WO2014018679A2 - Nme variant species expression and suppression - Google Patents

Nme variant species expression and suppression Download PDF

Info

Publication number
WO2014018679A2
WO2014018679A2 PCT/US2013/051899 US2013051899W WO2014018679A2 WO 2014018679 A2 WO2014018679 A2 WO 2014018679A2 US 2013051899 W US2013051899 W US 2013051899W WO 2014018679 A2 WO2014018679 A2 WO 2014018679A2
Authority
WO
WIPO (PCT)
Prior art keywords
cells
family member
nme1
state
nme7
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/051899
Other languages
English (en)
French (fr)
Other versions
WO2014018679A3 (en
Inventor
Cynthia Bamdad
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Minerva Biotechnologies Corp
Original Assignee
Minerva Biotechnologies Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/US2012/060684 external-priority patent/WO2013059373A2/en
Priority to CA2880010A priority Critical patent/CA2880010A1/en
Priority to EP22198880.1A priority patent/EP4206318A1/en
Priority to SG11201606118SA priority patent/SG11201606118SA/en
Priority to AU2013295811A priority patent/AU2013295811A1/en
Priority to JP2015524428A priority patent/JP6546087B2/ja
Priority to EP13823099.0A priority patent/EP2877586A4/en
Priority to CN201380049792.5A priority patent/CN104995518A/zh
Application filed by Minerva Biotechnologies Corp filed Critical Minerva Biotechnologies Corp
Publication of WO2014018679A2 publication Critical patent/WO2014018679A2/en
Priority to IL307628A priority patent/IL307628A/en
Priority to CN201480022551.6A priority patent/CN105229027A/zh
Priority to KR1020217019794A priority patent/KR20210082547A/ko
Priority to EP14753856.5A priority patent/EP2958940A4/en
Priority to KR1020157026033A priority patent/KR20150121131A/ko
Priority to JP2015558975A priority patent/JP6577872B2/ja
Priority to CA2901893A priority patent/CA2901893C/en
Priority to AU2014218872A priority patent/AU2014218872A1/en
Priority to IL240695A priority patent/IL240695B2/en
Priority to PCT/US2014/017515 priority patent/WO2014130741A2/en
Priority to US14/468,106 priority patent/US20150089677A1/en
Priority to US14/604,579 priority patent/US20150203823A1/en
Anticipated expiration legal-status Critical
Priority to IL236901A priority patent/IL236901B/en
Publication of WO2014018679A3 publication Critical patent/WO2014018679A3/en
Priority to US14/831,825 priority patent/US20160326263A1/en
Priority to US15/910,894 priority patent/US20180258186A1/en
Priority to AU2019202199A priority patent/AU2019202199B2/en
Priority to AU2019203098A priority patent/AU2019203098B2/en
Priority to JP2019109262A priority patent/JP6862497B2/ja
Priority to US17/306,477 priority patent/US20220089779A1/en
Priority to US17/449,932 priority patent/US20220193270A1/en
Priority to US17/548,312 priority patent/US20220218846A1/en
Priority to US17/935,854 priority patent/US20230049461A1/en
Priority to US18/439,331 priority patent/US20240277803A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0696Artificially induced pluripotent stem cells, e.g. iPS
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/48Reproductive organs
    • A61K35/54Ovaries; Ova; Ovules; Embryos; Foetal cells; Germ cells
    • A61K35/545Embryonic stem cells; Pluripotent stem cells; Induced pluripotent stem cells; Uncharacterised stem cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/45Transferases (2)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0603Embryonic cells ; Embryoid bodies
    • C12N5/0606Pluripotent embryonic cells, e.g. embryonic stem cells [ES]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0693Tumour cells; Cancer cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/70Enzymes
    • C12N2501/72Transferases [EC 2.]
    • C12N2501/727Kinases (EC 2.7.)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/998Proteins not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2506/00Differentiation of animal cells from one lineage to another; Differentiation of pluripotent cells

