WO2013171548A2 - Peptidos que inducen en peces una respuesta inmune contra copepodos y/o un escudo mucoso, vacunas, usos y métodos para modular la respuesta inmune de un pez y/o inducir la generación de un escudo mucoso - Google Patents
Peptidos que inducen en peces una respuesta inmune contra copepodos y/o un escudo mucoso, vacunas, usos y métodos para modular la respuesta inmune de un pez y/o inducir la generación de un escudo mucoso Download PDFInfo
- Publication number
- WO2013171548A2 WO2013171548A2 PCT/IB2012/052487 IB2012052487W WO2013171548A2 WO 2013171548 A2 WO2013171548 A2 WO 2013171548A2 IB 2012052487 W IB2012052487 W IB 2012052487W WO 2013171548 A2 WO2013171548 A2 WO 2013171548A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- caligus
- seq
- vaccine
- fish
- peptide
- Prior art date
Links
- 229960005486 vaccine Drugs 0.000 title claims description 239
- 108090000765 processed proteins & peptides Proteins 0.000 title claims description 114
- 241000251468 Actinopterygii Species 0.000 title claims description 103
- 102000004196 processed proteins & peptides Human genes 0.000 title claims description 65
- 241000239250 Copepoda Species 0.000 title claims description 31
- 238000000034 method Methods 0.000 title claims description 28
- 230000028993 immune response Effects 0.000 title claims description 22
- 238000011161 development Methods 0.000 title description 9
- 230000001939 inductive effect Effects 0.000 title 2
- 235000019688 fish Nutrition 0.000 claims description 103
- 108090000623 proteins and genes Proteins 0.000 claims description 58
- 102000004169 proteins and genes Human genes 0.000 claims description 58
- 239000002671 adjuvant Substances 0.000 claims description 28
- 239000000203 mixture Substances 0.000 claims description 28
- 241000277275 Oncorhynchus mykiss Species 0.000 claims description 22
- 241000277331 Salmonidae Species 0.000 claims description 20
- 241000542855 Megathura crenulata Species 0.000 claims description 19
- 241000277338 Oncorhynchus kisutch Species 0.000 claims description 19
- 241000277263 Salmo Species 0.000 claims description 19
- 230000000890 antigenic effect Effects 0.000 claims description 19
- 241001280377 Oncorhynchus tshawytscha Species 0.000 claims description 18
- 239000002480 mineral oil Substances 0.000 claims description 16
- 235000010446 mineral oil Nutrition 0.000 claims description 16
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 16
- 239000000839 emulsion Substances 0.000 claims description 15
- 108060003552 hemocyanin Proteins 0.000 claims description 13
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 claims description 11
- 241001247232 Caligidae Species 0.000 claims description 9
- 241000237988 Patellidae Species 0.000 claims description 9
- 241000277288 Salmo trutta Species 0.000 claims description 8
- 230000015572 biosynthetic process Effects 0.000 claims description 8
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 241001611011 Caligus Species 0.000 description 516
- 235000018102 proteins Nutrition 0.000 description 41
- 210000003097 mucus Anatomy 0.000 description 26
- 230000003053 immunization Effects 0.000 description 19
- 238000002255 vaccination Methods 0.000 description 19
- 241001247234 Lepeophtheirus salmonis Species 0.000 description 18
- 238000002649 immunization Methods 0.000 description 17
- 244000045947 parasite Species 0.000 description 16
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 16
- 241001611004 Caligus rogercresseyi Species 0.000 description 15
- 206010061217 Infestation Diseases 0.000 description 14
- 210000004027 cell Anatomy 0.000 description 14
- 210000002966 serum Anatomy 0.000 description 13
- 230000009467 reduction Effects 0.000 description 12
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 11
- 241001247233 Lepeophtheirus Species 0.000 description 10
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 10
- 235000018417 cysteine Nutrition 0.000 description 10
- 150000001413 amino acids Chemical group 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 241000972773 Aulopiformes Species 0.000 description 8
- 230000003071 parasitic effect Effects 0.000 description 8
- 210000002955 secretory cell Anatomy 0.000 description 8
- 239000000499 gel Substances 0.000 description 7
- 235000019515 salmon Nutrition 0.000 description 7
- 230000029087 digestion Effects 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- 230000000366 juvenile effect Effects 0.000 description 6
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 5
- 229940043264 dodecyl sulfate Drugs 0.000 description 5
- 210000000981 epithelium Anatomy 0.000 description 5
- 239000003921 oil Substances 0.000 description 5
- 230000003248 secreting effect Effects 0.000 description 5
- 239000011734 sodium Substances 0.000 description 5
- 229910052708 sodium Inorganic materials 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 4
- BLFLLBZGZJTVJG-UHFFFAOYSA-N benzocaine Chemical compound CCOC(=O)C1=CC=C(N)C=C1 BLFLLBZGZJTVJG-UHFFFAOYSA-N 0.000 description 4
- 230000002596 correlated effect Effects 0.000 description 4
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical compound CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- 210000002615 epidermis Anatomy 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 4
- 229920002401 polyacrylamide Polymers 0.000 description 4
- 239000013535 sea water Substances 0.000 description 4
- 239000007790 solid phase Substances 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 241001674048 Phthiraptera Species 0.000 description 3
- 241000607479 Yersinia pestis Species 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000021615 conjugation Effects 0.000 description 3
- 230000000875 corresponding effect Effects 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000004949 mass spectrometry Methods 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 238000005070 sampling Methods 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- 231100000699 Bacterial toxin Toxicity 0.000 description 2
- 241000571350 Caligus aesopus Species 0.000 description 2
- 241001235715 Caligus belones Species 0.000 description 2
- 241000571347 Caligus callaoensis Species 0.000 description 2
- 241001235711 Caligus centrodonti Species 0.000 description 2
- 241000420702 Caligus cheilodactyli Species 0.000 description 2
- 241000571348 Caligus chorinemi Species 0.000 description 2
- 241001235719 Caligus curtus Species 0.000 description 2
- 241001382015 Caligus diaphanus Species 0.000 description 2
- 241001405819 Caligus elongatus Species 0.000 description 2
- 241001235713 Caligus gurnardi Species 0.000 description 2
- 241001325422 Caligus longirostris Species 0.000 description 2
- 241000571430 Caligus mutabilis Species 0.000 description 2
- 241001155277 Caligus punctatus Species 0.000 description 2
- 241001382014 Caligus quadratus Species 0.000 description 2
- 241000571422 Caligus robustus Species 0.000 description 2
- 241000571399 Caligus serratus Species 0.000 description 2
- 241000571400 Caligus tylosuri Species 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 241001436044 Chelifer Species 0.000 description 2
- 102000009016 Cholera Toxin Human genes 0.000 description 2
- 108010049048 Cholera Toxin Proteins 0.000 description 2
- 241000522241 Cordyla <angiosperm> Species 0.000 description 2
- 101710146739 Enterotoxin Proteins 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 229920001503 Glucan Polymers 0.000 description 2
- 241001401881 Longicaudus Species 0.000 description 2
- 241000781273 Longipedis Species 0.000 description 2
- 241000187481 Mycobacterium phlei Species 0.000 description 2
- 241000123077 Ocyurus Species 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 241000873862 Paracyclopina nana Species 0.000 description 2
- 241000606012 Pectinatus Species 0.000 description 2
- 241000882917 Pomacentrus Species 0.000 description 2
- 241001098657 Pterois Species 0.000 description 2
- 241000353093 Raniceps Species 0.000 description 2
