delivery through the blood-brain barrier |
| US4892827A (en) | 1986-09-24 | 1990-01-09 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant pseudomonas exotoxins: construction of an active immunotoxin with low side effects |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5004697A (en) | 1987-08-17 | 1991-04-02 | Univ. Of Ca | Cationized antibodies for delivery through the blood-brain barrier |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5055303A (en) | 1989-01-31 | 1991-10-08 | Kv Pharmaceutical Company | Solid controlled release bioadherent emulsions |
| US5271961A (en) | 1989-11-06 | 1993-12-21 | Alkermes Controlled Therapeutics, Inc. | Method for producing protein microspheres |
| US5188837A (en) | 1989-11-13 | 1993-02-23 | Nova Pharmaceutical Corporation | Lipsopheres for controlled delivery of substances |
| US5061620A (en) | 1990-03-30 | 1991-10-29 | Systemix, Inc. | Human hematopoietic stem cell |
| US5268164A (en) | 1990-04-23 | 1993-12-07 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5506206A (en) | 1990-04-23 | 1996-04-09 | Alkermes, Inc. | Increasing blood-brain barrier permeability with permeabilizer peptides |
| US5512658A (en) | 1990-05-11 | 1996-04-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Pseudomonas exotoxins (PE) and conjugates thereof having lower animal toxicity with high cytocidal activity through substitution of positively charged amino acids |
| US5608039A (en) | 1990-10-12 | 1997-03-04 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Single chain B3 antibody fusion proteins and their uses |
| US5254342A (en) | 1991-09-30 | 1993-10-19 | University Of Southern California | Compositions and methods for enhanced transepithelial and transendothelial transport or active agents |
| US5413797A (en) | 1992-03-12 | 1995-05-09 | Alkermes Controlled Therapeutics, Inc. | Controlled release ACTH containing microspheres |
| US5602095A (en) | 1992-06-18 | 1997-02-11 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Recombinant pseudomonas exotoxin with increased activity |
| US5821238A (en) | 1992-06-18 | 1998-10-13 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant pseudomonas exotoxin with increased activity |
| US5854044A (en) | 1992-06-18 | 1998-12-29 | National Institutes Of Health | Recombinant pseudomonas exotoxin with increased activity |
| US5534496A (en) | 1992-07-07 | 1996-07-09 | University Of Southern California | Methods and compositions to enhance epithelial drug transport |
| US5514670A (en) | 1993-08-13 | 1996-05-07 | Pharmos Corporation | Submicron emulsions for delivery of peptides |
| WO1997025068A2 (en) | 1996-01-05 | 1997-07-17 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Mesothelin antigen and methods and kits for targeting it |
| US6083502A (en) | 1996-01-05 | 2000-07-04 | The United States Of America As Represented By The Department Of Health And Human Services | Mesothelium antigen and methods and kits for targeting it |
| US20050214304A1 (en) | 1997-12-01 | 2005-09-29 | The Government of the United States, as represented by The Secretary of Health & Human | Antibodies, including FV molecules, and immunoconjugates having high binding affinity for mesothelin and methods for their use |
| WO1999051643A1 (en) | 1998-04-03 | 1999-10-14 | The Penn State Research Foundation | Mutagenized il13-based chimeric molecules |
| US7081518B1 (en) | 1999-05-27 | 2006-07-25 | The United States Of America As Represented By The Department Of Health And Human Services | Anti-mesothelin antibodies having high binding affinity |