Definitions

  • the present application relates to the field of manipulating the expression of NME family proteins and their associated factors to regulate stem-like growth and treat cancer.
  • NM23 exists as a family of proteins wherein the commonality among these proteins is the presence of a nucleoside diphosphate kinase (NDPK) domain that catalyzes the conversion of ATP to ADP.
  • NDPK nucleoside diphosphate kinase
  • Leukemia cells are blood cells that are blocked from terminal differentiation. Interestingly, the ability to inhibit differentiation of leukemia cells was shown to be independent of its catalytic domain. Mutations in the NDPK domain that abrogated its enzymatic activity had no effect on the protein' s ability to block differentiation of some types of leukemia cells. However, the scientific literature of the following decades paints a picture of total confusion as to whether NM23 inhibits differentiation, accelerates differentiation or has no effect at all.
  • NM23 inhibited erythroid differentiation of leukemia cell lines HEL, KU812, and K562 but not monocyte or granulocyte differentiation of progenitors HL60, U937, or HEL/S cells.
  • Venturelli et al 1995 reported that NM23 overexpression inhibited G-CSF dependent granulocyte differentiation of human hematopoietic progenitors.
  • Willems et al 1998 found that NM23 expression decreases as human CD34 + hematopoietic progenitors from the bone marrow cells differentiate.
  • Willems et al showed that NM23 had no effect on cell proliferation, did not induce or inhibit differentiation but skewed differentiation of CD34+ cells toward the erythroid lineage.
  • proteins In biological systems, proteins often make up complicated signaling cascades that direct the cell to behave in a particular way.
  • a common way that cells are directed to begin the process of dividing is that a protein (ligand) binds to the extra cellular domain of a transmembrane protein receptor wherein binding of the ligand to the extra cellular domain confers a change in the conformation of the receptor.
  • the ligand-induced conformational change can take place in the extra cellular domain, the intra cellular domain or both and results in a change in which proteins or molecules are able to bind to the receptor.
  • This outside to inside signaling is a common mechanism that is used to signal cells to divide, initiate programmed cell death and many other processes.
  • One commonly used mechanism that regulates the activity of growth factor receptors is ligand-induced dimerization of the receptor's extra cellular domain which in turn brings the intracellular tails close together which makes a good docking site for modifying proteins such as kinases that initiate a signaling cascade that eventuates in a signal to the cell's nucleus that causes the cell to divide.
  • Ligand-induced dimerization of the extra cellular domain of growth factor receptors is often accomplished through the binding of ligand dimers; that is two ligands non- covalently bind to each other to form homo- or hetero-dimers which then bind to two receptors that are either the same (homo) or different (hetero).
  • ligand-induced receptor dimerization is NM23 dimers binding to and dimerizing the extra cellular domain of MUC1*, which is the truncated form of the MUC1 transmembrane protein that is tumor and stem cell specific.
  • the ligand is a monomer, dimer or a higher order multimer is a function of, among other things, its concentration.
  • the dimeric form of the ligand activates the growth factor receptor.
  • there are feedback loops wherein the higher order multimers turn off the function that is promoted by the dimer.
  • the CI protein of Phage lambda turns on transcription of one set of genes when it is bound to DNA as a tetramer but turns off transcription of those genes when, as a function of increased concentration, the CI protein becomes an octamer. Therefore, it would be advantageous to discover if such multimerization-regulated feedback loops that regulate function exist in higher order organisms, such as humans, and to develop methods to manipulate function based on the knowledge of the function of each multimer.
  • the present invention is directed to a method for generating less mature cells from starting cells comprising inducing the starting cells to revert to a less mature state comprising increasing the amount of an NME family member whose multimerization state is the biologically active state or decreasing the relative amount of an NME family member whose multimerization state is the biologically inactive state.
  • the invention is directed to a method of inhibiting differentiation of embryonic stem cell, induced pluripotent stem cell or progenitor cell comprising increasing the amount of an NME family member whose multimerization state is the biologically active state or decreasing the relative amount of an NME family member whose multimerization state is the biologically inactive state.
  • the invention is directed to a method of maintaining or inducing pluripotency in cells comprising decreasing the relative amount of an NME family member whose multimerization state is the biologically inactive state.
  • the invention is directed to a method of inhibiting differentiation in embryonic stem cell, induced pluripotent stem cell, or progenitor cell, comprising decreasing the relative amount of an NME family member whose multimerization state is the biologically inactive state.
  • the NME family member's multimerization state in the biologically inactive state may be a hexamer or higher order multimer.
  • such NME family member may be NME1 (NM23-H1) or NME2 (NM23-H2).
  • the NME family member's multimerization state in the biologically active state may be a dimer or a monomer that contains two units able to bind to the same target receptor.
  • such NME family member may be a mutant or variant of NME1 that favors dimerization or has two binding domains for its cognate ligand, or NME6 or NME7.
  • the relative amount of the NME family member whose multimerization state is the biologically inactive state may be decreased by adding an NME family member whose multimerization state is the biologically active state.
  • the NME family member whose multimerization state is the biologically active state may be increased by introducing a nucleic acid or small molecule that causes it to be expressed.
  • the relative amount of the NME family member whose multimerization state is the biologically inactive state may be decreased by introducing nucleic acids or small molecules that down-regulate its expression.
  • the NME family member whose multimerization state is the biologically inactive state may be decreased and the NME family member whose multimerization state is the biologically active state may be increased by simultaneously introducing a first nucleic acid that down-regulates a first NME that forms the inactive state and a second nucleic acid that up-regulates the NME that forms the active state.
  • the nucleic acid that down-regulates may be an anti-sense DNA, an inhibitory RNA, siRNA or shRNA and the nucleic acid that up- regulates is an encoding DNA, RNA, mRNA, or plasmid.
  • Such nucleic acid may be modified to facilitate entry into the cell.
  • the NME family member that may be down regulated may include NMEl , NME2 or NMEl and NME2.
  • the NME family member that may be up-regulated may be a mutant or variant of NMEl, NME2 that prefers dimerization, NME6 or NME7.
  • the present invention is directed to a nucleic acid that causes expression of NMEl mutant or variant that prefers dimer formation or has two binding domains of the same ligand; and/or
  • nucleic acid that causes expression of NME6 a nucleic acid that causes expression of NME6;
  • nucleic acid that down-regulates NMEl or NMEl and NME2.
  • the invention is directed to a media for culturing stem or progenitor cells wherein the media contains:
  • NMEl mutant or variant that prefers dimer formation or has two binding domains of the same ligand [0030] a. NMEl mutant or variant that prefers dimer formation or has two binding domains of the same ligand; and/or
  • nucleic acid that causes expression of NMEl mutant or variant that prefers dimer formation or has two binding domains of the same ligand;
  • nucleic acid that causes expression of NME7 a nucleic acid that causes expression of NME7;
  • nucleic acid that causes expression of NME6 a nucleic acid that causes expression of NME6;
  • g a nucleic acid that down-regulates NMEl or NMEl and NME2.
  • the invention is directed to a media for inducing pluripotency or for inducing cells to revert to a less mature state wherein the media contains:
  • NMEl mutant or variant that prefers dimer formation or has two binding domains of the same ligand and/or [0039] b. a nucleic acid that causes expression of NME1 mutant or variant that prefers dimer formation or has two binding domains of the same ligand; and/or
  • nucleic acid that causes expression of NME7 a nucleic acid that causes expression of NME7;
  • nucleic acid that causes expression of NME6 a nucleic acid that causes expression of NME6;
  • g. contains a nucleic acid that down-regulates NME1 or NME1 and NME2.
  • the media may also contain nucleic acids that encode some or all of the pluripotency-inducing genes or small molecules including OCT4, SOX2, NANOG, KLF4, and c-Myc.
  • the invention is directed to a host cell that carries a synthetic nucleic acid that causes decreased expression of an NME family member whose multimerization state is the biologically inactive state.
  • the NME family member may be NME1 , NME2 or NME1 and NME2.
  • the invention is directed to a host cell that carries a synthetic nucleic acid that causes increased expression of an NME family member whose multimerization state is the biologically active state.
  • the NME family member may include an NME1 mutant or variant that prefers dimer formation or has two binding domains of the same ligand, NME6, or NME7.
  • the invention is directed to a host cell that carries a synthetic nucleic acid that causes decreased expression of an NME family member whose multimerization state is the biologically inactive state and a synthetic nucleic acid that causes increased expression of an NME family member whose multimerization state is the biologically active state.
  • the NME family member whose expression will be decreased may be NME1 or NME1 and NME2 and the NME family member whose expression will be increased may be an NME1 mutant or variant that prefers dimer formation or has two binding domains of the same ligand, and/or NME6, and/or NME7.
  • the cell may also carry a nucleic acid that causes the expression of a gene that is either not expressed in the host cell or is mutated in the host cell.
  • the host cell may also carry a nucleic acid to down- regulate an unwanted gene and up-regulates a desired or corrected gene.
  • the host cell may be an embryonic stem cell, induced pluripotent stem cell, progenitor cell, or somatic cell.
  • the invention is directed to a method of treating a patient wherein the cells described above are administered to the patient.
  • the cells may be administered by bone marrow transplant, transplant into a specific site, transfusion, injection, or topical treatment.
  • the treatment may be for any disease or condition that would be alleviated by treatment with stem cells, progenitors, or by correction of a genetic abnormality or defect.
  • the cells may be differentiated prior to administration to patient and wherein NME1, NME6 or NME7 are withdrawn during differentiation process.
  • the invention is directed to a method of treating cancer in a patient comprising administering an agent to the patient such that the agent increases the amount of an NME family member whose multimerization state is the biologically inactive state or decreases the relative amount of an NME family member whose multimerization state is the biologically active state.
  • the NME family member whose multimerization state is the biologically active state may be NME7
  • the NME family member whose multimerization state is the biologically inactive state may be NME1, NME2 or NME8.
  • Figures 1 A-F show photographs of Western blots detecting the presence of NME1 (A,D), NME6 (B,E) or NME7 (C,F) in human stem cells cultured in NM23-S120G dimers, cultured in bFGF over MEFs or human breast cancer cells or the presence of the NME isoforms in a MUC1* pull-down assay.
  • Figure 2 is a photograph of a Western blot of human embryonic stem cell ly sates probed with an antibody specific for NME7.
  • Figure 3 shows photographs of human BGOlv embryonic stem cells that remain pluripotent and undifferentiated after several days in culture in NME1-S120G dimers present at a range of concentrations.
  • Figure 4 shows photographs of human BGOlv embryonic stem cells that have differentiated and are no longer pluripotent after several days in culture in NME 1 -wild type hexamers present at a range of concentrations.
  • Figure 5 shows photographs of human BGOlv embryonic stem cells that have differentiated and are no longer pluripotent after several days in culture in a mixture of 20% NME1-S120G dimers and 80% NMEl-wild type hexamers present at a range of concentrations.
  • Figure 6 is a graph showing quantitative PCR measurements of the expression levels of pluripotent, naive and primed genes in human embryonic H9 stem cells cultured for up to 37 passages in NME1-S120G dimers, compared to the same source cells cultured in bFGF.
  • Figures 7A-B show photographs of human stem cells in which siRNAs specific for NME1, NME6 and NME7 have been used to suppress expression of the three NM23 isoforms.
  • Figures 8 A-F show photographs of human stem cells in which siRNAs specific for NME1 , NME6 and NME7 have been used to suppress expression of the three NM23 isoforms either separately or in combinations.
  • Figures 9A-D show photographs of human stem cells in which differentiation induced by suppression of NME7 is rescued if cells are treated with recombinant NME1 purified as stable dimers.
  • Figure 10A-B show photographs of human stem cells in which siRNAs specific for NME1, NME6 and NME7 have been used to suppress expression of all three NM23 isoforms and that inhibition of cell growth and differentiation induced by suppressing all three NMEs is rescued by treating cells with recombinant NME1 purified as stable dimers.
  • Figures 11A-D show magnified photographs of human stem cells in which expression of NME1 (A,C) or NME7 (B,D) has been suppressed using siRNAs, or suppressed but wherein the suppressed cells are treated with recombinant NME1 purified as stable dimers (C,D).
  • Figures 12A-D show magnified photographs of human stem cells in which expression of NME1 (A,C) or NME7 (B,D) has been suppressed using siRNAs, or suppressed but rescued by also treating cells with recombinant NME1 purified as stable dimers (C,D).
  • Figures 13A-D show magnified photographs of human stem cells in which expression of NME1, NME6 and NME7 are suppressed (A,C) or NME1 and NME7 are suppressed (B,D), wherein cells are rescued to some extent by culturing the cells in recombinant NME1 purified as stable dimers (C,D).
  • Figure 14 shows a graph of an RT-PCR experiment in which expression of pluripotency genes NANOG, OCT4 and KLF4 or differentiation marker FOXA2, plus NMEl , NME6 and NME7 genes are measured in human stem cells in which either NMEl , NME6 or NME7 has been suppressed or "Knocked Out”; controls are a mock transfection and the same stem cells that have differentiated.
  • a striking increase in differentiation marker FOXA2 is seen in NME knock out cells and in the differentiation control.
  • a significant increase in the expression of NMEl is observed when NME6 or NME7 is suppressed.
  • Figure 15 shows a graph of an RT-PCR experiment in which expression of pluripotency genes NANOG, OCT4 and KLF4 or differentiation marker FOXA2, plus NMEl , NME6 and NME7 genes are measured in human stem cells in which NMEl has been Knocked Out (KO) wherein one set of NMEl suppressed cells has been cultured in media supplemented with human recombinant NMEl dimer form; control is the same stem cells that have been allowed to differentiate.