- 241000238680 Rhipicephalus microplus Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 241001194796 Schistonyx Species 0.000 description 2
- 241001290310 Sciaenops Species 0.000 description 2
- 241001187507 Sicarius Species 0.000 description 2
- 241000045687 Tigriopus japonicus Species 0.000 description 2
- 241000607598 Vibrio Species 0.000 description 2
- 101710161198 Vitellogenin-1 Proteins 0.000 description 2
- 230000003187 abdominal effect Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 238000005273 aeration Methods 0.000 description 2
- 235000001014 amino acid Nutrition 0.000 description 2
- 125000004103 aminoalkyl group Chemical group 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 230000036528 appetite Effects 0.000 description 2
- 235000019789 appetite Nutrition 0.000 description 2
- 238000009360 aquaculture Methods 0.000 description 2
- 244000144974 aquaculture Species 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 239000000688 bacterial toxin Substances 0.000 description 2
- 229960005274 benzocaine Drugs 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- FVMOEFABYNPCDS-UHFFFAOYSA-L calcium;1-(4-carboxy-2,6-dioxocyclohexylidene)propan-1-olate Chemical compound [Ca+2].CCC([O-])=C1C(=O)CC(C(O)=O)CC1=O.CCC([O-])=C1C(=O)CC(C(O)=O)CC1=O FVMOEFABYNPCDS-UHFFFAOYSA-L 0.000 description 2
- 239000012141 concentrate Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 238000003795 desorption Methods 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 239000000147 enterotoxin Substances 0.000 description 2
- 231100000655 enterotoxin Toxicity 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 238000009313 farming Methods 0.000 description 2
- 150000008271 glucosaminides Chemical class 0.000 description 2
- 229960002751 imiquimod Drugs 0.000 description 2
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 2
- 239000002955 immunomodulating agent Substances 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 230000002434 immunopotentiative effect Effects 0.000 description 2
- 230000000091 immunopotentiator Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 210000000936 intestine Anatomy 0.000 description 2
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical class O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 2
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 229940055036 mycobacterium phlei Drugs 0.000 description 2
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 229950010550 resiquimod Drugs 0.000 description 2
- BXNMTOQRYBFHNZ-UHFFFAOYSA-N resiquimod Chemical compound C1=CC=CC2=C(N(C(COCC)=N3)CC(C)(C)O)C3=C(N)N=C21 BXNMTOQRYBFHNZ-UHFFFAOYSA-N 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 229930182490 saponin Natural products 0.000 description 2
- 150000007949 saponins Chemical class 0.000 description 2
- 108010004034 stable plasma protein solution Proteins 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 230000000451 tissue damage Effects 0.000 description 2
- 231100000827 tissue damage Toxicity 0.000 description 2
- 239000000277 virosome Substances 0.000 description 2
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 1
- VZQHRKZCAZCACO-PYJNHQTQSA-N (2s)-2-[[(2s)-2-[2-[[(2s)-2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]prop-2-enoylamino]-3-methylbutanoyl]amino]propanoic acid Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)C(=C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VZQHRKZCAZCACO-PYJNHQTQSA-N 0.000 description 1
- ZTOJFFHGPLIVKC-UHFFFAOYSA-N 3-ethyl-2-[(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound S1C2=CC(S(O)(=O)=O)=CC=C2N(CC)C1=NN=C1SC2=CC(S(O)(=O)=O)=CC=C2N1CC ZTOJFFHGPLIVKC-UHFFFAOYSA-N 0.000 description 1
- 241000238876 Acari Species 0.000 description 1
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- OBMZMSLWNNWEJA-XNCRXQDQSA-N C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 Chemical compound C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 OBMZMSLWNNWEJA-XNCRXQDQSA-N 0.000 description 1
- 241000109841 Caligus fugu Species 0.000 description 1
- 241000571427 Caligus hoplognathi Species 0.000 description 1
- 241001235717 Caligus pelamydis Species 0.000 description 1
- 241000571424 Caligus sclerotinosus Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 235000008733 Citrus aurantifolia Nutrition 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 108010040721 Flagellin Proteins 0.000 description 1
- 229920002683 Glycosaminoglycan Polymers 0.000 description 1
- 206010022095 Injection Site reaction Diseases 0.000 description 1
- 241001235686 Lepeophtheirus pectoralis Species 0.000 description 1
- 241001382017 Lepeophtheirus thompsoni Species 0.000 description 1
- 241000972747 Macrourus Species 0.000 description 1
- 241000542857 Megathura Species 0.000 description 1
- 241000237852 Mollusca Species 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 101710176384 Peptide 1 Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 206010035148 Plague Diseases 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 241000277289 Salmo salar Species 0.000 description 1
- 241000306752 Salmoneus Species 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 235000011941 Tilia x europaea Nutrition 0.000 description 1
- 101710161186 Vitellogenin-2 Proteins 0.000 description 1
- YVNQAIFQFWTPLQ-UHFFFAOYSA-O [4-[[4-(4-ethoxyanilino)phenyl]-[4-[ethyl-[(3-sulfophenyl)methyl]amino]-2-methylphenyl]methylidene]-3-methylcyclohexa-2,5-dien-1-ylidene]-ethyl-[(3-sulfophenyl)methyl]azanium Chemical compound C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C(=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S(O)(=O)=O)C)C=2C(=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S(O)(=O)=O)C)C=C1 YVNQAIFQFWTPLQ-UHFFFAOYSA-O 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- ZCHPKWUIAASXPV-UHFFFAOYSA-N acetic acid;methanol Chemical compound OC.CC(O)=O ZCHPKWUIAASXPV-UHFFFAOYSA-N 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 239000001099 ammonium carbonate Substances 0.000 description 1
- 235000012501 ammonium carbonate Nutrition 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- QXJJQWWVWRCVQT-UHFFFAOYSA-K calcium;sodium;phosphate Chemical compound [Na+].[Ca+2].[O-]P([O-])([O-])=O QXJJQWWVWRCVQT-UHFFFAOYSA-K 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 210000004520 cell wall skeleton Anatomy 0.000 description 1
- 239000000919 ceramic Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000000326 densiometry Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- MCPKSFINULVDNX-UHFFFAOYSA-N drometrizole Chemical compound CC1=CC=C(O)C(N2N=C3C=CC=CC3=N2)=C1 MCPKSFINULVDNX-UHFFFAOYSA-N 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 230000003628 erosive effect Effects 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 239000013505 freshwater Substances 0.000 description 1
- 230000014509 gene expression Effects 0.000 description 1
- 210000002175 goblet cell Anatomy 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000001759 immunoprophylactic effect Effects 0.000 description 1
- 230000001524 infective effect Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 208000028454 lice infestation Diseases 0.000 description 1
- 239000004571 lime Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000000426 osmoregulatory effect Effects 0.000 description 1
- 230000036281 parasite infection Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 229940023041 peptide vaccine Drugs 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 238000009021 pre-vaccination Methods 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000007790 scraping Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1767—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0003—Invertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/14—Ectoparasiticides, e.g. scabicides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/06—Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
Definitions
- Copepods of the family Caligidae commonly called sea lice are the most reported ecoparasites in wild and cultivable salmon species.