| WO2007016150A2 (en) | 2005-07-29 | 2007-02-08 | THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY OF HEALTH AND HUMAN SERVICES NATIONAL INSTITUTES OF HEALTH | Mutated pseudomonas exotoxins with reduced antigenicity |
| WO2009032954A1 (en) | 2007-09-04 | 2009-03-12 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Deletions in domain ii of pseudomonas exotoxin a that reduce non-specific toxicity |
| WO2010111282A1 (en) * | 2009-03-24 | 2010-09-30 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Anti-mesothelin antibodies |
| WO2011032022A1 (en) | 2009-09-11 | 2011-03-17 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Improved pseudomonas exotoxin a with reduced immunogenicity |
Non-Patent Citations (99)
| Title |
|---|
| "Oncology Pocket Guide to Chemotherapy", 1995, MOSBY-YEAR BOOK |
| "Pierce Catalog and Handbook", 1994, PIERCE CHEMICAL CO. |
| "Remington's Pharmaceutical Science", 1995, MACK PUBLISHING COMPANY |
| "The Cancer Chemotherapy Handbook", 1993, MOSBY-YEAR BOOK |
| ALTSCHUL, J. MOL. BIOL., vol. 215, 1990, pages 403 |
| ALTSCHUL, NATURE GENET., vol. 6, 1994, pages 119 |
| ARBABI-GHAHROUDI ET AL., METHODS MOL BIOL, vol. 502, 2009, pages 341 - 364 |
| ARGANI ET AL., CLIN. CANCERRES., vol. 7, 2001, pages 3862 - 3868 |
| BANGA, A.J.: "Therapeutic Peptides and Proteins: Formulation, Processing, and Delivery Systems", 1995, TECHNOMIC PUBLISHING COMPANY, INC. |
| BAROUCH ET AL., J VIROL, vol. 79, 2005, pages 8828 - 8834 |
| BENJAMIN LEWIN: "Genes V", 1994, OXFORD UNIVERSITY PRESS |
| BETAGERI ET AL.: "Liposome Drug Delivery Systems", 1993, TECHNOMIC PUBLISHING CO., INC. |
| BRINKMANN ET AL., INT. J. CANCER, vol. 71, 1997, pages 638 |
| CARTELLIERI ET AL., J BIOMED BIOTECHNOL, vol. 2010, 2010, pages 956304 |
| CHANG ET AL., CANCER RES, vol. 52, 1992, pages 181 - 186 |
| CHANG ET AL., NATL. ACAD. SCI. USA, vol. 93, 1996, pages 136 140 |
| CHANG; PASTAN, INT. J. CANCER, vol. 57, 1994, pages 90 |
| CHANG; PASTAN, PROC NATL ACAD SCI USA, vol. 93, 1996, pages 136 - 140 |
| CHANG; PASTAN, PROC. NATL. ACAD. SCI USA, vol. 93, 1996, pages 136 |
| CHAUDHARY, NATURE, vol. 339, 1989, pages 394 - 397 |
| CHEN ET AL., J MOL BIOL, vol. 382, 2008, pages 779 - 789 |
| CHOWDHURY ET AL., MOL. IMMUNOL., vol. 34, 1997, pages 9 |
| CHOWDHURY; PASTAN, NAT BIOTECHNOL, vol. 17, 1999, pages 568 - 572 |
| CONNOR ET AL., PHARM THER, vol. 28, 1985, pages 341 - 365 |
| CONNOR ET AL., PHARM. THER., vol. 28, 1985, pages 341 - 365 |
| CORPET ET AL., NUCLEIC ACIDS RESEARCH, vol. 16, 1988, pages 10881 |
| CRAGG; GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743 |
| DI GAETANO ET AL., J IMMUNOL, vol. 171, 2003, pages 1581 - 1587 |
| E.W. MARTIN: "Remington's Pharmaceutical Sciences", 1975, MACK PUBLISHING CO. |
| FENG, MOL CANCER THER, vol. 8, 2009, pages 1113 - 1118 |
| FRANKEL ET AL., MOL. IMMUNOL., vol. 16, 1979, pages 101 - 106 |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HASSAN ET AL., APPL. IMMUNOHISTOCHEM. MOL. MORPHOL., vol. 13, 2005, pages 243 - 247 |
| HASSAN ET AL., CANCER IMMUN, vol. 7, 2007, pages 20 |
| HASSAN ET AL., CLIN CANCER RES, vol. 10, 2001, pages 3937 - 3942 |
| HASSAN ET AL., CLIN CANCER RES, vol. 8, 2002, pages 3520 - 3526 |
| HASSAN, CANCER IMMUN, vol. 7, 2007, pages 20 |
| HASSAN, CLIN. CANCER RES., vol. 10, 2004, pages 3937 - 3942 |
| HASSAN, PROC. AM. SOC. CLIN. ONCOL., vol. 21, 2002, pages 29A |
| HASSAN; HO, EUR J CANCER, vol. 44, 2008, pages 46 - 53 |
| HASSAN; HO, EUR J CANCER, vol. 44, no. 1, 2008, pages 46 - 53 |
| HIGGINS; SHARP, CABIOS, vol. 5, 1989, pages 151 |