  • KO Knocked Out
  • a striking increase in differentiation marker FOXA2 is seen in NMEl knock out cells and in the differentiation control.
  • Figure 16 shows a graph of an RT-PCR experiment in which expression of pluripotency genes NANOG, OCT4 and KLF4 or differentiation marker FOXA2, plus NMEl , NME6 and NME7 genes are measured in human stem cells in which NME6 has been Knocked Out (KO) wherein one set of NME6 suppressed cells has been cultured in media supplemented with human recombinant NMEl dimer form; control is the same stem cells that have been allowed to differentiate.
  • KO Knocked Out
  • Figure 17 shows a graph of an RT-PCR experiment in which expression of pluripotency genes NANOG, OCT4 and KLF4 or differentiation marker FOXA2, plus NMEl , NME6 and NME7 genes are measured in human stem cells in which NME7 has been Knocked Out (KO) wherein one set of NME7 suppressed cells has been cultured in media supplemented with human recombinant NMEl dimer form; control is the same stem cells that have been allowed to differentiate.
  • a striking increase in differentiation marker FOXA2 is seen in NME7 suppressed cells in addition to a significant increase in the expression of NMEl . Both return to an almost normal state when the suppressed cells are cultured in a minimal media supplemented with NMEl in dimer form.
  • Figure 18 shows a graph of an RT-PCR experiment in which expression of pluripotency genes NANOG, OCT4 and KLF4 or differentiation marker FOXA2, plus NMEl , NME6 and NME7 genes are measured in human stem cells in which NMEl, NME6 and NME7 have been suppressed (KO) wherein one set of suppressed cells has been cultured in media supplemented with human recombinant NMEl dimer form; control is the same stem cells that have been allowed to differentiate.
  • a striking increase in differentiation marker FOXA2 is seen in the suppressed cells, wherein suppressed cells that are cultured in a minimal media supplemented with NME1 in dimer form return to a near normal gene profile.
  • Figure 19 shows a graph of an RT-PCR experiment in which expression of pluripotency genes NANOG, OCT4 and KLF4 or differentiation marker FOXA2, plus NME1 , NME6 and NME7 genes are measured in human stem cells in which NME1 and NME7 have been suppressed (KO) wherein one set of suppressed cells has been cultured in media supplemented with human recombinant NME1 dimer form; control is the same stem cells that have been allowed to differentiate.
  • Figure 20 shows a graph of an ELISA assay in which a synthetic PSMGFR peptide of the MUC1 * extra cellular domain is immobilized on the surface of a multi-well plate and three different recombinant human NME6 proteins are assayed for binding to the peptide, wherein one is the wild type human NME6 that has been denatured and refolded (NME6 WT RS), the second is a human NME6 wherein the region that contributes to dimerization is swapped to a sea sponge sequence (NME6 HuToS), and the third is a mutant NME6 S139G, which is in a comparable position to the NME1 mutant identified in cancers that prefers dimerization. All demonstrate binding to the peptide of the extra cellular domain of MUC1 *.
  • NME6 WT RS wild type human NME6 that has been denatured and refolded
  • NME6 HuToS the region that contributes to dimerization is swapped to a sea sponge sequence
  • Figures 21A-B show graphs of ELISA assays in which a synthetic PSMGFR peptide of the MUC1 * extra cellular domain is immobilized on the surface of a multi-well plate and different recombinant human NME8 proteins are assayed for binding to the peptide, wherein one is a construct containing only NME8 domains A and B (NME8 1-2) and the other is a construct containing only NME8 domains B and C (NME8 2-3).
  • the NME variants tested were either expressed in soluble form or were refolded (RS). In some cases, DTT was added to break up large oligomers. All demonstrate binding to the peptide of the extra cellular domain of MUC1 *. NM23 S120G dimers are added for comparison to the binding of the NME8 constructs (A).
  • Figures 22A-D show magnified photographs of human stem cells at 96 hours post transfection of siRNA to suppress NME1 expression (A,B) and control cells wherein transfection reagents were added but with either no siRNA or a scrambled sequence siRNA (C,D). Comparison of NME1 suppressed cells to the control cells shows very little difference. Note that stem cells were plated over a layer of bivalent anti-MUC 1 * antibody which also functions as a MUC 1 * stimulating growth factor.
  • Figures 23A-D show magnified photographs of human stem cells at 96 hours post transfection of siRNA to suppress NME7 expression (A,B) and control cells wherein pluripotency gene Oct4 was suppressed (C,D). Comparison of NME7 suppressed cells to the OCT4 suppressed cells shows very little difference, wherein both have severely inhibited cell viability and remaining cells have taken on a fibroblast morphology.
  • Figure 24 shows magnified photographs of human stem cells at 96 hours post transfection of siRNA to suppress NME6 expression (A,B) and control cells wherein transfection reagents were added but with either no siRNA or a scrambled sequence siRNA (C,D). Comparison of NME6 suppressed cells to the control cells shows very little difference, although NME6 suppressed cells had areas of differentiating cells as can be seen as the brighter, thickening center of the cell cluster in Panel B. Note that stem cells were plated over a layer of bivalent anti-MUCl * antibody which also functions as a MUC1* stimulating growth factor.
  • Figure 25 shows a graph of an RT-PCR experiment in which expression of pluripotency genes NANOG, OCT4 and KLF4 or differentiation marker FOXA2, plus NME1 , NME6 and NME7 genes are measured in human stem cells 96 hours post transfection of siRNA to suppress NME1, NME6 or NME7. A minimal media free of growth factors, serum or cytokines was changed every 48 hours, but note that stem cells were plated over a layer of bivalent anti-MUCl * antibody which also functions as a MUC1* stimulating growth factor. Suppression of NME7 shows a marked increase in the expression of differentiation marker FOXA2.
  • Figures 26A-D show magnified photographs of human HES-3 stem cells that have been cultured in a minimal media free of growth factors, serum or cytokines and supplemented with either NME7 monomers (A,C) or NME1 (NM23-H1) dimers (B,D).
  • FIGs 27A-B show graphs of an ELISA sandwich assay that shows that NME7 monomers have two binding sites for the PSMGFR peptide of the MUC1 * extra cellular domain.
  • a synthetic PSMGFR peptide is immobilized on the surface of a multi-well plate and recombinant human NME7 (A and B domains and devoid of the M leader sequence) proteins are assayed for binding to the peptide (A), then bound by a histidine-tagged PSMGFR peptide, which is detected using an antibody to its histidine tag (B).
  • Figure 28 shows a graph of T47D breast cancer cell growth as a function of concentration of NME1 hexamers; experiment shows NME1 hexamers inhibit cancer cell growth.
  • Figures 29A-E show a graph of percent invasion of DU145 prostate cancer cells in response to treatment with NMEl hexamers, over a range of concentrations (A) and photographs of the cell migration assay wells (B-E) in which a cross is etched across a field of growing cancer cells and their ability to migrate across the gap is measured as a function of time.
  • Photographs were taken at time zero (B,C) and at 16 hours (D,E), wherein NMEl hexamers at 12 uM were added to the cells (C,E) and buffer alone was added to control cells (B,D). NMEl hexamers inhibited cancer cell migration.
  • Figures 30A-K show a graph of percent invasion of DU145 prostate cancer cells in response to treatment with NMEl dimers, over a range of concentrations (A) and photographs of the cell migration assay wells (B-K) in which a slash mark is etched across a field of growing cancer cells at time zero (B-F) and their ability to migrate across the gap is measured at 16 hours (G-K).
  • NMEl dimers did not inhibit cancer cell migration. Note that NMEl dimers induce cancer cell growth at optimal concentrations (4-16 nM) wherein one nMEl dimer dimerizes two MUC1* receptors; at very high concentrations, each NMEl dimer binds to a single MUC 1 * receptor and inhibits cancer cell growth and migration.
  • biologically active NME multimer includes NME multimer that induces the starting cells to revert to a less mature state or inhibits differentiation of immature cells, or maintains the immature state of a cell.
  • biologically inactive NME multimer includes NME multimer that does not induce the starting cells to revert to a less mature state or does not inhibit differentiation of immature cells, or does not maintain an immature state of the cell.
  • increasing MUC1* activity refers to directly or indirectly increasing MUC1* signaling, and includes without limitation the dimerization of MUC1* receptor and also increased production of MUC1* by cleavage of the MUC1 receptor.
  • MUC1* activity may be also increased by higher transcriptional expression of MUC1 receptor, which is further cleaved and dimerized. Therefore, in one aspect, MUC1* activity may be increased by a higher activity of the effector molecule that dimerizes MUC1*, or the higher activity of the cleavage molecule that cleaves MUC1 so that MUC1* is formed, or increased expression of the MUC1.
  • any chemical or biological species that is able to increase the activity of the MUC1 * dimerizing ligand, MUC1 cleavage enzyme to form MUC1*, or any transcriptional activator that enhances expression of MUC1, is encompassed as a species that "increases MUC1 * activity".
  • MUC1 Growth Factor Receptor is a functional definition meaning that portion of the MUC 1 receptor that interacts with an activating ligand, such as a growth factor or a modifying enzyme such as a cleavage enzyme.
  • the MGFR region of MUC1 is that extracellular portion that is closest to the cell surface and is defined by most or all of the PSMGFR, as defined below.
  • the MGFR is inclusive of both unmodified peptides and peptides that have undergone enzyme modifications, such as, for example, phosphorylation, glycosylation and so forth.
  • PSMGFR Primary Sequence of the MUC1 Growth Factor Receptor
  • the PSMGFR is defined as SEQ ID NO: 6, and all functional variants and fragments thereof having any integer value of amino acid substitutions up to 20 (i.e. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) and/or any integer value of amino acid additions or deletions up to 20 at its N- terminus and/or C-terminus.
  • a "functional variant or fragment” in the above context refers to such variant or fragment having the ability to specifically bind to, or otherways specifically interact with, ligands that specifically bind to, or otherwise specifically interact with, the peptide of SEQ ID NO: 6, while not binding strongly to identical regions of other peptide molecules identical to themselves, such that the peptide molecules would have the ability to aggregate (i.e. self-aggregate) with other identical peptide molecules.
  • a PSMGFR that is a functional variant of the PSMGFR peptide of SEQ NO:6 is SEQ ID NO:8, which differs from SEQ ID NO:6 by including an -SPY- sequence instead of the -SRY-.
  • MUC1 * refers to the MUC1 protein with the N-terminus truncated such that the extracellular domain is essentially comprised of the PSMGFR (SEQ ID NO:5).
  • MUC 1 * associated factors refers to agents that modify, activate, modulate the activity of, or modulate the expression of MUC1*.
  • MUC1* associated factors include, without limitation, agents that affect dimerization of MUC1* receptor, increased production of MUC1*, induce cleavage of the MUC1 receptor, agents that increase MUC1* activity by higher transcriptional expression of MUC 1 receptor, which is further cleaved and dimerized.
  • effective amount is an amount sufficient to effect beneficial or desired clinical or biochemical results. An effective amount can be administered one or more times.
  • an effective amount of an inhibitor compound is an amount that is sufficient to induce or maintain pluripotency of a cell or activate MUC1 *
  • fragments or “functional derivatives” refers to biologically active amino acid sequence variants and fragments of the native ligands or receptors of the present invention, as well as covalent modifications, including derivatives obtained by reaction with organic derivatizing agents, post-translational modifications, derivatives with nonproteinaceous polymers, and immunoadhesins.
  • immature cells refers to cells that can undergo at least one more step of differentiation and expresses markers of a particular cell type that is known to be able to undergo at least one more step of differentiation.
  • cell having less mature state than starting cell refers to a cell that has de-differentiated so that it has an increased ability to differentiate into a different cell type than the starting cell or has an increased ability to differentiate into more cell types than the starting cell.
  • a cell in a less mature state can be identified by measuring an increase in the expression of pluripotency markers, by a determination that the expression levels of pluripotency markers are closer to those of pluripotent stem cells or by measuring markers of a less mature state than the starting cells.
  • hematopoietic stem cells that can differentiate into any blood cell type are characterized by the expression of CD34 and the absence of CD38.
  • the technique of transdifferentiation involves reverting starting cells to a less mature state wherein the cells become unstable and can be directed to differentiate into a differentiate cell type than the starting cell, even if the starting cell was at the same relative level of differentiation as the resultant cell (Ieda et al 2010; Efe et al 2011).
  • cardio fibroblasts have been reverted to a less mature state by brief ectopic expression of OCT4, SOX2, KLF4 and c-MYC, then from this unstable state, differentiated into cardiomyocytes.
  • ligand refers to any molecule or agent, or compound that specifically binds covalently or transiently to a molecule such as a polypeptide.
  • ligand may include antibody.
  • ligand may refer to a molecule sought to be bound by another molecule with high affinity, such as but not limited to a natural or unnatural ligand for MUC1 * or a cleaving enzyme binding to MUC1 or MUC1* or a dimerizing ligand for MUC1 *.
  • Naive stem cells are those that resemble and share quantifiable characteristics with cells of the inner mass of a blastocyst. Naive stem cells have quantifiable differences in expression of certain genes compared to primed stem cells, which resemble and share traits and characteristics of cells from the epiblast portion of a blastocyst. Notably, naive stem cells of a female source have two active X chromosomes, referred to as XaXa, whereas the later primed stem cells of a female source have one of the X chromosomes inactivated (Nichols and Smith, ).
  • NME family proteins is a family of ten (10) proteins, some of which have been recently discovered, wherein they are categorized by their shared sequence homology to nucleoside diphosphate kinase (NDPK) domains, even though many of the NME family members are incapable of kinase activity. NME proteins were previously known as NM23-H1 and NM23-H2 then NM23-H3 through NM23-10 as they were being discovered. The different NME proteins function differently.
  • NME1 and NME6 bind to and dimerize the MUC1 * receptor (wherein its extra cellular domain is comprised essentially of the PSMGFR sequence) when they are in dimer form; NME7 has two (2) binding sites for MUC1* receptor extra cellular domain and also dimerizes the receptor.
  • NME1 dimers, NME6 dimers and NME7 are the preferred NME family members for use as MUC1* ligands to induce or maintain cells in a less mature state than the starting cells.