- Vaccines have been described that use vitogelin 1 as antigens (EP 2 405 003 and WO2007 / 039599), antigens comprising proteins fused to a promiscuous T-cell epitope (US 2010/00221271), however there is still a need to find vaccines highly efficient and easier to prepare for the immunization of fish that can be infested with copepods. In addition, compositions or vaccines that generate in the fish the formation of a mucous shield of protection against copepod infestation are needed.
- Figure 1 shows the proteins extracted from C rogercresseyi separated on an 8% sodium polyacrylamide dodecyl sulfate gel under reducing conditions. Callel: Molecular Weight Marker (Fermentas # SM1811). Lane 2: C rogercresseyi soluble protein concentrate;
- Figure 2 shows the amino acid sequences SEQ ID No. 1, SEQ ID No. 2 and SEQ ID No. 3 and the peptides that served as identification are marked; SEQ ID No. 1 Vitellogenin 1 [Lepeophtheirus salmonis], SEQ ID No. 2 Vitellogenin 2 [Lepeophtheirus salmonis] and SEQ ID No. 3 Vitellogenin-like protein [Lepeophtheirus salmonis];
- Figure 3 shows in a graph the efficacy of the vaccine A of the invention as the percentage of reduction of the amount of post-challenge parasitic stages in the trout immunized with respect to the controls in three stages of the challenge: fixation, development of Chalimus youth stages (I to IV) and adults (males and females).
- Figure 4 shows in a graph the average abundance of adult male and female parasites found per fish and the standard deviation corresponding to each group (vaccine A and controls);
- the specific antibody titers were determined by the Elisa technique;
- Figure 6 shows the amino acid sequence SEQ ID No. 1 and the peptides of the invention are indicated;
- Figure 7 shows in a graph the efficacy of the vaccines of the invention as the percentage reduction in the amount of post-challenge parasitic stages in Atlantic salmon immunized with respect to controls, in three stages of the challenge: fixation , development of juvenile stages (Chalimus I to IV) and adults (males and females);
- Figure 8 shows in a graph the average abundance of adult male and female parasites found per fish and the standard deviation corresponding to each group (vaccines 1-7 of the invention and controls);
- Figure 9 shows in a graph the induction kinetics of specific antibodies in Atlantic Salmon vaccinated with the different vaccines of the invention and their controls, challenged with C rogercresseyi infectious stages.
- Figure 10 shows in a graph the induction kinetics of specific antibodies in Atlantic Salmon mucus vaccinated with the different vaccines of the invention and their controls, challenged with C rogercresseyi infectious stages
- Figure 11 shows in a graph the correlation between the reduction percentage of the PRI infestation (%) and the serology expressed as Reverse of the Log of the specific antibody titer for vaccines 1 and A.
- Figure 12 shows the results of the histological analysis of the epidermis of vaccinated fish with the different vaccines and their controls performed at time 0, 10, 20 and 30 days after vaccination. Skin sections stained with PAS-Alcian Blue are observed where mucus secretory cells are identified.
- Figure 13 shows the histological analysis of the epidermis of vaccinated fish with the different vaccines and their controls, performed daily 40-50-80 and 120 during the course of immunization and challenge (below). PAS-stained skin cuts are observed where mucus secretory cells are identified.
- Figure 14 shows the application scheme and timeline where acclimatization is observed, fish immunization, challenge with the parasite and sampling.
- Fish can be salmonids, such as Atlantic salmon (Salt Psalm), Rainbow trout (Oncorhynchus mykiss), Coho salmon (Oncorhynchus kisutch), common trout (Salmo trutta) or Chinook salmon (O.
- the copepods can be Caligus rogercresseyi, Caligus absens, Caligus Acanthopagri, Caligus disposecus, Caligus aesopus, Caligus affinis, Caligus furcatus, Caligus alaihi, Caligus alatus, Caligus amblygenitalis, Caligus angustatus, Caligus arigus Caligus caligus, Caligus arigus Caligus caligus, Caligus arigus Caligus caligus, Caligus arigus caligus, Caligus arigus caligus, Caligus arigus caligus, Caligus arigus caligus, Caligus arigus caligus, Caligus arigus caligus, Caligus arigus caligus Caligus asymmetricus, Caligus atromaculatus, Caligus balistae, Caligus belones, Caligus
- the peptide may be conjugated to an antigenic protein, for example the peptide may be covalently conjugated to hemocyanin (KLH - keyhole limpet hemocyanin) of Megathura crenulata, or others.
- hemocyanin KLH - keyhole limpet hemocyanin
- a vaccine is provided against copepods that infest fish comprising at least one peptide, wherein said peptide has at least 90%, for example 91, 92, 93, 94, 95, 96, 97, 98 and 99% identity with the Sequences SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 22, SEQ ID No. 22, SEQ ID No. 23, SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27 or SEQ ID No. 28: and excipients and adjuvants.