| HIGGINS; SHARP, GENE, vol. 73, 1988, pages 237 |
| HO ET AL., CLIN CANCER RES, vol. 11, 2005, pages 3814 - 3820 |
| HO ET AL., CLIN CANCER RES, vol. 13, 2007, pages 1571 - 1575 |
| HO ET AL., INT J CANCER, vol. 128, 2011, pages 2020 - 2030 |
| HO ET AL., INT J CANCER, vol. 128, 2011, pages 2020 - 2302 |
| HO ET AL., J BIOL CHEM, vol. 280, 2005, pages 607 - 617 |
| HO, BIODRUGS, vol. 25, 2011, pages 275 - 284 |
| HO, INT J CANCER, vol. 128, 2011, pages 2020 - 2030 |
| HO, J BIOL CHEM, vol. 280, 2005, pages 607 - 617 |
| HO; PASTAN, METHODS MOL BIOL, vol. 525, 2009, pages 293 - 308 |
| IJNTEMA ET AL., INT. J. PHARM., vol. 112, 1994, pages 215 - 224 |
| JOHNSTON ET AL., PHARM. RES., vol. 9, 1992, pages 425 - 434 |
| KABAT: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES |
| KANEKO ET AL., J BIOL CHEM, vol. 284, 2009, pages 3739 - 3749 |
| KENDREW ET AL.: "The Encyclopedia of Molecular Biology", 1994, BLACKWELL SCIENCE LTD. |
| KONDO, J. BIOL. CHEM., vol. 263, 1988, pages 9470 - 9475 |
| KREIMAN ET AL., PROC. AM. SOC. CLINL O>ICOL., vol. 21, 2002, pages 22B |
| KREUTER, J.: "Colloidal Drug Delivery Systems", 1994, MARCEL DEKKER, INC., pages: 219 - 342 |
| KUBY, J.: "Immunology", 1997, W. H. FREEMAN & CO. |
| LANGER, ACCOUNTS CHEM. RES., vol. 26, 1993, pages 537 - 542 |
| LEFRANC, NUCLEIC ACIDS RES, vol. 29, 2001, pages 207 - 9 |
| LI ET AL., CANCER RES, vol. 68, 2008, pages 2400 - 2408 |
| LI ET AL., MOL. CANCER THER., vol. 7, 2008, pages 286 - 296 |
| M. HO ET AL.: "A novel high-affinity human monoclonal antibody to mesothelin.", INTERNATIONAL JOURNAL OF CANCER, vol. 128, no. 9, 1 May 2011 (2011-05-01), USA, pages 2020 - 2030, XP002715757 * |
| MCGUIRE ET AL., N. ENGL. J. MED., vol. 334, 1996, pages 1 - 6 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| OFEK ET AL., J VIROL, vol. 84, 2010, pages 2955 - 2962 |
| ONDA ET AL., CLIN CANCER RES, vol. 11, 2005, pages 5840 - 5846 |
| ONDA ET AL., PROC NATL ACAD SCI USA, vol. 105, no. 32, 2008, pages 11311 - 11316 |
| PAI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 3358 - 3362 |
| PARK, MOL THER, vol. 15, no. 4, 2007, pages 825 - 833 |
| PASTAN ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 1333, 1997, pages C1 - C6 |
| PASTAN ET AL., SCIENCE, vol. 254, 1991, pages 1173 - 1177 |
| PASTAN, NAT REV CANCER, vol. 6, 2006, pages 559 - 565 |
| PASTAN; HASSAN, NAT REV CANCER, vol. 6, 2006, pages 559 - 565 |
| PASTAN; HO: "Antibody Engineering", vol. II, 2010, SPRINGER, article "Recombinant immunotoxins for Treating Cancer", pages: 127 - 146 |
| PAWLUCZKOWYCZ ET AL., J IMMUNOL, vol. 183, 2009, pages 749 - 758 |
| PAWLUCZKOWYCZ, J IMMUNOL, vol. 183, 2009, pages 749 - 758 |
| PEARSON; LIPMAN, PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2444 |
| PEC ET AL., J. PARENT. SCI. TECH., vol. 44, no. 2, 1990, pages 58 - 65 |
| PERRY ET AL.: "Clinical Oncology", 2000, CHURCHILL LIVINGSTONE, INC, article "Chemotherapy" |
| ROBERT A. MEYERS: "Molecular Biology and Biotechnology: a Comprehensive Desk Reference", 1995, VCH PUBLISHERS, INC. |
| ROBINSON ET AL., LANCET, vol. 362, 2003, pages 1612 - 1616 |
| SIEGALL ET AL., J. BIOL. CHEM., vol. 264, 1989, pages 14256 - 14261 |
| SLAPAK; KUFE: "Harrison's Principles of Internal Medicine", article "Principles of Cancer Therapy" |
| SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| TCHOU, BREAST CANCER RES TREAT, vol. 133, no. 2, pages 799 - 804 |
| TICE; TABIBI: "Treatise on Controlled Drug Delivery", 1992, MARCEL DEKKER, INC., pages: 315 - 339 |
| WEINER ET AL., NAT REV IMMUNOL, vol. 10, 2010, pages 317 - 327 |