  • Other NME family members that are able to bind to and dimerize the MUC1* receptor are also contemplated for use as MUC1 * ligands to induce or maintain cells in a less mature state than the starting cells.
  • pluripotency markers are those genes and proteins whose expression is increased when cells revert to a less mature state than the starting cells.
  • Pluripotency markers include OCT4, SOX2, NANOG, KLF4, KLF2, Tra 1-60, Tra 1-81, SSEA4, and REX-1 as well as others previously described and those currently being discovered.
  • fibroblast cells express no detectable or low levels of these pluripotency markers, but express a fibroblast differentiation marker called CD 13. To determine if a cell is becoming less mature than the starting cells, one could measure a difference in the expression levels of the pluripotency markers between the starting cells and the resultant cells.
  • “primed stem cells” are cells that resemble and share traits and characteristics of cells from the epiblast portion of a blastocyst.
  • the term “specifically binds” refers to a non-random binding reaction between two molecules, for example between an antibody molecule immunoreacting with an antigen, or a non-antibody ligand reacting with another polypeptide, such as NM23 specifically binding with MUC1* or an antibody binding to MUC1* or a cleaving enzyme binding to MUC1 or MUC1*.
  • pluripotent stem cell refers to stem cells that can differentiate to all three germlines, endoderm, ectoderm and mesoderm, to differentiate into any cell type in the body, but cannot give rise to a complete organism.
  • a totipotent stem cell is one that can differentiate or mature into a complete organism such as a human being.
  • embryonic pluripotent stem cells they are cells derived from the inner cell mass of a blastocyst. Typical markers of pluripotency are OCT4, KLF4, NANOG, Tra 1-60, Tra 1-81 and SSEA4.
  • multipotent stem cells refer to stem cells that can differentiate into other cell types wherein the number of different cell types is limited.
  • pluripotent or pre-iPS state refers to a cell that has some or all of the morphological characteristics of a pluripotent stem cell, but its level of expression of the pluripotency markers or its ability to differentiate to all three germlines is less than that of a pluripotent stem cell.
  • stem-like morphology refers to a morphology that resembles that of a stem cell, a level of expression of one or more of the pluripotency genes, or an ability to differentiate into multiple cell types.
  • Stem-like morphology is when the cells have a rounded shape, and are rather small compared to the size of their nucleus, which is often has a large nucleus to cytoplasm ratio, which is characteristic of pluripotent stem cells.
  • fibroblast morphology is when cells have a long, spindly shape and do not have a large nucleus to cytoplasm ratio.
  • pluripotent stem cells are non-adherent, whereas other cell types, such as fibroblasts, are adherent.
  • a polynucleotide vector of this invention may be in any of several forms, including, but not limited to, RNA, DNA, RNA encapsulated in a retroviral coat, DNA encapsulated in an adenovirus coat, DNA packaged in another viral or viral-like form (such as herpes simplex, and adeno-associated virus (AAV)), DNA encapsulated in liposomes, DNA complexed with polylysine, complexed with synthetic polycationic molecules, complexed with compounds such as polyethylene glycol (PEG) to immunologically "mask” the molecule and/or increase half-life, or conjugated to a non-viral protein.
  • RNA Ribonucleic acid
  • the polynucleotide is DNA.
  • DNA includes not only bases A, T, C, and G, but also includes any of their analogs or modified forms of these bases, such as methylated nucleotides, internucleotide modifications such as uncharged linkages and thioates, use of sugar analogs, and modified and/or alternative backbone structures, such as polyamides.
  • multimer refers to a plurality of monomers that are covalently linked together or non-covalently fused to each other.
  • higher order multimer refers to a plurality of monomers that are covalently linked together or non-covalently fused to each other, which is greater than a dimer.
  • nucleotide symbols other than a, g, c, t they follow the convention set forth in WIPO Standard ST.25, Appendix 2, Table 1, wherein k represents t or g; n represents a, c, t or g; m represents a or c; r represents a or g; s represents c or g; w represents a or t and y represents c or t.
  • DTYHPMSEYP TYHTHGRYVP PSSTDRSPYE KVSAGNGGSS LSYTNPAVAA ASANL (SEQ ID NO: 1) describes full-length MUCl Receptor (Mucin 1 precursor, Genbank Accession number: P15941).
  • SEQ ID NOS:2, 3 and 4 describe N-terminal MUC-1 signaling sequence for directing MUCl receptor and truncated isoforms to cell membrane surface. Up to 3 amino acid residues may be absent at C-terminal end as indicated by variants in SEQ ID NOS:2, 3 and 4.
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLV ALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVS AGNGGSSLSYTNPAVAAASANL (SEQ ID NO:5) describes a truncated MUCl receptor isoform having nat-PSMGFR at its N-terminus and including the transmembrane and cytoplasmic sequences of a full-length MUCl receptor.
  • GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:6) describes Native Primary Sequence of the MUCl Growth Factor Receptor (nat-PSMGFR - an example of "PSMGFR"):
  • TINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:7) describes Native Primary Sequence of the MUCl Growth Factor Receptor (nat-PSMGFR - An example of "PSMGFR"), having a single amino acid deletion at the N-terminus of SEQ ID NO:6).
  • GTINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:8) describes "SPY” functional variant of the native Primary Sequence of the MUCl Growth Factor Receptor having enhanced stability (var-PSMGFR - An example of "PSMGFR").
  • TINVHDVETQFNQYKTEAASPYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO: 9) describes "SPY" functional variant of the native Primary Sequence of the MUCl Growth Factor Receptor having enhanced stability (var-PSMGFR - An example of "PSMGFR"), having a single amino acid deletion at the C-terminus of SEQ ID NO: 8).
  • PAVAAASA L (SEQ ID NO: 11) describes MUCl cytoplasmic domain amino acid sequence.
  • HEGRFFYQRLVEF MASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSF
  • MUC1 * growth factor receptor function of a MUC1 cleavage product, MUC1 *
  • MUC1 * the growth factor receptor function of a MUC1 cleavage product
  • NM23 the dimer form of NM23-H1 that binds to the PSMGFR portion of MUC1* ( Figures 21 and 27) and inhibits differentiation and supports the growth of stem and progenitor cells (Hikita et al, 2008; Smagghe et al, 2013).
  • NM23-H1 as a hexamer does not promote or maintain pluripotency; rather it induces differentiation.
  • NME1 hexamers have a biological function in that they induce differentiation, for brevity herein we refer to NME1 hexamers as a "biologically inactive" multimer because it is an NME multimer that does not induce the starting cells to revert to a less mature state or does not inhibit differentiation of immature cells, or does not maintain an immature state of the cell.
  • NME1 dimers as a "biologically active" NME multimer, being an NME multimer that induces the starting cells to revert to a less mature state or inhibits differentiation of immature cells, or maintains the immature state of a cell.
  • NME7 NM23-H7 monomers (Lacombe et al, 2000) also bind to and dimerize the extra cellular domain of MUC1 * and alone is sufficient to promote or maintain pluripotency in stem or stem-like cells (see Figure 26 and Figure 27). Further, the inventor discovered that NME1 dimers or NME7 monomers induce pluripotency or induce cells to revert to a less mature state.
  • NME1 NM23-H1
  • NME6 is roughly the same molecular weight as NME1 and in sea sponge (Suberites domunculd) it is reported to exist as a dimer (Perina et al, 2011, "Characterization of Nme6-like gene/protein from marine sponge Suberites domuncula” Naunyn-Schmiedeberg's Arch Pharmacol, 384:451-460).
  • NME6 binds to the PSMGFR peptide derived from the MUC1* extra cellular domain ( Figure 20).
  • human NME6 wild type protein was tested along with a variant (S139G) in which a mutation similar to the S120G mutation that made NME1 prefer dimer formation (Chang et al, 1986) and another variant in which that same region that made NME1 prefer dimer formation was mutated (S139A, V142D, V143A) to match the sequence that occurs in sea sponge, as NME6 in sea sponge reportedly exists as a dimer.
  • NME7 (NM23-H7) is a monomeric protein, the inventor has discovered that it functions like a dimer. It contains two NDPK catalytic domains, is approximately twice the molecular weight of an NME1 or NME6 monomer and is expressed and secreted by human embryonic stem (ES) and induced pluripotent stem (iPS) cells, as well as cancer cells (see Figure 1, Figure 2 and Figure 27).
  • ES human embryonic stem
  • iPS induced pluripotent stem
  • NME8 is another NME family member that has some binding affinity for the MUC1 extra cellular domain.
  • NME8 (Miranda- Vizuete et al, 2003) has 3 domains: A, B and C. When NME8 is expressed as only domains A and B, it is monomeric, while B with C forms oligomers. NME8 may bind to and re-cluster MUC1 to turn off stem-like growth.
  • NME8 domains A and B (“1" and “2” in Figure 21) or domains B and C ("2" and “3” in Figure 21) were tested for their ability to bind to the PSMGFR peptide from MUC1* extra cellular domain and compared to the binding of NME1 dimers (NM23 S120G in Figure 21 A). As can be seen in the figure, some binding is observed, but it is far less than the binding of NME1 when it is in dimer form.
  • NME8 is an oligomer, which may indicate that like NME1 hexamers, NME8 mutlimers or oligomers induce differentiation by binding to the extra cellular domain of MUC 1 and re-clustering the receptors to occlude the binding site of the biologically active NME multimer.
  • NME family proteins are differentially expressed at different times of cell and tissue development. Whereas we detect NME6, NME7 and NME1 in embryonic stem cells, only NME1 and NME2 are routinely expressed in adult cells or adult stem cells. Because NME1 forms hexamers which induce rather than inhibit stem cell differentiation, it follows that NME7 is expressed earlier in embryogenesis and in naive state stem cells because they cannot form the differentiation-inducing hexamers. In the earliest stages of embryogenesis, growth and inhibition of differentiation would be the default, with the regulatory function of the hexamer being important in later stages when one wants to initiate differentiation when a certain density of stem cells is reached.
  • Boyer et al (Boyer et al, 2005, "Core Transcriptional Regulatory Circuitry in Human Embryonic Stem Cells", Cell, Vol. 122, 947-956) reported that pluripotency inducing proteins SOX2 and NANOG bind to the promoter of NME7 but not other NME family members, indicating that it is the first NME protein expressed and is consistent with the notion that it can induce or maintain pluripotency but cannot form the hexamers that turn it off.
  • Boyer et al also report that pluripotency inducing proteins SOX2 and OCT4 bind to the promoter of MUCl, the target receptor of NME7 following cleavage to MUCl*.
  • SOX2 and OCT4 also bind to the promoter of the MUCl cleavage enzyme MMP-16.
  • MMP-16 MUCl cleavage enzyme
  • Example 1 describes an experiment in which BGOlv human embryonic stem cells are grown in either NM23-S120G, which has been refolded and purified to exist primarily as a dimer, over a coating of anti-MUCl* monoclonal antibody MN-C3 or cultured in bFGF over mouse fibroblast feeder cells.
  • Western blots of the resultant cells shows that NME7 is highly expressed in stem cells that have been cultured in NM23-S120G dimers ( Figure 1 , Part I. C - Lane 1) but only weakly expressed in stem cells cultured in bFGF (Lane 2).
  • stem cells cultured in NM23 dimers revert to the naive state (Smagghe et al, 2013), which is a less mature state than the primed state of human stem cells cultured in bFGF as are all commercially available stem cell lines.
  • the fact that more NME7 is expressed in naive state stem cells than primed state stem cells is consistent with NME7 being preferentially expressed in very early stages of embryogenesis but not later in embryo or fetal development.
  • Example 4 describes an experiment in which human embryonic stem cells were cultured in either NM23-S120G dimers over a MUCl * antibody surface or in bFGF over a surface of mouse fibroblast feeder cells, then analyzed by RT-PCR to measure expression levels of the naive genes versus the primed genes.
  • Figure 6 shows that stem cells cultured in NM23 dimers express higher levels of the naive genes and lower levels of the differentiated, primed genes.
  • NME7 is expressed to a greater degree in the desirable naive stem cells, which are able to differentiate into any cell type in the human body. Therefore, strategies that increase expression of NME7 in a cell, for example via introduction of nucleic acids capable of causing expression of NME7 or methods that add NME7 protein, or NME1 mutants or variants that prefer dimer formation are strategies that maintain pluripotency, maintain the naive stem cell state in embryonic or induced pluripotent stem cells, and/or induce pluripotency in more mature cell types, including somatic cells, dermablasts and fibroblasts.
  • NME7 is an earlier form of NM23 that is expressed in a more naive stem cell.
  • NM23 in dimer form induces stem cells to revert to a more pluripotent state often called the naive state.
  • Our experiments and those of others have shown that culturing stem cells in bFGF or culturing stem cells over a layer of mouse fibroblast feeder cells (MEFs) drives or maintains stem cells in the less pluripotent state called the "primed" state.
  • MEFs mouse fibroblast feeder cells
  • these primed stem cells express much less NME7, consistent with the idea that NME7 is associated with a more naive and thus truly pluripotent stem cell state.
  • the naive stem cells are the desired cells for research as well as for therapeutic use.
  • strategies that involve inducing expression of NME7 are desired to obtain cells for therapeutic uses.
  • strategies that decrease expression of NME7 in cancers would be anti-cancer therapies.
  • NME7 exists as a single protein but structurally is comprised of two monomers and so functions as a dimer. NME7 contains two NDPK domains, portions of which bind to the MUC 1 * growth factor receptor. Example 1 also describes a binding experiment called a pull-down assay. In this experiment, the MUC1 * extra cellular domain peptide was attached to beads which were then incubated with lysates from BGOlv human embryonic stem cells. After wash steps and release from the beads, species captured by interaction with the MUC1* peptide were separated on an SDS-PAGE gel then probed with an anti-NME7 antibody. Figure 1(F) - Lane 1 shows that NME7 binds to the MUC1 * extra cellular domain. Portions of the double NDPK domains in NME7 bind to MUC 1 * growth factor receptor and dimerize it which activates pathways that maintain pluripotency, induce pluripotency and inhibit differentiation of stem and progenitor cells.
  • NME6 exists as a dimer, and resists formation of higher order multimers. NME6 dimers bind to MUC 1 * growth factor receptor and dimerize it which activates pathways that maintain pluripotency, induce pluripotency and inhibit differentiation of stem and progenitor cells. Like NMEl mutants and variants that prefer dimer formation, both NME6 and NME7 are capable of maintaining and inducing pluripotency and inhibiting differentiation of stem and progenitor cells, including iPS cells.