- the adjuvant can be any known adjuvant, for example Megathura crenulata hemocyanin (keyhole limpet) (H8283-Sigma), a purified saponin, ⁇ (1-3) D-glucans of yeasts, synthetic or natural microbial derivatives such as monophosphoryl lipid A ( MPL), virosomes, polylactic-glycolic acid microparticles, skeleton of the Mycobacterium phlei cell wall, aminoalkyl glucosaminide phosphate, synthetic acetylated monosaccharides, derivatives of lipid A, flagelin, oligodeoxynucleotides containing CpG motifs, genetically modified bacterial toxins, Vibrio colerae cholera toxin, Escherichia coli heat-absorbed enterotoxin, human immunomodulators , chemokines, immunopotentiators, double stranded RNA, small immunopotentiating molecules such as imiquimod, resi
- the vaccine is an emulsion and the excipient is a non-mineral oil Montanide ISA 763 Seppic.
- the fish to be treated can be salmonids, such as Atlantic salmon (Salt Psalm), Rainbow trout (Oncorhynchus mykiss), Coho salmon (Oncorhynchus kisutch), common trout (Salmo trutta) or Chinook salmon (O.
- the copepods can be without limitation, Caligus absens, Caligus Acanthopagri, Caligus disposecus, Caligus aesopus, Caligus affinis, Caligus furcatus, Caligus alaihi, Caligus alatus, Caligus amblygenitalis, Caligus angustatus, Caligus arigus, Caligus arigus, Caligus arigus Caligus arigus , Caligus asymmetricus, Caligus atromaculatus, Caligus balistae, Caligus belones, Caligus bennetti, Caligus berychis, Caligus biaculeatus, Caligus bicycletus, Caligus bifurcatus, Caligus bifurcus, Caligus biseriodentatus, Caligus breig Caligus caligus, Caligus breig Caligus caligus, Caligus
- a vaccine can comprise a combination of 4 peptides, for example: the peptides of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19 and SEQ ID No. 20; or the peptides SEQ ID No. 21, SEQ ID No. 22, SEQ ID No. 23 and SEQ ID No. 24; or the peptides SEQ ID N ° 25, SEQ ID N ° 26, SEQ ID N ° 27 and SEQ ID N ° 28.
- 4 peptides for example: the peptides of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19 and SEQ ID No. 20; or the peptides SEQ ID No. 21, SEQ ID No. 22, SEQ ID No. 23 and SEQ ID No. 24; or the peptides SEQ ID N ° 25, SEQ ID N ° 26, SEQ ID N ° 27 and SEQ ID N ° 28.
- the adjuvant can be any adjuvant known to those skilled in the art, for example Megathura crenulata hemocyanin (keyhole limpet ) (H8283-Sigma), a purified saponin, ⁇ (1-3) D-glucans from yeasts, synthetic or natural microbial derivatives such as monophosphoryl lipid A (MPL), virosomes, polylactic-glycolic acid microparticles, cell wall skeleton of Mycobacterium phlei, aminoalkyl glucosaminide phosphate, synthetic acetylated monosaccharides, derivatives of lipid A, flagellin, oligodeoxynucleotides containing CpG motifs, genetically modified bacterial toxins, Vibrio colerae cholera toxin, Escherichia coli heat labile enterotoxin, human immunomodulatory cytokine, human immunomodulators , immunopotentiators, double stranded RNA, small immunopotentiating
- the peptides may be conjugated to an antigenic protein, for example KLH or another known one.
- the use of the peptide is also provided to prepare a vaccine that induces an immune response in fish or to prepare a composition that generates in the fish the formation of a protective mucous shield.
- a vaccine is also provided against copepods that infest fish comprising the proteins of SEQ ID No. 1, SEQ ID No. 2 and SEQ ID No. 3; excipients and adjuvants.
- a method to modulate the immune response of a fish that comprises administering to said fish a necessary amount of a vaccine comprising at least one peptide chosen from SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22, SEQ ID No. 23, SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27 or SEQ ID No. 28; and excipients.
- the method comprises the administration of between 1 and 500 ⁇ g of the peptide.
- the vaccine comprises 4 peptides, it is administered between 1 and 500 ⁇ g of each peptide.
- the peptide may be conjugated to an antigenic protein, for example KLH.
- a method for generating the formation of a mucous shield in a fish comprises administering to said fish a necessary amount of a vaccine comprising at least one peptide that has at least 90% identity with a sequence selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 22, SEQ ID No. 22, SEQ ID No. 23, SEQ ID No. 24, SEQ ID N ° 25, SEQ ID N ° 26, SEQ ID N ° 27, SEQ ID N ° 28 and combinations thereof; and excipients.
- administer between 1 and 500 ⁇ g of the peptide.
- the fish can be Atlantic salmon (Salmo Salar), Rainbow trout (Oncorhynchus mykiss) and Coho salmon (Oncorhynchus kisutch), common trout (Salmo trutta) and Chinook salmon (O. tshawytscha) and the copepods can be from the Caligidae family.
- the peptide may be conjugated to an antigenic protein, for example hemocyanin hemocyanin of keyhole limpet of Megathura crenulata.
- the term "vaccine” refers to a composition that induces an immune response in an animal, for example in fish and also refers to a composition that induces the formation of a mucous shield, wherein said shield It is a biological protection against infestation of copepods in fish.
- Soluble candidate proteins as immunogens were separated by electrophoresis in 8% sodium polyacrylamide dodecyl sulfate gels from a suspension of homogenized adult Caligus rogercresseyi parasites.
- Table 1 shows the amino acid sequence of Vitelogenin 1 [Lepeophtheirus salmonis], Vitelogenin 2 [Lepeophtheirus salmonis] and Vitelogenin-like protein [Lepeophtheirus salmonis] proteins indicating the homology of the peptides identified with the isolated proteins of Caligus rogercresseyi.
- Vitelogenin 1 [Lepeophtheirus SLAVYALK (SEQ ID No. 4) salmonis] (SEQ ID No. 1) FYMETIQKV (SEQ ID No. 5)
- KVETTMGVISPFTKQ (SEQ ID No. 6)
- Vitelogenin 2 [Lepeophtheirus KALVALFQTKM (SEQ ID No. Salmonis] (SEQ ID No. 2) 212 kDa 7)
- VKNSVVAFR (SEQ ID No. 11)
- WGSSYNVYSFLK (SEQ ID No. 16)
- the peptides obtained from the digestion of the isolated Caligus rogercresseyi proteins of the invention were correlated with known proteins of the vitelogenin family,
- Figure 2 shows the sequence of Vitelogenin 1 [Lepeophtheirus salmonis], Vitelogenin 2 [ Lepeophtheirus salmonis] and Vitelogenin-like protein [Lepeophtheirus salmonis] and the peptides found that are part of the amino acid sequence of the proteins of the invention are indicated.