| WELDON ET AL., BLOOD, vol. 113, no. 16, 2009, pages 3792 - 3800 |
| WELDON, BLOOD, vol. 113, no. 16, 2009, pages 3792 - 3800 |
| Y. FENG ET AL.: "A novel human monoclonal antibody that binds with high affinity to mesothelin-expressing cells and kills them by antibody-dependent cell-mediatated cytotoxicity.", MOLECULAR CANCER THERAPEUTICS, vol. 8, no. 5, May 2009 (2009-05-01), USA, pages 1113 - 1118, XP009136266 * |
| YAMAGUCHI ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 805 808 |
| YU ET AL., J CANCER, vol. 1, 2010, pages 141 - 149 |
| YU ET AL., J CANCER, vol. 1, 2010, pages 141 - 1749 |
| YU, J CANCER, vol. 1, 2010, pages 141 - 149 |
| Z. TANG ET AL.: "A human single-domain antibody elicits potent antitumor activity by targeting an epitope in mesothelin close to the cancer cell surface.", MOLECULAR CANCER THERAPEUTICS, vol. 12, no. 4, April 2013 (2013-04-01), USA, pages 416 - 426, XP002715758 * |
Cited By (76)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3421489A1 (en) * | 2012-03-23 | 2019-01-02 | The United States of America, as represented by The Secretary, Department of Health and Human Services | Anti-mesothelin chimeric antigen receptors |
| US10640569B2 (en) | 2013-12-19 | 2020-05-05 | Novartis Ag | Human mesothelin chimeric antigen receptors and uses thereof |
| US11999794B2 (en) | 2013-12-19 | 2024-06-04 | Novartis Ag | Human mesothelin chimeric antigen receptors and uses thereof |
| WO2016133829A1 (en) * | 2015-02-17 | 2016-08-25 | Full Spectrum Genetics, Inc. | Novel sd1 binding compounds and uses thereof |
| US11965012B2 (en) | 2015-05-18 | 2024-04-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| WO2017032293A1 (zh) * | 2015-08-21 | 2017-03-02 | 科济生物医药(上海)有限公司 | 抗间皮素全人抗体以及靶向间皮素的免疫效应细胞 |
| US10793641B2 (en) | 2015-08-21 | 2020-10-06 | Carsgen Therapeutics Co., Ltd. | Fully human anti-mesothelin antibodies and immune effector cells targeting mesothelin |
| JP6994456B2 (ja) | 2015-08-21 | 2022-02-04 | カファ セラピューティクス リミテッド | 抗メソテリン完全ヒト抗体およびメソテリンを標的とする免疫エフェクター細胞 |
| JP2018529327A (ja) * | 2015-08-21 | 2018-10-11 | カースゲン セラピューティクス リミテッドCarsgen Therapeutics Limited | 抗メソテリン完全ヒト抗体およびメソテリンを標的とする免疫エフェクター細胞 |
| EP3339326A4 (en) * | 2015-08-21 | 2019-01-09 | Carsgen Therapeutics Limited | COMPLETELY HUMAN ANTI-MESOTHELIN ANTIBODY AND IMMUNE EFFECTOR CELLS OBTAINING TO MESOTHELIN |
| EP4477269A2 (en) | 2015-09-20 | 2024-12-18 | The United States of America, as Represented By the Secretary, Department of Health and Human Services | Monoclonal antibodies specific for fibroblast growth factor receptor 4 (fgfr4) and methods of their use |
| US11413340B2 (en) | 2015-12-22 | 2022-08-16 | Novartis Ag | Mesothelin chimeric antigen receptor (CAR) and antibody against PD-L1 inhibitor for combined use in anticancer therapy |
| US12186278B2 (en) | 2015-12-22 | 2025-01-07 | Novartis Ag | Mesothelin chimeric antigen receptor (CAR) and antibody against PD-L1 inhibitor for combined use in anticancer therapy |
| WO2017196847A1 (en) | 2016-05-10 | 2017-11-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Variable new antigen receptor (vnar) antibodies and antibody conjugates targeting tumor and viral antigens |
| US11453716B2 (en) | 2016-05-20 | 2022-09-27 | Harpoon Therapeutics, Inc. | Single domain serum albumin binding protein |
| US11623958B2 (en) | 2016-05-20 | 2023-04-11 | Harpoon Therapeutics, Inc. | Single chain variable fragment CD3 binding proteins |
| WO2017214182A1 (en) | 2016-06-07 | 2017-12-14 | The United States Of America. As Represented By The Secretary, Department Of Health & Human Services | Fully human antibody targeting pdi for cancer immunotherapy |