  • NME6 and NME7 can be added exogenously to stem cells (embryonic or induced pluripotent) or progenitor cells to induce growth, maintain them in an undifferentiated state or inhibit their differentiation. NME6 and NME7 can be added exogenously to stem or progenitor cells to induce pluripotency.
  • nucleic acids encoding NMEl mutants and variants that prefer dimer formation, NME6 and/or NME7, or variants thereof, including single chain variants that behave as dimers can be introduced into cells to induce the cells to revert to a less differentiated state or to maintain cells in a less mature state.
  • NMEl and NME2 wild type proteins form tetramers, hexamers and higher order multimers.
  • NME dimers bind to the PSMGFR portion of the MUC1* growth factor receptor to support stem and progenitor cell growth while inhibiting differentiation.
  • NME dimers or NME7 monomers cause cells to revert to a less mature state, for example to induce pluripotency in more mature cells including somatic cells, dermablasts, fibroblasts and the like.
  • NMEl wild type proteins that exist primarily as hexamers and higher order multimers, do not bind to PSMGFR portion of the MUC1* growth factor receptor and induce differentiation of stem and progenitor cells [Smagghe et al, 2013].
  • NMEl forms multimers, including dimers, tetramers and hexamers.
  • the dimer form of NMEl maintains stem cells in an undifferentiated state and also induces pluripotency in more mature cells.
  • the amount of NMEl secreted from the stem cells causes an increase in the local concentration, favoring the formation of hexamers that do not support pluripotency and may in fact bind to a different cell surface receptor and actively trigger differentiation.
  • NME7 appears to function as the NMEl dimers. Therefore, it is advantageous to increase expression of, or to add exogenously, NME7 for the maintenance or induction of pluripotency. Even more preferred for the maintenance or induction of pluripotency is to suppress NMEl and increase expression of NME7 or to suppress NMEl and increase relative concentration of NME7 or NMEl dimers.
  • NME2 also forms hexamers and higher order multimers, it is also desirable to down-regulate NME2 in addition to down regulation of NMEl while maintaining or inducing pluripotency and where inhibition of differentiation is desired.
  • NMEl or NMEl and NME2 are down regulated while NMEl mutants and variants that prefer dimer formation, such as NMEl S120G or P96S or similar mutations in NME6 or NME7 are added exogenously or nucleic acids encoding them are caused to be expressed in the cells.
  • NME family members that can form higher order multimers, greater than dimer are suppressed.
  • expression of NMEl is suppressed in order to promote or maintain cells in a pluripotent state or to induce cells to revert to a less mature state. Suppression of a particular species can be carried out by a number of methods known to those skilled in the art.
  • a target species can be suppressed at the protein level or nucleic acid level: DNA or RNA.
  • the expressed protein can be suppressed by the use of antibodies or small molecules that inhibit or block the activity or binding site of the protein.
  • expression of protein can be inhibited by using anti-sense nucleic acids, anti-sense DNA, anti-sense RNA, inhibitory RNAs, such as RNAi, shRNA, or siRNA. Small molecules may also be used to block or inhibit expression of the targeted protein.
  • cells can be transfected or transduced with vectors that include sequences that encode the desired or undesirable gene.
  • Vectors can be viruses, DNA or RNA in nature.
  • Other methods involve introducing to cells mRNA that encodes the gene of interest. Genes targeted for repression can be down-regulated using shRNA or siRNA, anti-sense nucleic acids and the like.
  • Some methods for facilitating entry of nucleic acids encoding genes involve the use of detergents so that the encoding nucleic acid is encapsulated in a liposome.
  • Still other methods involve modifying nucleic acids that encode the genes with moieties such as O-methylation or cholesterol, which facilitate entry of the nucleic acid into the cell (See US Patent Application No. US 2010/0173359, filed July 11, 2008, the contents of which are incorporated by reference herein for its disclosure of the moieties).
  • moieties such as O-methylation or cholesterol
  • These latter methods are less harsh than detergents so can be used repeatedly to cause a cell to continuously express or repress a targeted gene.
  • AccellTM siRNA is specially modified for stability, target specificity, and uptake by cells without a transfection reagent (Dharmacon, Inc. - Layfayette, Colorado).
  • the AccellTM system can be used to down-regulate genes such NME1 or NME1 and NME2 that inhibit pluripotency. Modifications of the AccellTM system could be used to modify nucleic acids bearing sequences of genes that are beneficial for stem or progenitor cell growth or induction of pluripotency. Many techniques for gene up-regulation or down- regulation are known to those skilled in the art and can be used to down-regulate NME family proteins that are capable of forming higher order multimers, such as hexamers that induce differentiation.
  • NME1 and/or NME2 are suppressed with or without up-regulation of genes that maintain or induce pluripotency such as NME1 mutants and variants that prefer dimer formation, NME6 and/or NME7, or variants thereof, including single chain variants that behave as dimers.
  • NME6 and/or NME7, or variants thereof including single chain variants that behave as dimers, or adding exogenous protein forms of NME1 mutants and variants that prefer dimer formation, NME6 and/or NME7, or variants thereof, including single chain variants that behave as dimers
  • these proteins and nucleic acids can be prepared in time release formulations or encapsulated for delivery to cells over time. Using the methods described above, cell culture, especially stem or progenitor cell culture, can be greatly simplified with greatly reduced time and labor.
  • NME1 and/or NME2 are suppressed, while NME7 is upregulated or added exogenously to promote, maintain or induce pluripotency or to induce cells to revert to a less mature state.
  • NMEl can be suppressed to eliminate the negative effect of the hexamers that NMEl forms at increased concentration.
  • NMEl when NMEl is suppressed, which is typically only reduced by 50-75% in siRNA knockdown experiments, this likely decreases the local concentration of NMEl and thus decreases the probability of hexamer formation.
  • NME7, or NME6 and NME7 are not knocked down, stem cell growth proceeds and is even enhanced such that no additional recombinant growth factor needs to be added.
  • the temporary suppression of NMEl causes an increase in the concentration of NME7 which promotes pluripotency and does not form the hexamers that can turn off pluripotent growth and induce differentiation.
  • NMEl but not NME7 is suppressed in pluripotent stem cells, which enables their growth and inhibits differentiation without the addition of exogenously added growth factors, including the addition of recombinant NMEs.
  • NME7 or NMEl in dimer form may be added exogenously, however to increase cell number.
  • NMEl Knockdown of NMEl had very little effect even after 96 hours with no growth factor added into the media. It is well known that if stem cells are cultured in minimal media absent a stem cell growth factor such as bFGF or NMEl in dimer form, the stem cells rapidly differentiate by 48 hours. This did not occur when only NMEl was knocked down, which left NME6 and NME7, suspected of functioning as NMEl dimers would, available to promote pluripotency (See Figure 11, Figure 22 and Figure 25). [00231] Expression of the NME family member, isoform or variant may be transient, stable or controlled as enabled via inducible expression systems so that expression of the NME family member or variant is transient and can be turned on or off in a controllable manner.
  • a stem cell growth factor such as bFGF or NMEl in dimer form
  • a biologically active NME family member or variant promotes self-renewal, maintains or induces pluripotency while inhibiting differentiation.
  • transient expression of the biologically active NME family members or variants, especially NME6 or NME7 isoforms or variants maintains or induces pluripotency while inhibiting differentiation for a limited time period, thereafter, cells would differentiate.
  • expression of NME1 wild type can be activated in order to cause cells to enter differentiation as the biologically inactive hexamer form of NME1 is produced.
  • expression of NME6 and/or NME7 can be suppressed to induce differentiation.
  • NME proteins can be carried out using several techniques known to those skilled in the art, including the use of expression plasmids, linear nucleic acids for expression or suppression, e.g. siRNA, that may be derivatized with moieties such as cholesterol to facilitate entrance into the cells or nucleus.
  • expression plasmids linear nucleic acids for expression or suppression, e.g. siRNA, that may be derivatized with moieties such as cholesterol to facilitate entrance into the cells or nucleus.
  • Cells to which an NME family member, isoform or variant of the invention is added exogenously or which are caused to express the NME family member or variant include but are not limited to somatic cells, dermablasts, fibroblasts, stem cells, pluripotent stem cells, bone marrow cells, peripheral mobilized blood cells, hematopoietic stem cells, progenitor cells, patient cells, cells bearing a genetic defect or alteration, or feeder cells meant to provide neighboring cells with the secreted NME family member or variant.
  • the cell to which an NME family member, isoform or variant of the invention is added exogenously or which are caused to express the NME family member or variant can be a patient cell.
  • the patient cell may bear a genetic defect or alteration for which it is desired to revert the cell to a less mature state, to correct or replace defective gene, and cause self- replication of the corrected gene bearing cell.
  • the patient cells may be induced to become pluripotent, using NME family members or variants of the invention for treatments for the patient or another patient that requires treatment with stem or progenitor cells. NME family members or variants added exogenously or made to be expressed by patient cells for generating iPS cells, which can then be directed to differentiate into any desirable cell type. Such cells may then be administered to the patient or another patient for therapeutic purposes.
  • NME7 is secreted by cancer cells as well as stem cells. Some cancer cells express mutant NMEl that preferentially forms dimers and resists the formation of hexamers, meaning that in these cases, the cancer cells exhibit stem-like growth due to the dimeric NMEl growth factor, which does not form hexamers, and as a result does not induce differentiation. In other cancers, the stem-like growth factor function of NME7 can overcome the differentiation-inducing effects of the hexamer. Thus, as a treatment for cancers, NME7 is suppressed. Alternatively, NMEl or NME2, which readily form hexamers are overexpressed as a treatment for cancers.
  • NME7 is suppressed and NMEl and/or NME2 are overexpressed or exogenously introduced to the affected cells to inhibit stem-like growth.
  • any NME family member that resists differentiation-inducing multimerization states such as the hexamer form, are suppressed to treat cancers.
  • NME family members that induce differentiation, such as high concentrations of NMEl or NME2 are introduced or overexpressed to treat cancers or other maladies characterized by stem-like growth.
  • the invention contemplates practicing these methods in vitro, ex vivo and in vivo.
  • the invention also contemplates administering agents that suppress or induce expression of NME family members in a patient to either induce stem-like growth, for example at a site of injury, or to inhibit stem-like growth, for example as a treatment for cancers.
  • NMEl in dimer form functions as a pluripotency factor and as a growth factor, stimulating the growth of both stem cells and cancer cells when added to a minimal serum-free media.
  • treating cancer cells with NMEl in hexamer form inhibits cancer cell growth and migration, while treatment with the NMEl dimer did not. Exemplary experiments are shown in Figures 28-30.
  • Different NME multimers may bind to MUC1 at different sites.
  • Different cleavage enzymes may cleave MUC1 such that the binding site for a differentiation-inducing multimer is not present.
  • the enzyme that cleaves MUC1 may be different from the cleavage enzyme in stem cells and thus may cleave MUC 1 below the binding site for the multimer that turns off stemlike growth.
  • increasing the amount of an NME family member whose multimerization state is the biologically active state or decreasing the relative amount of an NME family member whose multimerization state is the biologically inactive state is a method for generating less mature cells from starting cells or for maintaining cells in a stem-like state, which may be a pluripotent state.
  • increasing the amount of an NME family member whose multimerization state is the biologically active state or decreasing the relative amount of an NME family member whose multimerization state is the biologically inactive state is a method of inhibiting differentiation of embryonic stem cells, induced pluripotent stem cells or progenitor cells.
  • agents that increase the amount of an NME family member whose multimerization state is the biologically inactive state or agents that decrease the relative amount of an NME family member whose multimerization state is the biologically active state are administered to a patient.
  • Nucleic acids that cause the expression of an NME family member whose multimerization state is the biologically active state can be introduced to a host cell to promote induction to or maintain it in a less mature or stemlike state.
  • the host cell may also carry a nucleic acid that causes the expression of a gene that is either not expressed in the host cell or is mutated in the host cell.
  • a nucleic acid that down-regulates the unwanted gene and up-regulates a desired or corrected gene can also be introduced to a host cell.
  • the source of host cells can be a donor or a patient and may be derived from the skin, tooth, bone marrow, blood, placenta, amniotic fluid, a blastocyst, fetus and the like and can be stem cells, iPS cells, progenitor cells or somatic cells.
  • Host cells used with methods of the invention can be administered to a patient. Methods of administering the cells to a patient include by bone marrow transplant, transplant into a specific site, transfusion, injection, or topical treatment. These methods can be used to treat any condition or disease wherein the disease or condition would be alleviated by treatment with stem cells, progenitors, or by correction of a genetic abnormality or defect.
  • Cells subjected to methods of the invention can also be differentiated to progenitors or somatic cells prior to administering to a patient.
  • NME family members whose multimerization state is the biologically active state would be withdrawn to allow differentiation.
  • Example 1 To determine whether or not human stem cells express NME6 or NME7 in addition to NMEl (HI) and NME2 (H2), we performed Western blot analysis on lysates and supernatant from various human stem cell lines.
  • Human embryonic stem cell line BGOlv cells were cultured either in a) NM23-S120G in dimer form only on a cell culture plate coated with anti-MUCl* monoclonal antibody MN-C3; or b) bFGF at 4 ng/mL on mouse feeder cells (MEFs). After 3 days in culture, the stem cells were harvested and lysed, then analyzed by Western blot using antibodies to probe for the presence of NMEl, NME6 and NME7.
  • NM23-H1 wild type (NM23-wt) protein was loaded onto the gel and also probed with antibodies that recognize the 3 different NMEs.