- Vaccine A comprises 1 ⁇ g of each of the following proteins: 220kDa (SEQ ID No. 1), 212kDa (SEQ ID No. 2) and 173kDa (SEQ ID No. 3) in an oily emulsion formulated with non-mineral Montanide oil ISA 763 Seppic (70 v / v oil-30 v / v water), and 10 ⁇ g of Megathura crenulata hemocyanin (keyhole limpet) (H8283-Sigma).
- Non-specific control composition Each dose contained 3 ⁇ g of BmSS (recombinant BmSS protein from Boophilus microplus intestine) in an oily emulsion formulated with non-mineral oil Montanide ISA 763 Seppic (70 v / v oil-30 v / v water) and 10 ⁇ g of hemocyanin from Megathura crenulata (keyhole limpet) (H8283-Sigma).
- BmSS synthetic BmSS protein from Boophilus microplus intestine
- oily emulsion formulated with non-mineral oil Montanide ISA 763 Seppic (70 v / v oil-30 v / v water) and 10 ⁇ g of hemocyanin from Megathura crenulata (keyhole limpet) (H8283-Sigma).
- Adjuvant control composition Each dose contained 30 ⁇ of PBS in an oily emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70 v / v oil - 30 v / v water) and 10 ⁇ g of Megathura crenulata hemocyanin (keyhole limpet) ( H8283- Sigma).
- PBS control composition Each dose contained only 100 ⁇ of PBS.
- the fish were challenged by infection with C. rogercresseyi During the period of immunization, challenge and monitoring of the fish it was observed that the vaccines did not cause local, systemic, inflammatory and / or granulomatous reactions at the site of administration. Vaccines were safe and safe. No composition or vaccine modified the behavior or appetite of the fish.
- the average abundance that was calculated as the average adult male and female parasites per fish was determined, considering the total amount of fish in each group (Fig 4).
- the average amount of adult male and female parasites per fish of the Control PBS group was 4.1 and 4.6 times greater than the amount detected in the fish treated with the vaccine A of the invention.
- Fish immunized with vaccine A showed a smaller difference in abundance between males and females.
- Figure 5 shows the specific antibody titres detected by ELISA in the serum of animals treated with the different vaccines. Only vaccine A was found to be immunogenic, showing a significant difference with respect to the antibody titers of the fish inoculated with the nonspecific controls, adjuvant and PBS.
- the present invention also relates to peptides and combinations thereof conjugates or not, in a composition or oil vaccine preventive and / or activating the humoral immune response of salmonids.
- the peptides or their combination increase the density of the mucus, the amount and diameter of the secretory cells and the thickness of the epithelium, generating a biological or mucous shield against infestation with pathogens, for example the C. rogercresseyi sea lice, reducing 80% (with respect to control) the amount of lice in juvenile and adult stages after the challenge with the parasite in treated salmonids.
- the proteins of the invention identified by mass spectroscopy having a molecular weight of 220 kDa (SEQ ID No. 1), 212kDa (SEQ ID No. 2) and 173kDa (SEQ ID No. 3) belong to the multimer of the vitelogenin family.
- an analysis of the prediction of linear B epitopes with BepiPred 1.0b (Technical University of Denmark) of the 220 kDa protein (Vitellogenin 1 [Lepeophtheirus salmonis] (SEQ) was performed ID No. 1) 12 peptides were selected whose sequence is highlighted in Figure 6.
- the selected peptides were also conjugated to hemocyanin extracted from mollusk called Lapa californiana (KLH - Keyhole limpet hemocyaninde Lapa californiana).
- Cysteine was added to COOHt, and conjugated to KLH.
- Peptide 2 ESLFVEKDEPVVVTNWKKALL (SEQ ID N ° 18). PM: 2548.01
- Cysteine was added to COOHt, and conjugated to KLH.
- Peptide 3 SQKEIHEVMEESGRACTGKQ (SEQ ID N ° 19) PM: 2282.70
- KLH was conjugated in the cysteine sequence.
- Peptide 4 STVSHQIPKPKTPKTVGNLF (SEQ ID No. 20) PM: 2282.70.
- Cysteine was added to COOHt, and conjugated to KLH.
- Peptide 5 KTLKAKSPQLYYVSTVSFSD (SEQ ID N ° 21) PM: 2282.70
- Cysteine was added to COOHt, and conjugated to KLH.
- Peptide 6 QKITQKLQITPRTLQEPELS (SEQ ID N ° 22) PM: 2282.70
- Cysteine was added to COOHt, and conjugated to KLH.
- Peptide 7 HGLPFKYTKTRNFVDVQSVAPTASGFPVRIQ (SEQ ID No. 23) PM: 2282.70
- Cysteine was added to COOHt, and conjugated to KLH.
- Peptide 8 CSQSSTNTVNPNTCEEKERS (SEQ ID N ° 24) PM: 2282.70
- KLH was conjugated in the sequence cysteine.
- Peptide 9 PVNESSGSSTPPSSTPGPLL (SEQ ID No. 25) PM: 2282.70
- Cysteine was added to COOHt, and conjugated to KLH.
- Peptide 10 SCQGIPTPEEKTKFEKESHE (SEQ ID No. 26) PM: 2282.70
- KLH was conjugated in the cysteine sequence.
- Peptide 11 PTTYNRMIEE ASNCQS SSS SGSGMGGGS (SEQ ID No. 27) PM: 2282.70 It was conjugated to KLH in the sequence cysteine.
- Peptide 12 SSPSSSDSSSHHAQPSTGRFQ (SEQ ID No. 28) PM: 2282.70
- Cysteine was added to COOHt, and conjugated to KLH.
- Peptides 1 to 4 correspond to the amino terminal sequence
- peptides 5 to 8 correspond to the middle region
- peptides 9 to 12 correspond to the carboxyl terminal region of vitelogenin 1 protein (SEQ ID No. 1) of Lepeophtheirus salmonis.
- Vaccine 1 of the invention comprised 50 ⁇ g of each of conjugated peptides 1-4
- Vaccine 2 of the invention comprised 50 ⁇ g of each of the conjugated 5-8 peptides
- Vaccine 3 of the invention comprised 50 ⁇ g of each of the conjugated 9-12 peptides (peptides SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27 and SEQ ID No. 28);
- Each of the vaccines was prepared as an emulsion in non-mineral oil Montanide
- Vaccine 5 of the invention comprised 50 ⁇ g of each of the unconjugated peptides 1-4 (peptides SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19 and SEQ ID No. 20);
- Vaccine 6 of the invention comprised 50 ⁇ g of each of the unconjugated 5-8 peptides (peptides SEQ ID No. 21, SEQ ID No. 22, SEQ ID No. 23 and SEQ ID No. 24);
- Vaccine 7 of the invention comprised 50 ⁇ g of each of the unconjugated 9-12 peptides (peptides SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27 and SEQ ID No. 28).