| US12187798B2 (en) | 2016-06-20 | 2025-01-07 | Invox Pharma Limited | LAG-3 binding members |
| WO2018026533A1 (en) | 2016-08-02 | 2018-02-08 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Monoclonal antibodies targeting glypican-2 (gpc2) and use thereof |
| US11377638B2 (en) | 2016-10-07 | 2022-07-05 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11085021B2 (en) | 2016-10-07 | 2021-08-10 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| EP3445787B1 (en) * | 2016-10-07 | 2020-12-02 | TCR2 Therapeutics Inc. | Compositions and methods for t-cell receptors reprogramming using fusion proteins |
| EP3848392A1 (en) * | 2016-10-07 | 2021-07-14 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| US12269859B2 (en) | 2016-12-02 | 2025-04-08 | Angeles Therapeutics, Inc. | Synthetic immune receptors and methods of use thereof |
| WO2018119279A1 (en) | 2016-12-21 | 2018-06-28 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Human monoclonal antibodies specific for flt3 and uses thereof |
| EP4219556A2 (en) | 2016-12-21 | 2023-08-02 | The United States of America as represented by The Secretary Department of Health and Human Services | Human monoclonal antibodies specific for flt3 and uses thereof |
| US11535668B2 (en) | 2017-02-28 | 2022-12-27 | Harpoon Therapeutics, Inc. | Inducible monovalent antigen binding protein |
| US20230241103A1 (en) * | 2017-03-24 | 2023-08-03 | Lentigen Technology, Inc. | Compositions and Methods for Treating Cancer with Anti-CD33 Immunotherapy |
| US20180280438A1 (en) * | 2017-03-24 | 2018-10-04 | Lentigen Technology, Inc. | Compositions and Methods for Treating Cancer with Anti-CD33 Immunotherapy |
| US11464801B2 (en) | 2017-03-24 | 2022-10-11 | Lentigen Technology, Inc. | Compositions and methods for treating cancer with anti-CD33 immunotherapy |
| US10426797B2 (en) * | 2017-03-24 | 2019-10-01 | Lentigen Technology, Inc. | Compositions and methods for treating cancer with anti-CD33 immunotherapy |
| EP3621648A4 (en) * | 2017-05-12 | 2021-01-20 | Harpoon Therapeutics, Inc. | TRISPECIFIC PROTEINS MSLN AND METHOD OF USE |
| US11607453B2 (en) | 2017-05-12 | 2023-03-21 | Harpoon Therapeutics, Inc. | Mesothelin binding proteins |
| WO2018213612A1 (en) * | 2017-05-18 | 2018-11-22 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mesothelin polypeptides and proteins |
| US11390683B2 (en) | 2017-05-18 | 2022-07-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-mesothelin polypeptides and proteins |
| WO2018213064A1 (en) | 2017-05-19 | 2018-11-22 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Human monoclonal antibody targeting tnfer2 for cancer immunotherapy |
| WO2019005208A1 (en) | 2017-06-30 | 2019-01-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | ANTIBODIES TO HUMAN MESOTHELIN AND USES IN ANTICANCER THERAPY |
| WO2019006280A1 (en) | 2017-06-30 | 2019-01-03 | Lentigen Technology, Inc. | HUMAN MONOCLONAL ANTIBODIES SPECIFIC TO CD33 AND METHODS OF USE |
| WO2019043026A1 (en) * | 2017-08-30 | 2019-03-07 | INSERM (Institut National de la Santé et de la Recherche Médicale) | ANTI-MESOTHELIC RADIOMARQUATED SINGLE DOMAIN ANTIBODIES SUITABLE FOR IMAGING AND TREATING CANCERS |
| US12371504B2 (en) | 2017-10-13 | 2025-07-29 | Harpoon Therapeutics, Inc. | Trispecific proteins and methods of use |
| WO2019094482A1 (en) | 2017-11-10 | 2019-05-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric antigen receptors targeting tumor antigens |