  • the gel is a denaturing gel so that the apparent molecular weight of the NM23-S120G dimer and the wild type hexamer will both appear to be the weight of a monomer.
  • the antibodies used to probe the gel were: for NMEl : NM23-H1 (C-20); NME6: NM23-H6 (L-17) and NME7: nm23-H7 (B9) (all purchased from Santa Cruz Biotechnology, Inc).
  • Figure 1 shows photos of 6 Western blot gels. Part I.
  • A-C shows the Western blots wherein the cell lysate was separated by gel electrophoresis and then probed with antibodies for: A) NMEl, B) NME6 and C) NME7.
  • Lane 1 corresponds to BGOlv stem cells cultured in NM23-S120G (in dimer form) on a cell culture plate coated with anti-MUCl* monoclonal antibody MN-C3
  • Lane 2 corresponds to BGOlv stem cells cultured in bFGF on MEFs
  • Lane 3 corresponds to T47D breast cancer cells
  • Lane 4 corresponds to purified recombinant NM23-H1 wild type (NM23-wt).
  • Figure 1(A) shows that NMEl is present in BGOlv human embryonic stem cells, whether cultured in NM23 in dimer form on an anti-MUCl* antibody surface (Lane 1) or cultured in bFGF on a surface of mouse feeder cells (MEFs) (Lane 2). NMEl is also present in human breast cancer cells (Lane 3). And the positive control, Lane 4, shows that the antibody used does in fact recognize NMEl purified protein.
  • Figure 1(B) shows that NME6 is not present in any of the samples tested, using these antibodies.
  • Figure 1(C) shows that NME7 is strongly expressed in human stem cells if they are cultured in NM23 (dimers) on an anti-MUCl* surface (Lane 1) but only weakly expressed in stem cells cultured in bFGF on MEF feeder cells (Lane 2). NME7 is also strongly expressed in human breast cancer cells (Lane 3), but is not recognized by the C-20 antibody purportedly specific for the HI isoform.
  • Figures l(D-F) show photos of Western blots of pull-down assays to determine which NMEs bound to the MUC1* extra cellular domain peptide.
  • a histidine-tagged MUC1* extra cellular domain peptide a histidine-tagged MUC1* extra cellular domain peptide
  • Figure 1(D) shows that NMEl in stem cells, whether cultured in NM23 (dimers) (Lane 1) or in bFGF (Lane 2), binds to MUC1* extra cellular domain peptide, as the inventor has previously shown.
  • Lane 3 shows that NMEl in breast cancer cell lysates also binds to MUC1* extra cellular domain peptide and
  • Lane 4 shows that the C-20 NMEl specific antibody binds to the purified recombinant wild type NMEl.
  • this gel shows that NME6, which in Part I of Figure 1 was shown not to be in these cell lysates, was also not pulled down by the MUC1* peptide.
  • Figure 1(F) importantly shows that NME7 binds to the MUC 1 * extra cellular domain peptide.
  • Example 2 Western blot analysis of human stem cell lines BGOlv and HES-3 cells shows that an NME antibody, purportedly specific for NME7 recognized NME7 and another species having an apparent molecular weight of ⁇ 22-25kDa ( Figure 2).
  • Example 3 The inventor previously showed that NM23 in dimer form or in a form that dimerized MUC1* receptor on cells promoted pluripotent stem cell growth, inhibited differentiation and induced pluripotency in more mature cells including somatic cells. Binding experiments showed that NM23 in dimer form bound to the MUC1 * receptor on cells and to the free MUC1 * extra cellular domain peptide. However, experiments using the hexamer form of either the wild type protein or the hexamer form of the S120G mutant caused stem cells to differentiate. Cellular localization experiments showed that the hexamer could bind to cells and was translocated to the nucleus where it presumably bound to elements that induce differentiation.
  • NME1 NM23- Hl
  • other NME family members that form hexamers and higher order mul timers are detrimental to the process of culturing stem cells in vitro, inducing pluripotency in more mature cells such as somatic cells and detrimental to the process of seeding a patient with a stem or progenitor cell wherein expansion to reconstitute a stem cell population or to overtake an endogenous stem cell population are desired.
  • NM23 dimers NME1-S 120G dimers
  • Figure 3 shows that the presence of a significant amount of NME1 wild type, which is hexameric, causes the stem cells to differentiate despite the presence of the dimer.
  • the wild type NME1 endogenous to human stem cells and secreted by them inhibits the growth and maintenance of stem and progenitor cells and inhibits the induction of pluripotency in more mature cells such as somatic cells.
  • Example 4 RT-PCR of naive versus primed markers for human stem cells cultured in NM23 dimers compared to cells cultured in bFGF.
  • Human embryonic H9 stem cells were plated onto plasticware coated with an anti-MUCl* monoclonal antibody MN-C3 then cultured in NM23-S120G, purified to dimer population only, for 37 passages. Samples of the growing cells were withdrawn at passages 8, 12, 14, 21, 26 and 37. For comparison, cells from the same starting stock were cultured in bFGF over a layer of mouse feeder cells (MEFs). Cells were analyzed using standard quantitative PCR techniques.
  • NME7 is characteristic of the naive state, not the primed state, and is better able to support pluripotent stem cell growth. These data provide rationale for adding exogenous NME7 or nucleic acids that induce its expression for the maintenance of pluripotency in cells, inhibition of differentiation, or the induction of pluripotency in cells. Such introduction of NME7 can be accompanied by repression of the differentiation-inducing NME1.
  • siRNA was used to knock down one or more of NME1, NME6 and NME7 in pluripotent stem cells.
  • siRNA was added to established ES and iPS cells that are commercially available. Cells were cultured in serum-free minimal stem cell growth media and pluripotent stem cells were plated over a layer of an antibody to a stem cell surface receptor, MUC1*, to avoid introduction of random growth factors that are present in feeder cells and Matrigel.
  • NME1, NME6 and NME7 were all knocked down together to assess the effect of knocking down NM23s without recognizing that some promote differentiation and others inhibit it.
  • FIG 7A suppressing expression of NME1, NME6 and NME7 results in poor cell growth and induces differentiation as can be seen by thickened areas of cell growth, in which cells have smaller nuclei and take on fibroblast-like morphology.
  • Knocking down NM23 without distinguishing among which isoforms are deleterious and which are good for the maintenance of pluripotency, causes differentiation within 48 hours.
  • equal amounts of a scrambled siRNA were added but no induction of differentiation is observed (Figure 7B).
  • siRNAs specific for NMEl, NME6 and NME7 were purchased from Santa Cruz Laboratories, Santa Cruz, CA. The procedure used was the Stemgen'TM siRNA transfection kit. The method uses lipids to form siRNA micelles, which will permeate the cell membrane and then act on the targeted RNA to downregulate it.
  • Example 6 The experiment of Example 5 was continued to 96 hours. Evaluation of cell morphology confirmed the 48 hour observations, but with additional caveats. After 96 hours, the NME variant knockdown experiment was extended to analyze the expression of pluripotency genes as well as to analyze the effect of suppressing one NME isoform on the other NME isoforms. Stem cells from each experimental condition were separately pelleted and analyzed by RT-PCR. Expression levels of pluripotency genes Nanog, Oct4, and Klf4, along with differentiation gene Foxa2 and NME isoforms NME1, NME6 and NME7 were measured. Expression levels were normalized to a control mock transfection of siRNA. siRNA typically suppresses the targeted gene by 50-75%. As a positive control, siRNA specific for Oct4 was used. Stem cells transfected with Oct4 siRNA differentiated as expected even if cultured in normal stem cell media and growth factor.
  • Figure 13 shows that all three NMEs cannot be knocked down without having a disastrous effect on cell growth and differentiation.
  • the triple knockdown gave rise to very little cells that were alive after 96 hours and those cells were entirely differentiated (Figure 13A). Knock down of NMEl and NME7 had an identical disastrous effect ( Figure 13B), implying that the role of NME6 is not as important as that of NMEl and NME7.
  • the addition of recombinant NMEl in dimer form improved cell growth but only to a limited degree (Figure 13C, D).
  • Figure 18 shows that the triple knockdown causes an increase in the differentiation gene Foxa2 and greatly reduced expression of all the NMEs.
  • Example 7 In another NME knockdown experiment performed as described above, human embryonic stem cells (BGOIV) were plated over a surface of an anti-MUCl* antibody (MN-C3). Specific NME proteins were knocked down using siRNA and images as well as RT-PCR quantified the results at 96 hours post transfection of the siRNA. No growth factor or serum was added to the cells after siRNA transfection. A minimal stem cell media was changed every 48 hours.
  • Figures 22A,B show photographs of the stem cells 96 hours after NME1 was suppressed and in the absence of any growth factors or serum added.
  • NME6 Suppression of NME6, shown in Figures 24A,B inhibited stem-like growth to a modest extent as areas of differentiation can be seen in the view shown in Figure 24B. However, NME6 suppression looks similar to the negative control cells wherein scrambled siRNA was added ( Figures 24C,D).
  • RT-PCR of the resultant NME suppression experiment described immediately above shows that only suppression of NME7 resulted in a significant increase in the expression of Foxa2, which is a marker of differentiation.
  • Example 8 Recombinant human NME7 promotes and maintains pluripotent stem cell growth
  • NME7-AB A soluble variant of NME7, NME7-AB, was generated and purified as previously described (PCT/US 12/60684, filed October 17, 2012, the contents of which are incorporated by reference in their entirety).
  • Human stem cells iPS cat# SClOla-1, System Biosciences
  • SClOla-1 Human stem cells
  • the base media was Minimal Stem Cell Media consisting of: 400 ml DME/F 12/GlutaM AX I (Invitrogen# 10565-018), 100 ml Knockout Serum Replacement (KO-SR, Invitrogen# 10828-028), 5 ml lOOx MEM Non-essential Amino Acid Solution (Invitrogen# 11140-050) and 0.9 ml (O.lmM) ⁇ -mercaptoethanol (55mM stock, Invitrogen# 21985-023).
  • the base media can be any media. In a preferred embodiment, the base media is free of other growth factors and cytokines.
  • NME7-AB 8nM NM23-H1 refolded and purified as stable dimers.
  • Media was changed every 48 hours and due to accelerated growth had to be harvested and passaged at Day 3 post-plating.
  • Figure 26 shows that culturing human stem cells in NM23-H1 dimers or in NME7 monomers results in pluripotent stem cell growth.
  • NME7 and NM23-H1 (NME1) dimers both grew pluripotently and had no differentiation even when 100% confluent.
  • NME7 cells grew faster than the cells grown in NM23-H1 dimers.
  • Cell counts at the first harvest verified that culture in NME7 produced 1.4-times more cells than culture in NM23-H1 dimers.
  • Example 9 ELISA assay showing NME7-AB simultaneously binds to two MUC 1 * extra cellular domain peptides
  • PSMGFR-Cys The PSMGFR peptide bearing a C-terminal Cysteine (PSMGFR-Cys) was covalently coupled to BSA using Imject Maleimide activated BSA kit (Thermo Fisher). PSMGFR-Cys coupled BSA was diluted to lOug/mL in 0.1M carbonate/bicarbonate buffer pH 9.6 and 50uL was added to each well of a 96 well plate. After overnight incubation at 4°C, the plate was washed twice with PBS-T and a 3% BSA solution was added to block remaining binding site on the well.
  • the plate was washed twice with PBS-T and NME7, diluted in PBS-T + 1% BSA, was added at different concentrations. After lh at room temperature the plate was washed 3x with PBS-T and anti-NM23-H7 (B-9, Santa Cruz Biotechnology), diluted in PBS-T + 1% BSA, was added at 1/500 dilution. After lh at room temperature the plate was washed 3x with PBS-T and goat anti mouse-HRP, diluted in PBS-T + 1% BSA, was added at 1/3333 dilution. After lh at room temperature the plate was washed 3x with PBS-T and binding of NME7 was measured at 415nm using a ABTS solution (Pierce).
  • ELISA MUC1* dimerization The protocol for NME7 binding was used and NME7 was used at 11.6ug/mL.
  • Example 10 NMEl in hexamer form inhibits cancer cell growth and migration.
  • T47D breast cancer cells secrete both NMEl and NME7.
  • T47D MUCl*-positive breast cancer cells were cultured in varying amounts of NMEl that had been purified as a stable population of essentially all hexamers in order to determine whether or not hexameric NMEl inhibited cancer cell growth and stem- like growth in the same manner stem cell growth is inhibited.
  • T47D cells were grown in 10% FBS RPMI and collected with trypsin. Cells were spun down and counted with a hemacytometer. 6,000 cells per well were seeded into 96 well plates. 24 hours later the media was changed to 1% FBS RPMI plus the varying concentrations of hexamer. Media was again changed 48 hours later.
  • Example 11 NMEl in hexamer form inhibits cancer cell migration; NMEl dimers do not.
  • Cancer cell migration is often regarded as one of the methods by which cancer cells invade other tissues or implant at various locations to start occult metastases.
  • One method of testing for inhibitors of cancer cell migration is a "scratch test.” In these assays, cancer cells are plated and allowed to proliferate to near confluency. A pipette tip or other instrument is used to scrape off a section of cells. Dislodged cells are washed away, leaving a background of growing cancer cells with an "slash" or "cross” shaped region in each well that is devoid of cells. NMEl purified as a pure population of either hexamers or dimers was added and allowed to grow for an additional 16 or 24 hours.
  • DU145 MUC1* -positive prostate cancer cells were grown in 10% FBS RPMI and collected with trypsin. Cells were spun down and counted with a hemacytometer. Approximately 1 x 10 6 cells per well were plated into 6 well plates in 10% FBS RPMI. The following day either a cross mark (NMEl hexamers) or a slash mark (NMEl dimers) was made using a sterile 1000 uL pipette tip to remove cells in a defined region. Dislodged cells were gently washed away. The media was changed to 10% FBS plus the varying concentrations of hexamer or dimer.
  • Figure 29 A shows the graph of the Image J quantification of the percent invasion for cancer cells treated with NME1 hexamers at the concentrations shown.
  • Figures 29B-E show photographs at time zero (B,C) and at 16 hours (D,E). By comparison to the control (D), it is clear that NME1 hexamer (E) inhibits cancer cell invasion.
  • Figure 30A shows the graph of the Image J quantification of the percent invasion for cancer cells treated with NME1 dimers at the concentrations shown.
  • Figures 30B-K show photographs at time zero (B-F) and at 16 hours (G-K).
  • G the control
  • NME1 dimers H,I
  • NME1 dimers bind to and dimerize the extra cellular domain of the MUC1 * growth factor receptor on cancer cells to stimulate growth.
  • concentrations of the NME1 dimers of -4-16nM are sufficient such that one NME1 dimer binds to two (2) MUC1* receptors.
  • concentrations (J,K) there would be one dimer bound to each MUC1* receptor rather than dimerizing the two receptors.
  • there is an inhibition of invasion there is an inhibition of invasion.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Developmental Biology & Embryology (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Reproductive Health (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Gynecology & Obstetrics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Transplantation (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Toxicology (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Oncology (AREA)
  • Virology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2013/051899 2012-07-24 2013-07-24 Nme variant species expression and suppression Ceased WO2014018679A2 (en)