- Each of the vaccines was prepared as an emulsion in non-mineral oil Montanide
- Composition 8 corresponds to the adjuvant control composition: Each dose contained 30 ⁇ of PBS in an oily emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70% v / v oil-30% v / v water) and more 10 ⁇ g of keyhole limpet hemocyanin from Megathura crenulata (H8283-Sigma).
- Composition 9 corresponds to the PBS control composition: Each dose of Control PBS vaccine contained only 0.05 ⁇ of PBS.
- Vaccines were safe and safe. No composition or vaccine modified the behavior or appetite of the fish.
- Vaccines 1 and A proved to be the most effective. Vaccine 1 showed a reduction of 81% and 77.7% and vaccine A of 72 and 68.5% in the number of juvenile and adult specimens, respectively. The reduction in the number of specimens was smaller for vaccines 2, 3, 4, 5, 6 and 7 (Fig 7).
- the average abundance per fish was determined.
- the average abundance corresponds to the amount of adult male and female parasites found in each fish with respect to the total amount in the totality of the fish of each group.
- the amount of adult male and female parasites found per fish in the Control PBS group was 5.5 and 3.88 times higher than that detected in fish treated with vaccine 1, which comprised peptides 1-4 conjugated to KLH, observing in the latter vaccine, the smallest difference in the average abundance between males and females (Fig 8).
- the sera were titrated in serial dilutions to the medium from the 1: 4 dilution.
- the coefficient of variation of positive and negative sera was calculated in 12 determinations that resulted in values between 4 and 19%.
- the results show that the immunization of Atlantic Salmon with a 200ug dose of peptide 1-4 (vaccine 1) induces high titers of specific serum antibodies, detected by ELISA (Fig 9).
- a single immunization was sufficient to induce in the vaccinated fish, serum titers greater than 1.5 and 2 Log between 20 and 40 dpv that were increased to 3 log during the course of immunization.
- Serum titres obtained from fish treated with vaccine 1 were correlated with the increase in specific antibody levels found in the group of fish vaccinated with vaccine A.
- Vaccines 2-3-5-6 and 7 induced similar serum titers. and lower than those observed with vaccines 1 and A.
- Controls with PBS and adjuvant did not induce specific antibody response in vaccinated fish (Fig. 9).
- the level of specific antibodies was determined by measuring absorbance at 405 nm in mucus extracted from vaccinated fish (Fig 10). The samples were tested undiluted. The results show, for example, that a single immunization of Atlantic Salmon with 200ug of peptide 1-4 formulated with hemocyanin in non-mineral oil (vaccine 1) induced the production of mucus-specific antibodies that were increased during the immunization period . These antibody levels obtained by immunizing the fish with vaccine 1 were correlated with the increase in levels of specific antibodies found in the mucus of the group of fish vaccinated with the vaccine A. Vaccines 2-3-5-6 and 7 induced levels minors of antibodies. Controls with PBS and adjuvant did not induce specific antibody response in the mucus of untreated control fish (Fig 10).
- the peptides and vaccines of the invention can be used to immunize against any type of copepods, since the peptides used are comprised in vitogelin 1 of for example Lepeophtheirus salmonis or other known copepods.
- Table 8 Thickness, quantity and diameter of mucus secretory cells at day 80 post-vaccination for the different vaccines and control groups.
- Table 9 Thickness, quantity and diameter of mucus secreting cells at day 120 post-vaccination for the different vaccines and control groups.
- the peptides and vaccines of the invention can be used as compositions that generate a mucous shield, and as can be seen the mucous shield decreases the ability to copepod infestation in treated fish.
- Example 1 Isolation, processing, analysis, identification of proteins and obtaining peptides
- Proteins were isolated from a suspension of 0.5g adult specimens of C. rogercresseyi in PBS-Tween 0.05%. The samples were frozen and homogenized with Precellys 24 tissue homogenizer (Bertin Technologies-France using 2mL tubes containing ceramic and glass spheres (prefilled bead- tubes Cat. No. 03119.200.RD000 Precellys-France). Two cycles of 50 sec were performed at 6000 rpm, then centrifuged at 5000 rpm for 15 min in a centrifuge (Eppendorf Refrigerated Microcentrifuge Model 5417 R-USA).
- the supernatant was collected and subsequently concentrated with CentriPlus YM50 (cut off> 50 kDa) (Millipore-Fisher Sci) at 2500 rpm in a Sorvall centrifuge with SS34 rotor.
- the soluble proteins collected were separated by electrophoresis in 8% sodium polyacrylamide-dodecyl sulfate gels under reducing and non-reducing conditions and colored with Coomassie Brilliant Blue G-250 according to Laemmli et al 1970.
- Processing was performed by triptic digestion followed by cursed mass spectrometry (Matrix-Assisted Laser Desorption / Ionization-time of flight).
- the samples subjected to triptic digestion were injected into the column and the peptides were eluted with 0.1M acetic acid-100% acetonitrile with a gradient flow of 0.4 ⁇ 1 / ⁇ for 2 hours.
- the nanospray source was operated at 2.5 kV.
- Triptic digestion and maldi-tof mass spectrometry analysis of the bands extracted from the gel determined that different peptide fractions were obtained that were analyzed using the Sequest algorithm and the NCBI NR-2006 database.
- Conjugated peptides were obtained by solid phase chemical synthesis techniques (SPPS).
- SPPS solid phase chemical synthesis techniques
- the SPPS follows a general pattern of repetitive coupling-washing-deprotection-washing cycles.
- the free terminal amino terminus of a peptide bound in a solid phase is coupled to a single protected N amino acid unit. This unit is then unprotected, thus showing a new amino end to which another amino acid can bind.
- the conjugation to KLH was performed through the free cysteine group or to the addition thereof using the MBS method (m-Maleimidobenzoyl-N-hydroxysuccinimide Ester or activated maileimide) preferred for coupling of amino acids according to Hermanson.
- MBS method m-Maleimidobenzoyl-N-hydroxysuccinimide Ester or activated maileimide
- the peptides were sequenced using the method described by Merrifield
- Vaccine A Three soluble high molecular weight proteins were selected from the parasite homogenate. Protein quantification was performed by densitometry in a UV-P System densitometer using BSA (V-Sigma fraction) as a reference. Each dose of vaccine A contained 1 ⁇ g of each of the proteins of 220465.60 Da (SEQ ID No. 1), 212947.00 Da (SEQ ID No. 2) and 173132.50 Da (SEQ ID No.