| US11987620B2 (en) | 2018-03-16 | 2024-05-21 | Scipher Medicine Corporation | Methods of treating a subject with an alternative to anti-TNF therapy |
| US12415860B2 (en) | 2018-05-14 | 2025-09-16 | Harpoon Therapeutics, Inc. | Binding moiety for conditional activation of immunoglobulin molecules |
| US12103976B2 (en) | 2018-07-12 | 2024-10-01 | Invox Pharma Limited | Fc binding fragments comprising a CD137 antigen-binding site |
| US12247074B2 (en) | 2018-07-12 | 2025-03-11 | Invox Pharma Limited | Antibody molecules |
| WO2020014482A1 (en) | 2018-07-12 | 2020-01-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Affinity matured cd22-specific monoclonal antibody and uses thereof |
| US12344672B2 (en) | 2018-07-12 | 2025-07-01 | Invox Pharma Limited | Antibody molecules that bind PD-L1 and CD137 |
| US12325742B2 (en) | 2018-07-12 | 2025-06-10 | Invox Pharma Limited | Anti-mesothelin antibodies |
| US12319739B2 (en) | 2018-07-12 | 2025-06-03 | Invox Pharma Limited | Mesothelin and CD137 binding molecules |
| US12297283B2 (en) | 2018-07-12 | 2025-05-13 | Invox Pharma Limited | Fc binding fragments comprising an OX40 antigen-binding site |
| US12252537B2 (en) | 2018-07-12 | 2025-03-18 | Invox Pharma Limited | Antibody molecules that bind CD137 and OX40 |
| WO2020033430A1 (en) | 2018-08-08 | 2020-02-13 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | High affinity monoclonal antibodies targeting glypican-2 and uses thereof |
| EP3844282A4 (en) * | 2018-08-29 | 2022-06-01 | Nanjing Legend Biotech Co., Ltd. | ANTI-MESOTHELIN CHIMERAL ANTIGEN RECEPTOR (CAR) CONSTRUCTS AND THEIR USES |
| WO2020043152A1 (en) | 2018-08-29 | 2020-03-05 | Nanjing Legend Biotech Co., Ltd. | Anti-mesothelin chimeric antigen receptor (car) constructs and uses thereof |
| US11932698B2 (en) | 2018-08-29 | 2024-03-19 | Nanjing Legend Biotech Co., Ltd. | Anti-mesothelin chimeric antigen receptor (CAR) constructs and uses thereof |
| US12195544B2 (en) | 2018-09-21 | 2025-01-14 | Harpoon Therapeutics, Inc. | EGFR binding proteins and methods of use |
| US11807692B2 (en) | 2018-09-25 | 2023-11-07 | Harpoon Therapeutics, Inc. | DLL3 binding proteins and methods of use |
| WO2020146182A1 (en) | 2019-01-08 | 2020-07-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Cross-species single domain antibodies targeting mesothelin for treating solid tumors |
| US12180296B2 (en) | 2019-01-08 | 2024-12-31 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Cross species single domain antibodies targeting mesothelin for treating solid tumors |
| WO2020154150A1 (en) | 2019-01-22 | 2020-07-30 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | High affinity monoclonal antibodies targeting glypican-1 and methods of use |
| US12062415B2 (en) | 2019-06-27 | 2024-08-13 | Scipher Medicine Corporation | Methods of treating a subject suffering from rheumatoid arthritis with anti-TNF therapy based in part on a trained machine learning classifier |
| US11783913B2 (en) | 2019-06-27 | 2023-10-10 | Scipher Medicine Corporation | Methods of treating a subject suffering from rheumatoid arthritis with alternative to anti-TNF therapy based in part on a trained machine learning classifier |
| WO2021081052A1 (en) | 2019-10-22 | 2021-04-29 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | High affinity nanobodies targeting b7h3 (cd276) for treating multiple solid tumors |
| US11180563B2 (en) | 2020-02-21 | 2021-11-23 | Harpoon Therapeutics, Inc. | FLT3 binding proteins and methods of use |
| WO2022010798A1 (en) * | 2020-07-06 | 2022-01-13 | Kiromic BioPharma, Inc. | Mesothelin isoform binding molecules and chimeric pd1 receptor molecules, cells containing the same and uses thereof |