Priority Applications (30)

Application Number Priority Date Filing Date Title
CA2880010A CA2880010A1 (en) 2012-07-24 2013-07-24 Nme variant species expression and suppression
EP22198880.1A EP4206318A1 (en) 2012-07-24 2013-07-24 Nme variant species expression and suppression
SG11201606118SA SG11201606118SA (en) 2012-07-24 2013-07-24 Nme variant species expression and suppression
AU2013295811A AU2013295811A1 (en) 2012-07-24 2013-07-24 NME variant species expression and suppression
JP2015524428A JP6546087B2 (ja) 2012-07-24 2013-07-24 Nmeバリアント種の発現および抑制
EP13823099.0A EP2877586A4 (en) 2012-07-24 2013-07-24 NME VARIANTS SPECIAL EXPRESSION AND SUPPRESSION
CN201380049792.5A CN104995518A (zh) 2012-07-24 2013-07-24 Nme变体物种表达和抑制
PCT/US2014/017515 WO2014130741A2 (en) 2013-02-20 2014-02-20 Nme inhibitors and methods of using nme inhibitors
IL240695A IL240695B2 (en) 2013-02-20 2014-02-20 Nme inhibitors and methods of using nme inhibitors
IL307628A IL307628A (en) 2013-02-20 2014-02-20 Nme inhibitors and methods of using nme inhibitors
CN201480022551.6A CN105229027A (zh) 2013-02-20 2014-02-20 Nme抑制剂以及应用nme抑制剂的方法
KR1020217019794A KR20210082547A (ko) 2013-02-20 2014-02-20 Nme 저해제 및 nme 저해제의 사용 방법
EP14753856.5A EP2958940A4 (en) 2013-02-20 2014-02-20 NME INHIBITORS AND METHOD OF USE OF THE NME HEMMER
KR1020157026033A KR20150121131A (ko) 2013-02-20 2014-02-20 Nme 저해제 및 nme 저해제의 사용 방법
JP2015558975A JP6577872B2 (ja) 2013-02-20 2014-02-20 Nme阻害剤、及びnme阻害剤を使用する方法
CA2901893A CA2901893C (en) 2013-02-20 2014-02-20 Nme inhibitors and methods of using nme inhibitors
AU2014218872A AU2014218872A1 (en) 2013-02-20 2014-02-20 NME inhibitors and methods of using NME inhibitors
US14/468,106 US20150089677A1 (en) 2013-02-20 2014-08-25 Method for enhancing tumor growth
US14/604,579 US20150203823A1 (en) 2012-07-24 2015-01-23 Nme variant species expression and suppression
IL236901A IL236901B (en) 2012-07-24 2015-01-25 Expression of variable strains of nme and repression
US14/831,825 US20160326263A1 (en) 2013-02-20 2015-08-20 NME Inhibitors and Methods of Using NME Inhibitors
US15/910,894 US20180258186A1 (en) 2013-02-20 2018-03-02 NME Inhibitors and Methods of Using NME Inhibitors
AU2019202199A AU2019202199B2 (en) 2013-02-20 2019-03-29 NME inhibitors and methods of using NME inhibitors
AU2019203098A AU2019203098B2 (en) 2012-07-24 2019-05-02 NME variant species expression and suppression
JP2019109262A JP6862497B2 (ja) 2013-02-20 2019-06-12 Nme阻害剤、及びnme阻害剤を使用する方法
US17/306,477 US20220089779A1 (en) 2013-02-20 2021-05-03 Nme inhibitors and methods of using nme inhibitors
US17/449,932 US20220193270A1 (en) 2013-02-20 2021-10-04 Method for enhancing tumor growth
US17/548,312 US20220218846A1 (en) 2013-02-20 2021-12-10 Nme inhibitors and methods of using nme inhibitors
US17/935,854 US20230049461A1 (en) 2012-07-24 2022-09-27 Nme variant species expression and suppression
US18/439,331 US20240277803A1 (en) 2013-02-20 2024-02-12 Nme inhibitors and methods of using nme inhibitors

Applications Claiming Priority (14)

Application Number Priority Date Filing Date Title
US201261675292P 2012-07-24 2012-07-24
US61/675,292 2012-07-24
US201261677442P 2012-07-30 2012-07-30
US61/677,442 2012-07-30
US201261679021P 2012-08-02 2012-08-02
US61/679,021 2012-08-02
US201261683155P 2012-08-14 2012-08-14
US61/683,155 2012-08-14
US201261684654P 2012-08-17 2012-08-17
US61/684,654 2012-08-17
US201261693712P 2012-08-27 2012-08-27
US61/693,712 2012-08-27
PCT/US2012/060684 WO2013059373A2 (en) 2011-10-17 2012-10-17 Media for stem cell proliferation and induction
USPCT/US2012/060684 2012-10-17

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2012/060684 Continuation-In-Part WO2013059373A2 (en) 2011-10-17 2012-10-17 Media for stem cell proliferation and induction
PCT/US2013/055015 Continuation-In-Part WO2014028668A2 (en) 2012-08-14 2013-08-14 Stem cell enhancing therapeutics

Related Child Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2013/050563 Continuation-In-Part WO2014012115A2 (en) 2012-07-13 2013-07-15 Method for inducing cells to less mature state
US14/604,579 Continuation US20150203823A1 (en) 2012-07-24 2015-01-23 Nme variant species expression and suppression

Publications (2)

Publication Number Publication Date
WO2014018679A2 true WO2014018679A2 (en) 2014-01-30
WO2014018679A3 WO2014018679A3 (en) 2015-05-07

Family

ID=49997968

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/051899 Ceased WO2014018679A2 (en) 2012-07-24 2013-07-24 Nme variant species expression and suppression

Country Status (9)

Country Link
US (2) US20150203823A1 (cg-RX-API-DMAC7.html)
EP (2) EP4206318A1 (cg-RX-API-DMAC7.html)
JP (3) JP6546087B2 (cg-RX-API-DMAC7.html)
CN (2) CN111849874A (cg-RX-API-DMAC7.html)
AU (2) AU2013295811A1 (cg-RX-API-DMAC7.html)
CA (1) CA2880010A1 (cg-RX-API-DMAC7.html)
IL (1) IL236901B (cg-RX-API-DMAC7.html)
SG (2) SG10201700593YA (cg-RX-API-DMAC7.html)
WO (1) WO2014018679A2 (cg-RX-API-DMAC7.html)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015157322A2 (en) 2014-04-07 2015-10-15 Minerva Biotechnologies Corporation Anti-nme antibody
CN107660213A (zh) * 2015-02-10 2018-02-02 米纳瓦生物技术公司 人源化抗muc1*抗体
AU2021200429B2 (en) * 2013-08-12 2023-05-11 Minerva Biotechnologies Corporation Method for enhancing tumor growth
US11976295B2 (en) 2011-10-17 2024-05-07 Minerva Biotechnologies Corporation Media for stem cell proliferation and induction
US12037413B2 (en) 2019-02-04 2024-07-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12049514B2 (en) 2020-06-08 2024-07-30 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12195728B2 (en) 2011-03-17 2025-01-14 Minerva Biotechnologies Corporation Method for making pluripotent stem cells
US12415868B1 (en) 2020-06-26 2025-09-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12491259B2 (en) 2022-04-12 2025-12-09 Minerva Biotechnologies Corporation Anti-variable MUC1* antibodies and uses thereof

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109081863A (zh) * 2018-08-01 2018-12-25 西北民族大学 抗癌活性物质放线菌素fgr的分离鉴定方法

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2329822A1 (en) * 2001-09-05 2011-06-08 Minerva Biotechnologies Corporation Compositions and methods of treatment of cancer
EP1375661A1 (en) * 2002-06-17 2004-01-02 Academisch Ziekenhuis Bij De Universiteit Van Amsterdam The role of the N-myc - nm23H1/nm23H2 - cdc42 pathway in proliferation, differentiation and treatment of cancer
CN101273060A (zh) * 2005-06-24 2008-09-24 美国政府(由卫生和人类服务部、国立卫生研究院的部长所代表) 通过靶向肿瘤坏死因子受体的前配体装配域(plad)来缓解炎性关节炎
JP2008099662A (ja) * 2006-09-22 2008-05-01 Institute Of Physical & Chemical Research 幹細胞の培養方法
WO2008067065A2 (en) * 2006-10-19 2008-06-05 Shiv Srivastava Methods, kits, and systems for diagnosing and prognosing prostate cancer using secreted biomarkers
US20090075926A1 (en) * 2006-12-06 2009-03-19 Bamdad Cynthia C Method for identifying and manipulating cells
WO2009012173A2 (en) 2007-07-13 2009-01-22 Dharmacon, Inc. Enhanced biotherapeutic production using inhibitory rna
CN102272290B (zh) * 2008-10-09 2018-08-14 米纳瓦生物技术公司 用于在细胞中诱导多能性的方法
MX2011013385A (es) * 2009-06-11 2012-05-29 Minerva Biotechnologies Corp Metodos para cultivar celulas madre y celulas progenitoras.
EP3228629A1 (en) * 2010-06-16 2017-10-11 Minerva Biotechnologies Corporation Reprogramming cancer cells
AU2013289913A1 (en) * 2012-07-13 2015-03-05 Minerva Biotechnologies Corporation Method for inducing cells to less mature state

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of EP2877586A4 *

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12195728B2 (en) 2011-03-17 2025-01-14 Minerva Biotechnologies Corporation Method for making pluripotent stem cells
US11976295B2 (en) 2011-10-17 2024-05-07 Minerva Biotechnologies Corporation Media for stem cell proliferation and induction
AU2021200429C1 (en) * 2013-08-12 2023-11-30 Minerva Biotechnologies Corporation Method for enhancing tumor growth
AU2021200429B2 (en) * 2013-08-12 2023-05-11 Minerva Biotechnologies Corporation Method for enhancing tumor growth
JP2020073562A (ja) * 2014-04-07 2020-05-14 ミネルバ バイオテクノロジーズ コーポレーション 抗nme抗体
US12479928B2 (en) 2014-04-07 2025-11-25 Minerva Biotechnologies Corporation Anti-cancer peptide
WO2015157322A2 (en) 2014-04-07 2015-10-15 Minerva Biotechnologies Corporation Anti-nme antibody
JP2018203765A (ja) * 2014-04-07 2018-12-27 ミネルバ バイオテクノロジーズ コーポレーション 抗nme抗体
EP3129476A4 (en) * 2014-04-07 2017-11-08 Minerva Biotechnologies Corporation Anti-nme antibody
AU2015243948B2 (en) * 2014-04-07 2020-10-15 Minerva Biotechnologies Corporation Anti-NME antibody
TWI746420B (zh) * 2014-04-07 2021-11-21 美商密內瓦生物技術公司 抗nme抗體
JP2022095648A (ja) * 2014-04-07 2022-06-28 ミネルバ バイオテクノロジーズ コーポレーション 抗nme抗体
EP4050103A1 (en) * 2014-04-07 2022-08-31 Minerva Biotechnologies Corporation Anti-nme antibody
JP2017512825A (ja) * 2014-04-07 2017-05-25 ミネルバ バイオテクノロジーズ コーポレーション 抗nme抗体
CN106414726A (zh) * 2014-04-07 2017-02-15 米纳瓦生物技术公司 抗nme抗体
US11702483B2 (en) 2014-04-07 2023-07-18 Minerva Biotechnologies Corporation Method of treating an NME7 expressing cancer with a peptide
WO2015157322A3 (en) * 2014-04-07 2015-12-23 Minerva Biotechnologies Corporation Anti-nme antibody
EP3256494A4 (en) * 2015-02-10 2018-12-05 Minerva Biotechnologies Corporation Humanized anti-muc1* antibodies
US11897967B2 (en) 2015-02-10 2024-02-13 Minerva Biotechnologies Corporation Humanized anti-MUC1* antibodies
US11746159B2 (en) 2015-02-10 2023-09-05 Minerva Biotechnologies Corporation Humanized anti-MUC1* antibodies
US12006371B2 (en) 2015-02-10 2024-06-11 Minerva Biotechnologies Corporation Humanized anti-MUC1* antibodies
CN107660213B (zh) * 2015-02-10 2023-01-13 米纳瓦生物技术公司 人源化抗MUCl*抗体
CN107660213A (zh) * 2015-02-10 2018-02-02 米纳瓦生物技术公司 人源化抗muc1*抗体
US12037413B2 (en) 2019-02-04 2024-07-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12049514B2 (en) 2020-06-08 2024-07-30 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12415868B1 (en) 2020-06-26 2025-09-16 Minerva Biotechnologies Corporation Anti-NME antibody and method of treating cancer or cancer metastasis
US12491259B2 (en) 2022-04-12 2025-12-09 Minerva Biotechnologies Corporation Anti-variable MUC1* antibodies and uses thereof

Also Published As

Publication number Publication date
EP2877586A2 (en) 2015-06-03
WO2014018679A3 (en) 2015-05-07
EP4206318A1 (en) 2023-07-05
AU2019203098B2 (en) 2021-04-08
SG10201700593YA (en) 2017-03-30
JP2015529454A (ja) 2015-10-08
JP2021192614A (ja) 2021-12-23
CN111849874A (zh) 2020-10-30
IL236901A0 (en) 2015-03-31
IL236901B (en) 2021-03-25
US20150203823A1 (en) 2015-07-23
US20230049461A1 (en) 2023-02-16
JP6546087B2 (ja) 2019-07-17
EP2877586A4 (en) 2016-02-17
JP7386210B2 (ja) 2023-11-24
CA2880010A1 (en) 2014-01-30
AU2019203098A1 (en) 2019-05-23
SG11201606118SA (en) 2016-08-30
AU2013295811A1 (en) 2015-03-12
CN104995518A (zh) 2015-10-21
JP2019141100A (ja) 2019-08-29

Similar Documents

Publication Publication Date Title
US20230049461A1 (en) Nme variant species expression and suppression
US11976295B2 (en) Media for stem cell proliferation and induction
Fan et al. Alpha protocadherins and Pyk2 kinase regulate cortical neuron migration and cytoskeletal dynamics via Rac1 GTPase and WAVE complex in mice
JP7501824B2 (ja) より未分化状態への細胞の誘導方法
JP6862497B2 (ja) Nme阻害剤、及びnme阻害剤を使用する方法
EP3524672B1 (en) Reprogramming cancer cells
JP2011523558A (ja) 多能性関連後成的因子
US20240247229A1 (en) Media for stem cell proliferation and induction
Chen The Subcellular Localisation of HAX1 Isoforms and Their Roles in Cancer Cell Migration, Autophagy and Apoptosis.

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13823099

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2880010

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 236901

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2015524428

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2013823099

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2013295811

Country of ref document: AU

Date of ref document: 20130724

Kind code of ref document: A