- Inespecific Control Composition Recombinant BmSS protein from Boophilus microplus intestine, highly immunogenic and protective in the infestation of bovines with native ticks was used. Each vaccine dose contained 3 ⁇ g of BmSS in an oily emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70 v / v oil - 30 v / v water) and 10 ⁇ g of keyhole hemocyanin limg of Megathura crenulata (H8283-Sigma) .
- Adjuvant Control Composition Each dose of adjuvant control vaccine contained 30 ⁇ of PBS in an oily emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70 v / v oil-30 v / v water) and 10 ⁇ g of Megathura keyhole limpet hemocyanin crenulata (H8283-Sigma).
- Control PBS vaccine contained only 100 ⁇ of PBS. Once the peptides were obtained, part of them were conjugated with the KLH antigenic protein by a liquid phase conjugation method as described in the examples. The following vaccines were prepared:
- Vaccine 1 comprised 50 ⁇ g of each of conjugated peptides 1-4 (SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19 and SEQ ID No. 20);
- Vaccine 2 comprised 50 ⁇ g of each of the conjugated peptides 5-8 (SEQ ID No. 21, SEQ ID No. 22, SEQ ID No. 23 and SEQ ID No. 24);
- Vaccine 3 comprised 50 ⁇ g of each of the conjugated peptides 9-12 (SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27 and SEQ ID No. 28);
- Vaccine 5 comprised 50 ⁇ g of each of conjugated peptides 1-4;
- Vaccine 6 comprised 50 ⁇ g of each of the 5-8 unconjugated peptides
- Vaccine 7 comprised 50 ⁇ g of each of the unconjugated 9-12 peptides.
- composition 8 Control Adjuvants: Each dose of adjuvant control vaccine contained 30 ⁇ of PBS in an oily emulsion formulated with Montanide ISA 763 Seppic non-mineral oil (70 v / v oil-30 v / v water) and more 10 ⁇ g of keyhole limpet hemocyanin of Megathura crenulata (H8283-Sigma).
- Control PBS Each dose of Control PBS vaccine contained only 0.05 ml of PBS.
- rainbow trout Oncorhynchus mykiss
- Group 1 was vaccinated with vaccine A, group 2 with the nonspecific control composition, Group 3 with the adjuvant control composition and Group 4 with PBS only.
- the tests were carried out in the Aquaculture Unit of the city of Mercedes (Province of wholesome Aires, Argentina).
- the animals were acclimatized for 4 days in fresh water in 200 L ponds at a temperature between 17-20 ° C, with 5 mg / 1 oxygen (minimum), with a replacement rate of 1L / hour and with a density of up to 20 Kg / m3.
- the fish were anesthetized with 20% Benzocaine at a dose of 50 ppm.
- a single immunization (0.1 mL / fish) was performed intraperitoneally in the ventral midline with a 1 mL syringe and 25G x 5/8 "needle.
- the control group was vaccinated with 0.1 ml / fish of sterile PBS and marked with a fatty fin cut for subsequent identification No injection site reactions / tissue damage / survival were observed After the vaccination, the fish were deposited in the identified ponds where they remained without being subjected to stressful handling until the completion of their immunization period At 450-500 UTA, the fish were transferred to ponds with seawater (25ppt), prior to the challenge with the infecting stages of C. rogercresseyi During this period the temperature was monitored daily
- Serum and mucus samples were taken prior to vaccination, at the time of challenge and every 10 days after it to determine the immunological response to the vaccine. The average parasite load of the challenged fish was determined. Challenge with C. rogercresseyi
- ovigerous females were collected and collected weekly with fine tweezers from a filter of an Atlantic Salmon processing plant.
- the samples were sent to the laboratory transported in plastic containers containing seawater with a constant aeration system.
- the naupliary stages were removed and deposited in beakers containing 600 ml of filtered and sterilized sea water with constant aeration. They were kept in a Hotcold-S culture chamber at an average temperature of 13 ° C, until the copepodites emerged. Once the infective stages were obtained, the Neubauer chamber count was performed, the specimens being concentrated in 4000 copepodites / 600 mL of filtered water.
- the challenge was made when the fish reached 600UTA, introducing 4000 copepoditos (in the indicated volume of filtered seawater) every 50 fish / pond, and a 50% fixation rate was expected.
- the water level was reduced to 50%, the oxygen flow and the water flow stopped for 6 hours after infection (static flow), after which it resumed and the water flow rate remained at 0.5 liters / hour so that it does not impact the fixation of C rogercresseyi.
- the control group was vaccinated with 0.1 ml / fish of sterile PBS and labeled with fat fin for subsequent identification. Reactions were collected at the injection site. / tissue damage / survival The challenge was made when the Atlantic salmon reached a weight of 80g, at 600UTA.
- Serum and mucus samples were taken to determine by ELISA the specific antibody titer from day 0 or pre-immune, at 10, 20, 30, 40 days, to the challenge (50 days) and every 10 days post challenge until 120 days post-vaccination (dpv)
- the 220 kDa (SEQ ID N ° 1), 212 kDa (SEQ ID N ° 2) and 173 kDa (SEQ ID N ° 3) proteins at a concentration of 50 ⁇ g / mL were used as capture antigen.
- the secondary antibody used was anti-coM salmon IgM (Oncorhyncus kisutch) (monoclonal fraction IgGl) (Bios-Bios Chile Group) and as peroxidase-labeled IgG Anti-mouse conjugate antibody (Dako Denmark goat anti-mouse) and as ABTS substrate (2 , 2'-azino-bis (3-ethylbenzothiazoline-6-sulphonic acid).
- samples of the epidermis of the scalpel fish were taken, making cuts in the abdominal and lateral areas of the fish on days 10-10-20-30-40-50.80 and 120.
- the cuts were embedded in formalin buffer 4% and stained with the staining of PAS (periodic acid-Shiff) and PAS-Alcian Blue.
- the mucus was obtained by scraping the surface of the fish with a scalpel.
- the extracted material was placed in 15 mL tubes with 2 mL of PBS + protease inhibitor cocktail (Promega G6521 50X) to obtain a dense suspension. It was centrifuged at 3000g for 10 minutes and the supernatant that was kept at -20 ° C was taken. Samples were tested in duplicate and undiluted. Five serum and mucus samples were taken per group and per sampling time for serum analysis, using 3 samples for histological analysis.
- Tadiso TM Krasnov A, Skugor S, Afanasyev S, Hordvik I, Nilsen F.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Tropical Medicine & Parasitology (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Description
Claims
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB1421363.1A GB2522119A (en) | 2012-05-17 | 2012-05-17 | Peptides inducing an immune response against copepods and/or the development of a mucous shield in fish |
CA2873599A CA2873599A1 (en) | 2012-05-17 | 2012-05-17 | Peptides inducing an immune response against copepods and/or the development of a mucous shield in fish; vaccines, uses and methods for modulating the fish immune response and/or for inducing development of a mucous shield in fish |
PCT/IB2012/052487 WO2013171548A2 (es) | 2012-05-17 | 2012-05-17 | Peptidos que inducen en peces una respuesta inmune contra copepodos y/o un escudo mucoso, vacunas, usos y métodos para modular la respuesta inmune de un pez y/o inducir la generación de un escudo mucoso |
ARP130101697A AR092320A1 (es) | 2012-05-17 | 2013-05-16 | Peptidos que inducen en peces una respuesta inmune contra copepodos y/o un escudo mucoso, vacunas, usos y metodos para modular la respuesta inmune de un pez y/o inducir la generacion de un escudo mucoso |
NO20141508A NO342822B1 (no) | 2012-05-17 | 2014-12-12 | Vaksine som induserer en immunrespons mot kopepoder og/eller et slimskjold hos fisk omfattende peptidkombinasjoner, og anvendelse av peptidene for fremstilling av en vaksine. |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/IB2012/052487 WO2013171548A2 (es) | 2012-05-17 | 2012-05-17 | Peptidos que inducen en peces una respuesta inmune contra copepodos y/o un escudo mucoso, vacunas, usos y métodos para modular la respuesta inmune de un pez y/o inducir la generación de un escudo mucoso |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2013171548A2 true WO2013171548A2 (es) | 2013-11-21 |
Family
ID=49584397
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/IB2012/052487 WO2013171548A2 (es) | 2012-05-17 | 2012-05-17 | Peptidos que inducen en peces una respuesta inmune contra copepodos y/o un escudo mucoso, vacunas, usos y métodos para modular la respuesta inmune de un pez y/o inducir la generación de un escudo mucoso |
Country Status (5)
Country | Link |
---|---|
AR (1) | AR092320A1 (es) |
CA (1) | CA2873599A1 (es) |
GB (1) | GB2522119A (es) |
NO (1) | NO342822B1 (es) |
WO (1) | WO2013171548A2 (es) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023080791A1 (en) * | 2021-11-08 | 2023-05-11 | Kapp Det Gode Håp As | Peptides for the inhibition of parasite infection |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
NO343723B1 (en) * | 2016-06-10 | 2019-05-20 | Aqua Health As | Peptides for the inhibition of trypsin and sea lice infestation. |
NO343281B1 (en) * | 2016-12-30 | 2019-01-14 | Aqua Health As | Peptides for the inhibition of trypsin and sea lice infestation. |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2575156T3 (es) * | 2004-07-28 | 2016-06-24 | National Research Council Of Canada | Vacunas recombinantes contra copépodos caligidae (piojo de mar) y sus secuencias antigénicas |
CU23919B1 (es) * | 2010-09-28 | 2013-07-31 | Ct De Ingeniería Genética Y Biotecnología | Composición vacunal para el control de las infestaciones por ectoparásitos |
-
2012
- 2012-05-17 GB GB1421363.1A patent/GB2522119A/en not_active Withdrawn
- 2012-05-17 WO PCT/IB2012/052487 patent/WO2013171548A2/es active Application Filing
- 2012-05-17 CA CA2873599A patent/CA2873599A1/en not_active Abandoned
-
2013
- 2013-05-16 AR ARP130101697A patent/AR092320A1/es unknown
-
2014
- 2014-12-12 NO NO20141508A patent/NO342822B1/no unknown
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023080791A1 (en) * | 2021-11-08 | 2023-05-11 | Kapp Det Gode Håp As | Peptides for the inhibition of parasite infection |
Also Published As
Publication number | Publication date |
---|---|
AR092320A1 (es) | 2015-04-15 |
NO342822B1 (no) | 2018-08-13 |
GB201421363D0 (en) | 2015-01-14 |
NO20141508A1 (no) | 2015-02-05 |
GB2522119A (en) | 2015-07-15 |
CA2873599A1 (en) | 2013-11-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
ES2968398T3 (es) | Composiciones y métodos para potenciar las respuestas inmunitarias a Eimeria o limitar la infección por Eimeria | |
Newton et al. | Protection against multiply drug-resistant and geographically distant strains of Haemonchus contortus by vaccination with H11, a gut membrane-derived protective antigen | |
WO2012041260A1 (es) | Composicion vacunal para el control de las infestaciones por ectoparasitos. | |
WO2013171548A2 (es) | Peptidos que inducen en peces una respuesta inmune contra copepodos y/o un escudo mucoso, vacunas, usos y métodos para modular la respuesta inmune de un pez y/o inducir la generación de un escudo mucoso | |
RU2580294C2 (ru) | Применение расар в качестве молекулярного адъюванта для вакцин | |
RU2677347C2 (ru) | Вакцина против клещей рода rhipicephalus | |
DK202170436A1 (en) | Sea Lice Vaccines | |
ES2360430T3 (es) | Vacuna sintética para el control de garrapatas. | |
DK202070544A1 (en) | Sea lice antigens and vaccines | |
JP7281208B2 (ja) | SseJタンパク質を用いたサルモネラワクチン | |
BG99888A (bg) | Приложението на антихелминтни ваксини при лечение на паразитно заболяване,свързано със загуба на естествения имунитет | |
JP4925236B2 (ja) | マダニセメントタンパク質を含むワクチン | |
WO2014037592A1 (es) | Proteína recombinante de haemonchus contortus y su aplicación para la producción de una vacuna frente a la hemoncosis | |
CUNHA et al. | rROP2 from Toxoplasma gondii as a potential vaccine against oocyst shedding in domestic cats | |
WO2018082719A1 (es) | Uso de peptido secretagogo de la hormona de crecimiento como adyuvante vacunal | |
BR102019021511A2 (pt) | Método de produção de proteínas recombinantes do toxocara canis, visadas como vacina para controle da toxocaríase canina | |
Esteves | Plathylemimth fatty acid binding proteins as candidate vaccines | |
Carroll | Babesia microti Recombinant DNA Vaccine as a Model for Babesia bovis Prevention | |
El Hakim et al. | Purification and Characterization of two glycoproteins from the cattle tick Boophilus annulatus |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12877071 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 2873599 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2014003096 Country of ref document: CL |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 1421363 Country of ref document: GB Kind code of ref document: A Free format text: PCT FILING DATE = 20120517 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1421363.1 Country of ref document: GB |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 12877071 Country of ref document: EP Kind code of ref document: A2 |