| WO2022093745A1 (en) | 2020-10-26 | 2022-05-05 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies targeting sars coronavirus spike protein and uses thereof |
| EP4263612A4 (en) * | 2020-12-18 | 2025-04-02 | Bioardis LLC | Mesothelin binding molecules and uses thereof |
| WO2022232612A1 (en) | 2021-04-29 | 2022-11-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Lassa virus-specific nanobodies and methods of their use |
| EP4333983A4 (en) * | 2021-05-07 | 2025-07-30 | Kiromic Biopharma Inc | MESOTHELIN ISOFORM-BINDING MOLECULES AND CHIMERIC PD1 RECEPTOR MOLECULES, CELLS CONTAINING THEM AND USES THEREOF |
| WO2022261017A1 (en) | 2021-06-09 | 2022-12-15 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Cross species single domain antibodies targeting pd-l1 for treating solid tumors |
| WO2023076881A1 (en) | 2021-10-26 | 2023-05-04 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies targeting the s2 subunit of sars-cov-2 spike protein |
| WO2024050399A1 (en) | 2022-09-01 | 2024-03-07 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies targeting hpv e6/e7 oncogenic peptide/mhc complexes |
| WO2024050524A1 (en) | 2022-09-01 | 2024-03-07 | University Of Georgia Research Foundation, Inc. | Compositions and methods for directing apolipoprotein l1 to induce mammalian cell death |
| WO2024238346A1 (en) | 2023-05-12 | 2024-11-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Single domain antibodies that specifically bind the s2 subunit of sars-cov-2 spike protein and compositions and uses thereof |
| WO2025019228A1 (en) | 2023-07-20 | 2025-01-23 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Fully human monoclonal antibodies and chimeric antigen receptors against cd276 for the treatment of solid tumors |
| WO2025171238A1 (en) | 2024-02-07 | 2025-08-14 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Monoclonal antibodies that bind the juxta-membrane region of mesothelin and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2013324049B2 (en) | 2017-09-21 |
| JP2016500655A (ja) | 2016-01-14 |
| JP6307085B2 (ja) | 2018-04-04 |
| US20150274836A1 (en) | 2015-10-01 |
| CN104955845B (zh) | 2018-11-16 |
| AU2013324049A1 (en) | 2015-03-19 |
| CA2885761C (en) | 2021-09-21 |
| EP2900695B1 (en) | 2018-01-17 |
| CA2885761A1 (en) | 2014-04-03 |
| EP2900695A1 (en) | 2015-08-05 |
| CN104955845A (zh) | 2015-09-30 |
| US9416190B2 (en) | 2016-08-16 |
| HK1213000A1 (en) | 2016-06-24 |
| ES2666131T3 (es) | 2018-05-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9416190B2 (en) | Mesothelin antibodies and methods for eliciting potent antitumor activity | |
| AU2018202446B2 (en) | Mesothelin domain-specific monoclonal antibodies and use thereof | |
| US10640571B2 (en) | Human monoclonal antibodies specific for glypican-3 and use thereof | |
| US9409994B2 (en) | High-affinity monoclonal antibodies to glypican-3 and use thereof | |
| HK1213000B (en) | Mesothelin antibodies and methods for eliciting potent antitumor activity |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13766859 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013766859 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14428771 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2013324049 Country of ref document: AU Date of ref document: 20130916 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2885761 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2015534544 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |